5AXOA

Crystal structure of metallo-beta-lactamase smb-1 bound to hydrolyzed meropenem
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
259
structure length
259
Chain Sequence
b'RDWSSPQQPFTIYGNTHYVGTGGISAVLLSSPQGHILVDGTTEKGAQVVAANIRAMGFKLSDVKYILSTHSHEDHAGGISAMQKLTGATVLAGAANVDTLRTGVSPKSDPQFGSLSNFPGSAKVRAVADGELVKLGPLAVKAHATPGHTEGGITWTWQSCEQGKCKDVVFADSLTAVSADSYRFSDHPEVVASLRGSFEAVEKLSCDIAIAAHPEVNDMWTRQQRAAKEGNSAYVDNGACRAIAAAGRKRLETRLASEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metallo-beta-lactamase
publication title Crystal Structure of Metallo-beta-Lactamase SMB-1 Bound to Hydrolyzed Meropenem
rcsb
source organism Serratia marcescens
molecule tags Hydrolase
total genus 87
structure length 259
sequence length 259
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5axoA00
2FU6A 3BK1A 2WYMA 1WUOA 4ZEJA 2NZEA 4ZO3A 4EXSA 5ACSA 1YCHA 5AXRA 1DXKA 1E5DA 2FHXA 4Z5YA 3IOGA 4D1WA 4WD6A 3T3NA 3X2ZA 2CBNA 4H0DA 4BP0A 5LLDA 4UWRB 4RBSA 5EV6A 1KO3A 4EXYA 3X2XA 4RL0A 4J5HA 2XR1A 5LCAA 4UWSB 2AZ4A 3KNSA 1JJTA 2GFKA 1SMLA 2BG6A 2Q9UA 4NQ6A 2BIBA 2Q42A 5ACQA 4FSBA 4O98A 4HL2A 2P1EA 3LVZA 3ESHA 3RPCA 1A8TA 4J5FA 3IDZA 2ZO4A 3S0ZA 3PY5A 5K0WA 5ACVA 2GCUA 1YCFA 4FEKA 2YCBA 2BFZB 3QH8A 2VW8A 5K4KA 5IQKA 1WW1A 4NQ2A 4JO0A 3RKKA 3VQZA 2A7MA 1DDKA 3ZQ4A 2BG2A 4BZ3A 2I7VA 2Y8AA 3R2UA 5HH5A 2BTNA 2BFKA 2ZNBA 5FQAA 4UA4A 4C1FA 1A7TA 5EVKA 1K07A 4EYLA 2H6AA 2BG8B 3IE2A 5HIOA 5ACWA 4AD9A 4XUKA 1P9EA 4TZFA 3FAIA 3TP9A 4UBQA 4EFZA 2QINA 3H3EA 1ZNBA 3KL7A 1WRAA 4GYQA 4Z7RA 5HIQA 1Y44A 4XWTA 5A5ZA 5AYAA 4PVOA 3ZNBA 3F9OA 4D1TA 4ZNBA 3DHCA 5LE1A 5K4MA 2FU9A 4V0HA 4ZO2A 3G1PA 3BK2A 2BG8A 3DHBA 4PVTA 3VPEA 4EY2A 5LSCA 2NYPA 4RAWA 5DPXA 2FM6A 2BFLA 5ACPA 3I13A 4AX1B 4AWZA 4AWYB 1WUPA 3A4YA 1KO2A 2FU8A 4XWWA 2HB9A 2I7TA 1DD6A 3ZR9A 4D1VA 5ACUA 2Q0JA 3FCZA 5A0VA 3IE1A 4TZ9A 1HLKA 1YCGA 4YSBA 1L9YA 3I0VA 4TYTA 3X2YA 4C1EA 1MQOA 2FU7A 3IOFA 5LCHA 5AEBA 1X8GA 2M5DA 3BC2A 3T3OA 2NZFA 3PG4A 3IELA 2Y87A 4F6ZA 2OHHA 5KIKA 5EH9A 2BC2A 2YNTB 5ACXA 5HISA 5B3RA 2P18A 1KR3A 5AHRA 3SFPA 2Q0IA 5FQCA 3DH8A 3IE0A 4EYBA 3ZWFA 2BMIA 4GYUA 3I15A 1QH3A 5AHOA 3I14A 2UYXA 4C1HA 4DILA 4DIKA 3WXCA 4F6HA 2YNWA 2OHIA 4Z6XA 2BFZA 5KILA 3BV6A 4YSLA 3SW3A 2P4ZA 2QJSA 3X30A 2Y8BA 4HKYA 1XTOA 5LS3A 3SD9A 5EV8A 4C1GA 1BMCA 2DOOA 2YNUA 1M2XA 3AF6A 2FK6A 2WHGA 3MD7A 5A87A 5AXOA 4NQ5A 4RM5A 2WYMC 5HIPA 2ZZIA 5EW0A 4RAMA 3SPUA 4P62A 5B15A 5EWAA 1BVTA 5HH6A 2R2DA 3I11A 2OHJA 4TZBA 2P97A 3AF5A 2ZWRA 4KEPA 3Q6VA 5FQBA 5HH4A 5EVDA 2BGAA 2GFJA 4Z5ZA 4UAMA 1BC2A 5LM6A 2DKFA 4FR7A 3PY6A 4YSKA 3KNRA 2NXAA 4U4LA 2AIOA 4GCWA 5LMCA 2GKLA 4UWPB 3JXPA 4B87A 2QDSA 2XF4A 4TYFA 4C1CA 2YZ3A 4HL1A 1VGNA 4AX0B 2E7YA 2BR6A 1X8HA 4NQ4A 4C1DA 3P2UA 5EHTA 3IEKA 2QEDA 2WRSA 4LE6A 2GMNA 1JJEA 2YNVB 3RKJA 3L6NA 4D02A 4C09A 2WYLA 3DHAA 3T9MA 1VMEA 3SBLA 5ACRA 5K4NA 4TZEA 2BG7A 3ADRA 5EVBA 3IEMA 5LCFA 1X8IA 1XM8A 5ACTA 4D1UA 3AJ3A 1ZTCA 4Z60A 4RL2A 2QDTA 4CHLA 2FHXB 2I7XA 3SRXA 2YNTA 5B1UA 4Z67A 4UWOB 1QH5A 4EYFA 1ZKPA 1VJNA 2M5CA 2YNVA 4KEQA 1JT1A 5A0TA
chains in the Genus database with same CATH superfamily
2FU6A 5A23A 3BK1A 2WYMA 1WUOA 4ZEJA 2NZEA 4ZO3A 4EXSA 5ACSA 1YCHA 5AXRA 1DXKA 1E5DA 2FHXA 4Z5YA 3IOGA 4D1WA 4WD6A 3T3NA 3X2ZA 2CBNA 4H0DA 4BP0A 5LLDA 4UWRB 4RBSA 5EV6A 1KO3A 4EXYA 3X2XA 4RL0A 4J5HA 2XR1A 5LCAA 4UWSB 2AZ4A 3KNSA 4PDXA 1JJTA 2GFKA 1SMLA 2BG6A 2Q9UA 4NQ6A 2BIBA 2Q42A 5ACQA 4FSBA 4O98A 2CFUA 4HL2A 2P1EA 3LVZA 3ESHA 3RPCA 1A8TA 4J5FA 3IDZA 2ZO4A 3S0ZA 3PY5A 5K0WA 5ACVA 2GCUA 1YCFA 4FEKA 2YCBA 2BFZB 3QH8A 2VW8A 5K4KA 5IQKA 1WW1A 4NQ2A 4JO0A 3RKKA 3VQZA 2A7MA 1DDKA 3ZQ4A 2BG2A 4BZ3A 2I7VA 2Y8AA 4AV7A 3R2UA 5HH5A 2BTNA 2BFKA 2ZNBA 5FQAA 4UA4A 4C1FA 1A7TA 5EVKA 1K07A 4EYLA 2H6AA 2BG8B 3IE2A 5HIOA 5ACWA 4AD9A 4XUKA 1P9EA 4TZFA 3FAIA 3TP9A 4UBQA 4EFZA 2QINA 3H3EA 1ZNBA 3KL7A 1WRAA 4GYQA 4Z7RA 5HIQA 1Y44A 4XWTA 5A5ZA 5AYAA 4PVOA 3ZNBA 3F9OA 4D1TA 4ZNBA 3DHCA 5LE1A 5K4MA 2FU9A 4V0HA 5AJLA 4ZO2A 3G1PA 3BK2A 2BG8A 3DHBA 4PVTA 3VPEA 4EY2A 5LSCA 2NYPA 4RAWA 5DPXA 2FM6A 2BFLA 5ACPA 3I13A 4AX1B 4AWZA 4AWYB 1WUPA 3A4YA 1KO2A 2FU8A 4XWWA 2HB9A 2I7TA 1DD6A 3ZR9A 4D1VA 2CG3A 5ACUA 2Q0JA 3FCZA 5A0VA 3IE1A 4TZ9A 1HLKA 1YCGA 4YSBA 1L9YA 3I0VA 4TYTA 3X2YA 4C1EA 1MQOA 2FU7A 3IOFA 2YHEA 5LCHA 5AEBA 1X8GA 2M5DA 3BC2A 3T3OA 2NZFA 3PG4A 3IELA 2Y87A 4F6ZA 2OHHA 5KIKA 5EH9A 2BC2A 4AXHA 2YNTB 5ACXA 5HISA 5B3RA 2P18A 1KR3A 5AHRA 3SFPA 2Q0IA 5FQCA 3DH8A 3IE0A 4EYBA 3ZWFA 2BMIA 4GYUA 3I15A 1QH3A 5AHOA 3I14A 2UYXA 4C1HA 4DILA 4DIKA 3WXCA 4F6HA 2YNWA 4NURA 2OHIA 4Z6XA 2BFZA 5KILA 3BV6A 4YSLA 3SW3A 2P4ZA 2QJSA 3X30A 2Y8BA 4HKYA 1XTOA 5LS3A 3SD9A 5EV8A 4C1GA 1BMCA 2DOOA 2YNUA 1M2XA 3AF6A 2FK6A 2WHGA 3MD7A 5A87A 5AXOA 4NQ5A 4RM5A 2WYMC 5HIPA 2ZZIA 5EW0A 4RAMA 3SPUA 4P62A 5B15A 5EWAA 1BVTA 5HH6A 2R2DA 3I11A 2OHJA 4TZBA 2P97A 3AF5A 2ZWRA 4KEPA 3Q6VA 5FQBA 5HH4A 5EVDA 2BGAA 2GFJA 4Z5ZA 4UAMA 1BC2A 5LM6A 2DKFA 2CFZA 4FR7A 3PY6A 4YSKA 3KNRA 2NXAA 4U4LA 2AIOA 4GCWA 5LMCA 2GKLA 4UWPB 3JXPA 4B87A 2QDSA 2XF4A 4TYFA 4C1CA 2YZ3A 4HL1A 2CG2A 1VGNA 4AX0B 2E7YA 2BR6A 1X8HA 4NQ4A 4C1DA 3P2UA 5EHTA 3IEKA 2QEDA 2WRSA 4LE6A 2GMNA 1JJEA 2YNVB 3RKJA 3L6NA 4D02A 4C09A 2WYLA 3DHAA 3T9MA 1VMEA 3SBLA 5ACRA 5K4NA 4TZEA 2BG7A 3ADRA 5EVBA 3IEMA 5LCFA 1X8IA 1XM8A 5ACTA 4D1UA 3AJ3A 1ZTCA 4Z60A 4RL2A 2QDTA 4CHLA 2FHXB 2I7XA 3SRXA 2YNTA 5B1UA 4Z67A 4UWOB 5AIJA 1QH5A 4EYFA 1ZKPA 1VJNA 2M5CA 2YNVA 4KEQA 1JT1A 5A0TA
chains in the Genus database with same CATH topology
2FU6A 3BK1A 2WYMA 1WUOA 4ZEJA 2NZEA 4ZO3A 4EXSA 5ACSA 1YCHA 5AXRA 1DXKA 1E5DA 2FHXA 4Z5YA 3IOGA 4D1WA 4WD6A 3T3NA 3X2ZA 2CBNA 4H0DA 4BP0A 5LLDA 4UWRB 4RBSA 5EV6A 1KO3A 4EXYA 3X2XA 4RL0A 4J5HA 2XR1A 5LCAA 4UWSB 2AZ4A 3KNSA 1JJTA 2GFKA 1SMLA 2BG6A 2Q9UA 4NQ6A 2BIBA 2Q42A 5ACQA 4FSBA 4O98A 4HL2A 2P1EA 3LVZA 3ESHA 3RPCA 1A8TA 4J5FA 3IDZA 2ZO4A 3S0ZA 3PY5A 5K0WA 5ACVA 2GCUA 1YCFA 4FEKA 2YCBA 2BFZB 3QH8A 2VW8A 5K4KA 5IQKA 1WW1A 4NQ2A 4JO0A 3RKKA 3VQZA 2A7MA 1DDKA 3ZQ4A 2BG2A 4BZ3A 2I7VA 2Y8AA 3R2UA 5HH5A 2BTNA 2BFKA 2ZNBA 5FQAA 4UA4A 4C1FA 1A7TA 5EVKA 1K07A 4EYLA 2H6AA 2BG8B 3IE2A 5HIOA 5ACWA 4AD9A 4XUKA 1P9EA 4TZFA 3FAIA 3TP9A 4UBQA 4EFZA 2QINA 3H3EA 1ZNBA 3KL7A 1WRAA 4GYQA 4Z7RA 5HIQA 1Y44A 4XWTA 5A5ZA 5AYAA 4PVOA 3ZNBA 3F9OA 4D1TA 4ZNBA 3DHCA 5LE1A 5K4MA 2FU9A 4V0HA 4ZO2A 3G1PA 3BK2A 2BG8A 3DHBA 4PVTA 3VPEA 4EY2A 5LSCA 2NYPA 4RAWA 5DPXA 2FM6A 2BFLA 5ACPA 3I13A 4AX1B 4AWZA 4AWYB 1WUPA 3A4YA 1KO2A 2FU8A 4XWWA 2HB9A 2I7TA 1DD6A 3ZR9A 4D1VA 5ACUA 2Q0JA 3FCZA 5A0VA 3IE1A 4TZ9A 1HLKA 1YCGA 4YSBA 1L9YA 3I0VA 4TYTA 3X2YA 4C1EA 1MQOA 2FU7A 3IOFA 5LCHA 5AEBA 1X8GA 2M5DA 3BC2A 3T3OA 2NZFA 3PG4A 3IELA 2Y87A 4F6ZA 2OHHA 5KIKA 5EH9A 2BC2A 2YNTB 5ACXA 5HISA 5B3RA 2P18A 1KR3A 5AHRA 3SFPA 2Q0IA 5FQCA 3DH8A 3IE0A 4EYBA 3ZWFA 2BMIA 4GYUA 3I15A 1QH3A 5AHOA 3I14A 2UYXA 4C1HA 4DILA 4DIKA 3WXCA 4F6HA 2YNWA 2OHIA 4Z6XA 2BFZA 5KILA 3BV6A 4YSLA 3SW3A 2P4ZA 2QJSA 3X30A 2Y8BA 4HKYA 1XTOA 5LS3A 3SD9A 5EV8A 4C1GA 1BMCA 2DOOA 2YNUA 1M2XA 3AF6A 2FK6A 2WHGA 3MD7A 5A87A 5AXOA 4NQ5A 4RM5A 2WYMC 5HIPA 2ZZIA 5EW0A 4RAMA 3SPUA 4P62A 5B15A 5EWAA 1BVTA 5HH6A 2R2DA 3I11A 2OHJA 4TZBA 2P97A 3AF5A 2ZWRA 4KEPA 3Q6VA 5FQBA 5HH4A 5EVDA 2BGAA 2GFJA 4Z5ZA 4UAMA 1BC2A 5LM6A 2DKFA 4FR7A 3PY6A 4YSKA 3KNRA 2NXAA 4U4LA 2AIOA 4GCWA 5LMCA 2GKLA 4UWPB 3JXPA 4B87A 2QDSA 2XF4A 4TYFA 4C1CA 2YZ3A 4HL1A 1VGNA 4AX0B 2E7YA 2BR6A 1X8HA 4NQ4A 4C1DA 3P2UA 5EHTA 3IEKA 2QEDA 2WRSA 4LE6A 2GMNA 1JJEA 2YNVB 3RKJA 3L6NA 4D02A 4C09A 2WYLA 3DHAA 3T9MA 1VMEA 3SBLA 5ACRA 5K4NA 4TZEA 2BG7A 3ADRA 5EVBA 3IEMA 5LCFA 1X8IA 1XM8A 5ACTA 4D1UA 3AJ3A 1ZTCA 4Z60A 4RL2A 2QDTA 4CHLA 2FHXB 2I7XA 3SRXA 2YNTA 5B1UA 4Z67A 4UWOB 1QH5A 4EYFA 1ZKPA 1VJNA 2M5CA 2YNVA 4KEQA 1JT1A 5A0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FU6 A;  3BK1 A;  2WYM A;  1WUO A;  4ZEJ A;  2NZE A;  4ZO3 A;  4EXS A;  5ACS A;  1YCH A;  5AXR A;  1DXK A;  1E5D A;  2FHX A;  4Z5Y A;  3IOG A;  4D1W A;  4WD6 A;  3T3N A;  3X2Z A;  2CBN A;  4H0D A;  4BP0 A;  5LLD A;  4UWR B;  4RBS A;  5EV6 A;  1KO3 A;  4EXY A;  3X2X A;  4RL0 A;  4J5H A;  2XR1 A;  5LCA A;  4UWS B;  2AZ4 A;  3KNS A;  1JJT A;  2GFK A;  1SML A;  2BG6 A;  2Q9U A;  4NQ6 A;  2BIB A;  2Q42 A;  5ACQ A;  4FSB A;  4O98 A;  4HL2 A;  2P1E A;  3LVZ A;  3ESH A;  3RPC A;  1A8T A;  4J5F A;  3IDZ A;  2ZO4 A;  3S0Z A;  3PY5 A;  5K0W A;  5ACV A;  2GCU A;  1YCF A;  4FEK A;  2YCB A;  2BFZ B;  3QH8 A;  2VW8 A;  5K4K A;  5IQK A;  1WW1 A;  4NQ2 A;  4JO0 A;  3RKK A;  3VQZ A;  2A7M A;  1DDK A;  3ZQ4 A;  2BG2 A;  4BZ3 A;  2I7V A;  2Y8A A;  3R2U A;  5HH5 A;  2BTN A;  2BFK A;  2ZNB A;  5FQA A;  4UA4 A;  4C1F A;  1A7T A;  5EVK A;  1K07 A;  4EYL A;  2H6A A;  2BG8 B;  3IE2 A;  5HIO A;  5ACW A;  4AD9 A;  4XUK A;  1P9E A;  4TZF A;  3FAI A;  3TP9 A;  4UBQ A;  4EFZ A;  2QIN A;  3H3E A;  1ZNB A;  3KL7 A;  1WRA A;  4GYQ A;  4Z7R A;  5HIQ A;  1Y44 A;  4XWT A;  5A5Z A;  5AYA A;  4PVO A;  3ZNB A;  3F9O A;  4D1T A;  4ZNB A;  3DHC A;  5LE1 A;  5K4M A;  2FU9 A;  4V0H A;  4ZO2 A;  3G1P A;  3BK2 A;  2BG8 A;  3DHB A;  4PVT A;  3VPE A;  4EY2 A;  5LSC A;  2NYP A;  4RAW A;  5DPX A;  2FM6 A;  2BFL A;  5ACP A;  3I13 A;  4AX1 B;  4AWZ A;  4AWY B;  1WUP A;  3A4Y A;  1KO2 A;  2FU8 A;  4XWW A;  2HB9 A;  2I7T A;  1DD6 A;  3ZR9 A;  4D1V A;  5ACU A;  2Q0J A;  3FCZ A;  5A0V A;  3IE1 A;  4TZ9 A;  1HLK A;  1YCG A;  4YSB A;  1L9Y A;  3I0V A;  4TYT A;  3X2Y A;  4C1E A;  1MQO A;  2FU7 A;  3IOF A;  5LCH A;  5AEB A;  1X8G A;  2M5D A;  3BC2 A;  3T3O A;  2NZF A;  3PG4 A;  3IEL A;  2Y87 A;  4F6Z A;  2OHH A;  5KIK A;  5EH9 A;  2BC2 A;  2YNT B;  5ACX A;  5HIS A;  5B3R A;  2P18 A;  1KR3 A;  5AHR A;  3SFP A;  2Q0I A;  5FQC A;  3DH8 A;  3IE0 A;  4EYB A;  3ZWF A;  2BMI A;  4GYU A;  3I15 A;  1QH3 A;  5AHO A;  3I14 A;  2UYX A;  4C1H A;  4DIL A;  4DIK A;  3WXC A;  4F6H A;  2YNW A;  2OHI A;  4Z6X A;  2BFZ A;  5KIL A;  3BV6 A;  4YSL A;  3SW3 A;  2P4Z A;  2QJS A;  3X30 A;  2Y8B A;  4HKY A;  1XTO A;  5LS3 A;  3SD9 A;  5EV8 A;  4C1G A;  1BMC A;  2DOO A;  2YNU A;  1M2X A;  3AF6 A;  2FK6 A;  2WHG A;  3MD7 A;  5A87 A;  5AXO A;  4NQ5 A;  4RM5 A;  2WYM C;  5HIP A;  2ZZI A;  5EW0 A;  4RAM A;  3SPU A;  4P62 A;  5B15 A;  5EWA A;  1BVT A;  5HH6 A;  2R2D A;  3I11 A;  2OHJ A;  4TZB A;  2P97 A;  3AF5 A;  2ZWR A;  4KEP A;  3Q6V A;  5FQB A;  5HH4 A;  5EVD A;  2BGA A;  2GFJ A;  4Z5Z A;  4UAM A;  1BC2 A;  5LM6 A;  2DKF A;  4FR7 A;  3PY6 A;  4YSK A;  3KNR A;  2NXA A;  4U4L A;  2AIO A;  4GCW A;  5LMC A;  2GKL A;  4UWP B;  3JXP A;  4B87 A;  2QDS A;  2XF4 A;  4TYF A;  4C1C A;  2YZ3 A;  4HL1 A;  1VGN A;  4AX0 B;  2E7Y A;  2BR6 A;  1X8H A;  4NQ4 A;  4C1D A;  3P2U A;  5EHT A;  3IEK A;  2QED A;  2WRS A;  4LE6 A;  2GMN A;  1JJE A;  2YNV B;  3RKJ A;  3L6N A;  4D02 A;  4C09 A;  2WYL A;  3DHA A;  3T9M A;  1VME A;  3SBL A;  5ACR A;  5K4N A;  4TZE A;  2BG7 A;  3ADR A;  5EVB A;  3IEM A;  5LCF A;  1X8I A;  1XM8 A;  5ACT A;  4D1U A;  3AJ3 A;  1ZTC A;  4Z60 A;  4RL2 A;  2QDT A;  4CHL A;  2FHX B;  2I7X A;  3SRX A;  2YNT A;  5B1U A;  4Z67 A;  4UWO B;  1QH5 A;  4EYF A;  1ZKP A;  1VJN A;  2M5C A;  2YNV A;  4KEQ A;  1JT1 A;  5A0T A; 
#chains in the Genus database with same CATH topology
 2FU6 A;  5A23 A;  3BK1 A;  2WYM A;  1WUO A;  4ZEJ A;  2NZE A;  4ZO3 A;  4EXS A;  5ACS A;  1YCH A;  5AXR A;  1DXK A;  1E5D A;  2FHX A;  4Z5Y A;  3IOG A;  4D1W A;  4WD6 A;  3T3N A;  3X2Z A;  2CBN A;  4H0D A;  4BP0 A;  5LLD A;  4UWR B;  4RBS A;  5EV6 A;  1KO3 A;  4EXY A;  3X2X A;  4RL0 A;  4J5H A;  2XR1 A;  5LCA A;  4UWS B;  2AZ4 A;  3KNS A;  4PDX A;  1JJT A;  2GFK A;  1SML A;  2BG6 A;  2Q9U A;  4NQ6 A;  2BIB A;  2Q42 A;  5ACQ A;  4FSB A;  4O98 A;  2CFU A;  4HL2 A;  2P1E A;  3LVZ A;  3ESH A;  3RPC A;  1A8T A;  4J5F A;  3IDZ A;  2ZO4 A;  3S0Z A;  3PY5 A;  5K0W A;  5ACV A;  2GCU A;  1YCF A;  4FEK A;  2YCB A;  2BFZ B;  3QH8 A;  2VW8 A;  5K4K A;  5IQK A;  1WW1 A;  4NQ2 A;  4JO0 A;  3RKK A;  3VQZ A;  2A7M A;  1DDK A;  3ZQ4 A;  2BG2 A;  4BZ3 A;  2I7V A;  2Y8A A;  4AV7 A;  3R2U A;  5HH5 A;  2BTN A;  2BFK A;  2ZNB A;  5FQA A;  4UA4 A;  4C1F A;  1A7T A;  5EVK A;  1K07 A;  4EYL A;  2H6A A;  2BG8 B;  3IE2 A;  5HIO A;  5ACW A;  4AD9 A;  4XUK A;  1P9E A;  4TZF A;  3FAI A;  3TP9 A;  4UBQ A;  4EFZ A;  2QIN A;  3H3E A;  1ZNB A;  3KL7 A;  1WRA A;  4GYQ A;  4Z7R A;  5HIQ A;  1Y44 A;  4XWT A;  5A5Z A;  5AYA A;  4PVO A;  3ZNB A;  3F9O A;  4D1T A;  4ZNB A;  3DHC A;  5LE1 A;  5K4M A;  2FU9 A;  4V0H A;  5AJL A;  4ZO2 A;  3G1P A;  3BK2 A;  2BG8 A;  3DHB A;  4PVT A;  3VPE A;  4EY2 A;  5LSC A;  2NYP A;  4RAW A;  5DPX A;  2FM6 A;  2BFL A;  5ACP A;  3I13 A;  4AX1 B;  4AWZ A;  4AWY B;  1WUP A;  3A4Y A;  1KO2 A;  2FU8 A;  4XWW A;  2HB9 A;  2I7T A;  1DD6 A;  3ZR9 A;  4D1V A;  2CG3 A;  5ACU A;  2Q0J A;  3FCZ A;  5A0V A;  3IE1 A;  4TZ9 A;  1HLK A;  1YCG A;  4YSB A;  1L9Y A;  3I0V A;  4TYT A;  3X2Y A;  4C1E A;  1MQO A;  2FU7 A;  3IOF A;  2YHE A;  5LCH A;  5AEB A;  1X8G A;  2M5D A;  3BC2 A;  3T3O A;  2NZF A;  3PG4 A;  3IEL A;  2Y87 A;  4F6Z A;  2OHH A;  5KIK A;  5EH9 A;  2BC2 A;  4AXH A;  2YNT B;  5ACX A;  5HIS A;  5B3R A;  2P18 A;  1KR3 A;  5AHR A;  3SFP A;  2Q0I A;  5FQC A;  3DH8 A;  3IE0 A;  4EYB A;  3ZWF A;  2BMI A;  4GYU A;  3I15 A;  1QH3 A;  5AHO A;  3I14 A;  2UYX A;  4C1H A;  4DIL A;  4DIK A;  3WXC A;  4F6H A;  2YNW A;  4NUR A;  2OHI A;  4Z6X A;  2BFZ A;  5KIL A;  3BV6 A;  4YSL A;  3SW3 A;  2P4Z A;  2QJS A;  3X30 A;  2Y8B A;  4HKY A;  1XTO A;  5LS3 A;  3SD9 A;  5EV8 A;  4C1G A;  1BMC A;  2DOO A;  2YNU A;  1M2X A;  3AF6 A;  2FK6 A;  2WHG A;  3MD7 A;  5A87 A;  5AXO A;  4NQ5 A;  4RM5 A;  2WYM C;  5HIP A;  2ZZI A;  5EW0 A;  4RAM A;  3SPU A;  4P62 A;  5B15 A;  5EWA A;  1BVT A;  5HH6 A;  2R2D A;  3I11 A;  2OHJ A;  4TZB A;  2P97 A;  3AF5 A;  2ZWR A;  4KEP A;  3Q6V A;  5FQB A;  5HH4 A;  5EVD A;  2BGA A;  2GFJ A;  4Z5Z A;  4UAM A;  1BC2 A;  5LM6 A;  2DKF A;  2CFZ A;  4FR7 A;  3PY6 A;  4YSK A;  3KNR A;  2NXA A;  4U4L A;  2AIO A;  4GCW A;  5LMC A;  2GKL A;  4UWP B;  3JXP A;  4B87 A;  2QDS A;  2XF4 A;  4TYF A;  4C1C A;  2YZ3 A;  4HL1 A;  2CG2 A;  1VGN A;  4AX0 B;  2E7Y A;  2BR6 A;  1X8H A;  4NQ4 A;  4C1D A;  3P2U A;  5EHT A;  3IEK A;  2QED A;  2WRS A;  4LE6 A;  2GMN A;  1JJE A;  2YNV B;  3RKJ A;  3L6N A;  4D02 A;  4C09 A;  2WYL A;  3DHA A;  3T9M A;  1VME A;  3SBL A;  5ACR A;  5K4N A;  4TZE A;  2BG7 A;  3ADR A;  5EVB A;  3IEM A;  5LCF A;  1X8I A;  1XM8 A;  5ACT A;  4D1U A;  3AJ3 A;  1ZTC A;  4Z60 A;  4RL2 A;  2QDT A;  4CHL A;  2FHX B;  2I7X A;  3SRX A;  2YNT A;  5B1U A;  4Z67 A;  4UWO B;  5AIJ A;  1QH5 A;  4EYF A;  1ZKP A;  1VJN A;  2M5C A;  2YNV A;  4KEQ A;  1JT1 A;  5A0T A; 
#chains in the Genus database with same CATH homology
 2FU6 A;  3BK1 A;  2WYM A;  1WUO A;  4ZEJ A;  2NZE A;  4ZO3 A;  4EXS A;  5ACS A;  1YCH A;  5AXR A;  1DXK A;  1E5D A;  2FHX A;  4Z5Y A;  3IOG A;  4D1W A;  4WD6 A;  3T3N A;  3X2Z A;  2CBN A;  4H0D A;  4BP0 A;  5LLD A;  4UWR B;  4RBS A;  5EV6 A;  1KO3 A;  4EXY A;  3X2X A;  4RL0 A;  4J5H A;  2XR1 A;  5LCA A;  4UWS B;  2AZ4 A;  3KNS A;  1JJT A;  2GFK A;  1SML A;  2BG6 A;  2Q9U A;  4NQ6 A;  2BIB A;  2Q42 A;  5ACQ A;  4FSB A;  4O98 A;  4HL2 A;  2P1E A;  3LVZ A;  3ESH A;  3RPC A;  1A8T A;  4J5F A;  3IDZ A;  2ZO4 A;  3S0Z A;  3PY5 A;  5K0W A;  5ACV A;  2GCU A;  1YCF A;  4FEK A;  2YCB A;  2BFZ B;  3QH8 A;  2VW8 A;  5K4K A;  5IQK A;  1WW1 A;  4NQ2 A;  4JO0 A;  3RKK A;  3VQZ A;  2A7M A;  1DDK A;  3ZQ4 A;  2BG2 A;  4BZ3 A;  2I7V A;  2Y8A A;  3R2U A;  5HH5 A;  2BTN A;  2BFK A;  2ZNB A;  5FQA A;  4UA4 A;  4C1F A;  1A7T A;  5EVK A;  1K07 A;  4EYL A;  2H6A A;  2BG8 B;  3IE2 A;  5HIO A;  5ACW A;  4AD9 A;  4XUK A;  1P9E A;  4TZF A;  3FAI A;  3TP9 A;  4UBQ A;  4EFZ A;  2QIN A;  3H3E A;  1ZNB A;  3KL7 A;  1WRA A;  4GYQ A;  4Z7R A;  5HIQ A;  1Y44 A;  4XWT A;  5A5Z A;  5AYA A;  4PVO A;  3ZNB A;  3F9O A;  4D1T A;  4ZNB A;  3DHC A;  5LE1 A;  5K4M A;  2FU9 A;  4V0H A;  4ZO2 A;  3G1P A;  3BK2 A;  2BG8 A;  3DHB A;  4PVT A;  3VPE A;  4EY2 A;  5LSC A;  2NYP A;  4RAW A;  5DPX A;  2FM6 A;  2BFL A;  5ACP A;  3I13 A;  4AX1 B;  4AWZ A;  4AWY B;  1WUP A;  3A4Y A;  1KO2 A;  2FU8 A;  4XWW A;  2HB9 A;  2I7T A;  1DD6 A;  3ZR9 A;  4D1V A;  5ACU A;  2Q0J A;  3FCZ A;  5A0V A;  3IE1 A;  4TZ9 A;  1HLK A;  1YCG A;  4YSB A;  1L9Y A;  3I0V A;  4TYT A;  3X2Y A;  4C1E A;  1MQO A;  2FU7 A;  3IOF A;  5LCH A;  5AEB A;  1X8G A;  2M5D A;  3BC2 A;  3T3O A;  2NZF A;  3PG4 A;  3IEL A;  2Y87 A;  4F6Z A;  2OHH A;  5KIK A;  5EH9 A;  2BC2 A;  2YNT B;  5ACX A;  5HIS A;  5B3R A;  2P18 A;  1KR3 A;  5AHR A;  3SFP A;  2Q0I A;  5FQC A;  3DH8 A;  3IE0 A;  4EYB A;  3ZWF A;  2BMI A;  4GYU A;  3I15 A;  1QH3 A;  5AHO A;  3I14 A;  2UYX A;  4C1H A;  4DIL A;  4DIK A;  3WXC A;  4F6H A;  2YNW A;  2OHI A;  4Z6X A;  2BFZ A;  5KIL A;  3BV6 A;  4YSL A;  3SW3 A;  2P4Z A;  2QJS A;  3X30 A;  2Y8B A;  4HKY A;  1XTO A;  5LS3 A;  3SD9 A;  5EV8 A;  4C1G A;  1BMC A;  2DOO A;  2YNU A;  1M2X A;  3AF6 A;  2FK6 A;  2WHG A;  3MD7 A;  5A87 A;  5AXO A;  4NQ5 A;  4RM5 A;  2WYM C;  5HIP A;  2ZZI A;  5EW0 A;  4RAM A;  3SPU A;  4P62 A;  5B15 A;  5EWA A;  1BVT A;  5HH6 A;  2R2D A;  3I11 A;  2OHJ A;  4TZB A;  2P97 A;  3AF5 A;  2ZWR A;  4KEP A;  3Q6V A;  5FQB A;  5HH4 A;  5EVD A;  2BGA A;  2GFJ A;  4Z5Z A;  4UAM A;  1BC2 A;  5LM6 A;  2DKF A;  4FR7 A;  3PY6 A;  4YSK A;  3KNR A;  2NXA A;  4U4L A;  2AIO A;  4GCW A;  5LMC A;  2GKL A;  4UWP B;  3JXP A;  4B87 A;  2QDS A;  2XF4 A;  4TYF A;  4C1C A;  2YZ3 A;  4HL1 A;  1VGN A;  4AX0 B;  2E7Y A;  2BR6 A;  1X8H A;  4NQ4 A;  4C1D A;  3P2U A;  5EHT A;  3IEK A;  2QED A;  2WRS A;  4LE6 A;  2GMN A;  1JJE A;  2YNV B;  3RKJ A;  3L6N A;  4D02 A;  4C09 A;  2WYL A;  3DHA A;  3T9M A;  1VME A;  3SBL A;  5ACR A;  5K4N A;  4TZE A;  2BG7 A;  3ADR A;  5EVB A;  3IEM A;  5LCF A;  1X8I A;  1XM8 A;  5ACT A;  4D1U A;  3AJ3 A;  1ZTC A;  4Z60 A;  4RL2 A;  2QDT A;  4CHL A;  2FHX B;  2I7X A;  3SRX A;  2YNT A;  5B1U A;  4Z67 A;  4UWO B;  1QH5 A;  4EYF A;  1ZKP A;  1VJN A;  2M5C A;  2YNV A;  4KEQ A;  1JT1 A;  5A0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...