4Z5ZA

The 2.5-angstrom crystal structure of mg(2+)-bound pqqb from pseudomonas putida
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
308
structure length
308
Chain Sequence
MMYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIALSDDGVHWILCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLREGCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFPLRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLLVDGTLWEDDEMQRRGVGTRTGREMGHLAQNGPGGTLEVLDGFPRQRKVLIHINNTNPILDENSPERAEVLRRGVEVAFDGMSIELLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures reveal metal-binding plasticity at the active site of PqqB
rcsb
source organism Pseudomonas putida (strain kt2440)
molecule tags Hydrolase
molecule keywords Coenzyme PQQ synthesis protein B
total genus 103
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4z5zA00
3PY6A 2QINA 5A0TA 1YCFA 4U4LA 4FSBA 5K4MA 3DHAA 3L6NA 2YNWA 5HIOA 1P9EA 1WUOA 1YCGA 5EV8A 5FQAA 1ZKPA 3X30A 3SD9A 3ZR9A 3X2XA 4YSBA 4Z5YA 3P2UA 2NZFA 5IQKA 4HL2A 3ADRA 1WW1A 4ZO3A 4AD9A 3IE1A 3BV6A 4FR7A 4C1GA 3TP9A 4GCWA 2ZZIA 3IDZA 2ZNBA 5ACQA 5K0WA 3H3EA 3ZWFA 4H0DA 4UWOB 2FU6A 4Z67A 1X8HA 5LLDA 5ACXA 5K4KA 3IEMA 5DPXA 2BG7A 3AJ3A 4TYFA 3R2UA 2I7XA 4GYQA 5EWAA 3T3OA 4EYLA 2BTNA 5A0VA 2P97A 4EFZA 3SPUA 2Y87A 4EYFA 4UWSB 2YNVA 3IE0A 1K07A 2A7MA 1JJTA 4JO0A 2H6AA 3DHCA 1DD6A 4AWYB 3RPCA 2OHHA 1JT1A 1SMLA 2YNTA 4D02A 5AHOA 4Z6XA 5B1UA 3SFPA 3T3NA 5ACTA 5EH9A 3VQZA 1X8IA 3IE2A 2BG8A 5LCFA 2BG8B 3JXPA 5K4NA 1KO2A 4HKYA 4Z7RA 4RBSA 2BFZB 2NZEA 4DILA 1VMEA 1QH3A 5ACUA 3DHBA 4YSLA 1ZNBA 4Z5ZA 5AYAA 4UA4A 4EYBA 3BK1A 3IEKA 3FCZA 1JJEA 4AWZA 3SRXA 5LSCA 2CBNA 2FHXA 2Y8BA 4NQ2A 4UWPB 3ZQ4A 2GCUA 1X8GA 5HH6A 4KEQA 5AHRA 5LCAA 2P18A 3BK2A 5B15A 5ACWA 2FU8A 2BFLA 2Q42A 2FM6A 3AF6A 2DKFA 1WUPA 2M5CA 4ZO2A 2AZ4A 2WHGA 5B3RA 3Q6VA 4TZBA 2DOOA 5EVKA 4EXSA 5HISA 4D1TA 2FK6A 4RL2A 2R2DA 4XWTA 4PVOA 2FU9A 3ZNBA 2I7TA 4DIKA 2BFZA 5HH4A 4ZNBA 2NYPA 5HIQA 3F9OA 4Z60A 4XWWA 3G1PA 5AEBA 1WRAA 2Q0JA 5EVDA 2GFJA 4C1FA 3VPEA 2Q0IA 2BFKA 2BC2A 2QJSA 4UWRB 4C1DA 5EVBA 4BP0A 5LM6A 4NQ4A 4RAWA 3RKJA 2E7YA 3BC2A 4D1WA 3KNSA 4BZ3A 2FU7A 4LE6A 2YZ3A 2BR6A 2WRSA 1E5DA 5ACPA 3QH8A 2Q9UA 1L9YA 1MQOA 4NQ5A 4ZEJA 1ZTCA 1HLKA 4WD6A 1BVTA 1DDKA 4UAMA 4AX1B 2NXAA 2YCBA 4C09A 4C1EA 4NQ6A 2WYLA 5AXRA 1BMCA 1KR3A 4C1CA 3KNRA 3FAIA 5LE1A 4HL1A 3LVZA 4P62A 3T9MA 4V0HA 4PVTA 5ACVA 5AXOA 3S0ZA 5HIPA 3SBLA 3IOGA 3A4YA 2BGAA 3ESHA 1XM8A 3I11A 2M5DA 3PG4A 4O98A 4UBQA 3X2YA 2I7VA 5EW0A 4RL0A 1XTOA 2YNTB 3WXCA 4EXYA 3MD7A 1VJNA 2BIBA 3I13A 4F6ZA 4B87A 5LS3A 3IOFA 1VGNA 2WYMC 5LMCA 2VW8A 1A8TA 2ZWRA 2GMNA 5HH5A 3AF5A 4EY2A 3I0VA 4D1UA 5KIKA 1QH5A 2FHXB 2UYXA 2AIOA 3I14A 2YNVB 2XF4A 4C1HA 1KO3A 2P1EA 2QDSA 2P4ZA 4FEKA 4TZ9A 1DXKA 5KILA 4RM5A 2OHJA 4RAMA 2GKLA 5ACSA 2ZO4A 2OHIA 3I15A 5FQBA 2WYMA 4GYUA 3PY5A 5LCHA 5A5ZA 4XUKA 1A7TA 5FQCA 4TZFA 5EV6A 4TZEA 4YSKA 3X2ZA 3DH8A 2QEDA 2GFKA 2BG2A 5A87A 3KL7A 1BC2A 2BMIA 2Y8AA 3IELA 1YCHA 1M2XA 4J5HA 4TYTA 1Y44A 3SW3A 4AX0B 2BG6A 2HB9A 2XR1A 4F6HA 4CHLA 3RKKA 2YNUA 5ACRA 4J5FA 5EHTA 2QDTA 4KEPA 4D1VA
chains in the Genus database with same CATH superfamily
3PY6A 2QINA 5A0TA 1YCFA 4U4LA 4FSBA 5K4MA 3DHAA 3L6NA 2YNWA 5HIOA 1P9EA 1WUOA 1YCGA 5EV8A 5FQAA 2CFUA 1ZKPA 3X30A 3SD9A 3ZR9A 3X2XA 4YSBA 4Z5YA 3P2UA 2NZFA 5IQKA 4HL2A 3ADRA 1WW1A 4ZO3A 4AD9A 4PDXA 3BV6A 3IE1A 4FR7A 4C1GA 3TP9A 4GCWA 2ZZIA 3IDZA 2ZNBA 5ACQA 5K0WA 3H3EA 3ZWFA 4H0DA 4UWOB 2FU6A 4Z67A 1X8HA 5LLDA 5ACXA 5K4KA 3IEMA 5DPXA 2BG7A 3AJ3A 4TYFA 3R2UA 2I7XA 4GYQA 5EWAA 3T3OA 4EYLA 2BTNA 5A0VA 2P97A 4EFZA 3SPUA 2Y87A 4EYFA 4UWSB 2YNVA 3IE0A 1K07A 2A7MA 1JJTA 4JO0A 2H6AA 3DHCA 1DD6A 4AWYB 3RPCA 2OHHA 1JT1A 1SMLA 2YNTA 4D02A 5AHOA 4Z6XA 5B1UA 3SFPA 3T3NA 5ACTA 5EH9A 3VQZA 1X8IA 3IE2A 2BG8A 5LCFA 2BG8B 3JXPA 5K4NA 1KO2A 4HKYA 4Z7RA 4RBSA 2BFZB 2NZEA 4DILA 1VMEA 1QH3A 5ACUA 3DHBA 4YSLA 1ZNBA 4Z5ZA 5AYAA 4UA4A 4EYBA 3BK1A 3IEKA 3FCZA 1JJEA 4AWZA 3SRXA 5LSCA 2CBNA 2FHXA 2Y8BA 4NQ2A 4UWPB 3ZQ4A 2GCUA 1X8GA 5HH6A 2YHEA 4KEQA 5AHRA 5LCAA 2P18A 3BK2A 5B15A 5ACWA 2FU8A 2BFLA 2Q42A 2FM6A 3AF6A 2CG3A 2DKFA 1WUPA 2M5CA 4ZO2A 2AZ4A 2WHGA 5B3RA 3Q6VA 4TZBA 2DOOA 5EVKA 4EXSA 5HISA 4D1TA 2FK6A 4RL2A 2R2DA 4XWTA 4PVOA 2FU9A 2CFZA 3ZNBA 2I7TA 4DIKA 2BFZA 5HH4A 4ZNBA 2NYPA 5HIQA 3F9OA 4Z60A 4XWWA 3G1PA 5AEBA 1WRAA 2Q0JA 5EVDA 2GFJA 4C1FA 3VPEA 2Q0IA 2BFKA 2BC2A 2QJSA 4UWRB 4C1DA 5EVBA 4BP0A 4NQ4A 4RAWA 3RKJA 5LM6A 2E7YA 3BC2A 4D1WA 3KNSA 4BZ3A 2FU7A 4LE6A 2YZ3A 2BR6A 2WRSA 1E5DA 5ACPA 3QH8A 2Q9UA 1L9YA 1MQOA 4NQ5A 4ZEJA 1ZTCA 1HLKA 4WD6A 1BVTA 1DDKA 4UAMA 4AX1B 2NXAA 2YCBA 4C09A 4C1EA 4NQ6A 2WYLA 5AXRA 1BMCA 1KR3A 4C1CA 3KNRA 3FAIA 5LE1A 4HL1A 3LVZA 4P62A 3T9MA 4V0HA 4PVTA 5ACVA 5AXOA 3S0ZA 5HIPA 3SBLA 3IOGA 3A4YA 2BGAA 3ESHA 1XM8A 3I11A 2M5DA 3PG4A 4O98A 4UBQA 3X2YA 2I7VA 5EW0A 4RL0A 1XTOA 2YNTB 3WXCA 4EXYA 3MD7A 1VJNA 2BIBA 3I13A 4F6ZA 4B87A 5LS3A 3IOFA 1VGNA 2CG2A 2WYMC 5LMCA 2VW8A 1A8TA 2ZWRA 2GMNA 5HH5A 3AF5A 4EY2A 3I0VA 4D1UA 5AJLA 5KIKA 1QH5A 2FHXB 2UYXA 2AIOA 3I14A 2YNVB 2XF4A 4AXHA 4C1HA 1KO3A 2P1EA 2QDSA 2P4ZA 4NURA 4FEKA 4TZ9A 1DXKA 5KILA 4RM5A 2OHJA 4RAMA 2GKLA 5ACSA 2ZO4A 4AV7A 2OHIA 3I15A 5FQBA 2WYMA 4GYUA 5AIJA 3PY5A 5LCHA 5A5ZA 4XUKA 1A7TA 5FQCA 4TZFA 5EV6A 4TZEA 4YSKA 3X2ZA 3DH8A 2QEDA 2GFKA 5A23A 2BG2A 5A87A 3KL7A 1BC2A 2BMIA 2Y8AA 3IELA 1YCHA 1M2XA 4J5HA 4TYTA 1Y44A 3SW3A 4AX0B 2BG6A 2HB9A 2XR1A 4F6HA 4CHLA 3RKKA 2YNUA 5ACRA 4J5FA 5EHTA 2QDTA 4KEPA 4D1VA
chains in the Genus database with same CATH topology
3PY6A 2QINA 5A0TA 1YCFA 4U4LA 4FSBA 5K4MA 3DHAA 3L6NA 2YNWA 5HIOA 1P9EA 1WUOA 1YCGA 5EV8A 5FQAA 1ZKPA 3X30A 3SD9A 3ZR9A 3X2XA 4YSBA 4Z5YA 3P2UA 2NZFA 5IQKA 4HL2A 3ADRA 1WW1A 4ZO3A 4AD9A 3IE1A 3BV6A 4FR7A 4C1GA 3TP9A 4GCWA 2ZZIA 3IDZA 2ZNBA 5ACQA 5K0WA 3H3EA 3ZWFA 4H0DA 4UWOB 2FU6A 4Z67A 1X8HA 5LLDA 5ACXA 5K4KA 3IEMA 5DPXA 2BG7A 3AJ3A 4TYFA 3R2UA 2I7XA 4GYQA 5EWAA 3T3OA 4EYLA 2BTNA 5A0VA 2P97A 4EFZA 3SPUA 2Y87A 4EYFA 4UWSB 2YNVA 3IE0A 1K07A 2A7MA 1JJTA 4JO0A 2H6AA 3DHCA 1DD6A 4AWYB 3RPCA 2OHHA 1JT1A 1SMLA 2YNTA 4D02A 5AHOA 4Z6XA 5B1UA 3SFPA 3T3NA 5ACTA 5EH9A 3VQZA 1X8IA 3IE2A 2BG8A 5LCFA 2BG8B 3JXPA 5K4NA 1KO2A 4HKYA 4Z7RA 4RBSA 2BFZB 2NZEA 4DILA 1VMEA 1QH3A 5ACUA 3DHBA 4YSLA 1ZNBA 4Z5ZA 5AYAA 4UA4A 4EYBA 3BK1A 3IEKA 3FCZA 1JJEA 4AWZA 3SRXA 5LSCA 2CBNA 2FHXA 2Y8BA 4NQ2A 4UWPB 3ZQ4A 2GCUA 1X8GA 5HH6A 4KEQA 5AHRA 5LCAA 2P18A 3BK2A 5B15A 5ACWA 2FU8A 2BFLA 2Q42A 2FM6A 3AF6A 2DKFA 1WUPA 2M5CA 4ZO2A 2AZ4A 2WHGA 5B3RA 3Q6VA 4TZBA 2DOOA 5EVKA 4EXSA 5HISA 4D1TA 2FK6A 4RL2A 2R2DA 4XWTA 4PVOA 2FU9A 3ZNBA 2I7TA 4DIKA 2BFZA 5HH4A 4ZNBA 2NYPA 5HIQA 3F9OA 4Z60A 4XWWA 3G1PA 5AEBA 1WRAA 2Q0JA 5EVDA 2GFJA 4C1FA 3VPEA 2Q0IA 2BFKA 2BC2A 2QJSA 4UWRB 4C1DA 5EVBA 4BP0A 5LM6A 4NQ4A 4RAWA 3RKJA 2E7YA 3BC2A 4D1WA 3KNSA 4BZ3A 2FU7A 4LE6A 2YZ3A 2BR6A 2WRSA 1E5DA 5ACPA 3QH8A 2Q9UA 1L9YA 1MQOA 4NQ5A 4ZEJA 1ZTCA 1HLKA 4WD6A 1BVTA 1DDKA 4UAMA 4AX1B 2NXAA 2YCBA 4C09A 4C1EA 4NQ6A 2WYLA 5AXRA 1BMCA 1KR3A 4C1CA 3KNRA 3FAIA 5LE1A 4HL1A 3LVZA 4P62A 3T9MA 4V0HA 4PVTA 5ACVA 5AXOA 3S0ZA 5HIPA 3SBLA 3IOGA 3A4YA 2BGAA 3ESHA 1XM8A 3I11A 2M5DA 3PG4A 4O98A 4UBQA 3X2YA 2I7VA 5EW0A 4RL0A 1XTOA 2YNTB 3WXCA 4EXYA 3MD7A 1VJNA 2BIBA 3I13A 4F6ZA 4B87A 5LS3A 3IOFA 1VGNA 2WYMC 5LMCA 2VW8A 1A8TA 2ZWRA 2GMNA 5HH5A 3AF5A 4EY2A 3I0VA 4D1UA 5KIKA 1QH5A 2FHXB 2UYXA 2AIOA 3I14A 2YNVB 2XF4A 4C1HA 1KO3A 2P1EA 2QDSA 2P4ZA 4FEKA 4TZ9A 1DXKA 5KILA 4RM5A 2OHJA 4RAMA 2GKLA 5ACSA 2ZO4A 2OHIA 3I15A 5FQBA 2WYMA 4GYUA 3PY5A 5LCHA 5A5ZA 4XUKA 1A7TA 5FQCA 4TZFA 5EV6A 4TZEA 4YSKA 3X2ZA 3DH8A 2QEDA 2GFKA 2BG2A 5A87A 3KL7A 1BC2A 2BMIA 2Y8AA 3IELA 1YCHA 1M2XA 4J5HA 4TYTA 1Y44A 3SW3A 4AX0B 2BG6A 2HB9A 2XR1A 4F6HA 4CHLA 3RKKA 2YNUA 5ACRA 4J5FA 5EHTA 2QDTA 4KEPA 4D1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PY6 A;  2QIN A;  5A0T A;  1YCF A;  4U4L A;  4FSB A;  5K4M A;  3DHA A;  3L6N A;  2YNW A;  5HIO A;  1P9E A;  1WUO A;  1YCG A;  5EV8 A;  5FQA A;  1ZKP A;  3X30 A;  3SD9 A;  3ZR9 A;  3X2X A;  4YSB A;  4Z5Y A;  3P2U A;  2NZF A;  5IQK A;  4HL2 A;  3ADR A;  1WW1 A;  4ZO3 A;  4AD9 A;  3IE1 A;  3BV6 A;  4FR7 A;  4C1G A;  3TP9 A;  4GCW A;  2ZZI A;  3IDZ A;  2ZNB A;  5ACQ A;  5K0W A;  3H3E A;  3ZWF A;  4H0D A;  4UWO B;  2FU6 A;  4Z67 A;  1X8H A;  5LLD A;  5ACX A;  5K4K A;  3IEM A;  5DPX A;  2BG7 A;  3AJ3 A;  4TYF A;  3R2U A;  2I7X A;  4GYQ A;  5EWA A;  3T3O A;  4EYL A;  2BTN A;  5A0V A;  2P97 A;  4EFZ A;  3SPU A;  2Y87 A;  4EYF A;  4UWS B;  2YNV A;  3IE0 A;  1K07 A;  2A7M A;  1JJT A;  4JO0 A;  2H6A A;  3DHC A;  1DD6 A;  4AWY B;  3RPC A;  2OHH A;  1JT1 A;  1SML A;  2YNT A;  4D02 A;  5AHO A;  4Z6X A;  5B1U A;  3SFP A;  3T3N A;  5ACT A;  5EH9 A;  3VQZ A;  1X8I A;  3IE2 A;  2BG8 A;  5LCF A;  2BG8 B;  3JXP A;  5K4N A;  1KO2 A;  4HKY A;  4Z7R A;  4RBS A;  2BFZ B;  2NZE A;  4DIL A;  1VME A;  1QH3 A;  5ACU A;  3DHB A;  4YSL A;  1ZNB A;  4Z5Z A;  5AYA A;  4UA4 A;  4EYB A;  3BK1 A;  3IEK A;  3FCZ A;  1JJE A;  4AWZ A;  3SRX A;  5LSC A;  2CBN A;  2FHX A;  2Y8B A;  4NQ2 A;  4UWP B;  3ZQ4 A;  2GCU A;  1X8G A;  5HH6 A;  4KEQ A;  5AHR A;  5LCA A;  2P18 A;  3BK2 A;  5B15 A;  5ACW A;  2FU8 A;  2BFL A;  2Q42 A;  2FM6 A;  3AF6 A;  2DKF A;  1WUP A;  2M5C A;  4ZO2 A;  2AZ4 A;  2WHG A;  5B3R A;  3Q6V A;  4TZB A;  2DOO A;  5EVK A;  4EXS A;  5HIS A;  4D1T A;  2FK6 A;  4RL2 A;  2R2D A;  4XWT A;  4PVO A;  2FU9 A;  3ZNB A;  2I7T A;  4DIK A;  2BFZ A;  5HH4 A;  4ZNB A;  2NYP A;  5HIQ A;  3F9O A;  4Z60 A;  4XWW A;  3G1P A;  5AEB A;  1WRA A;  2Q0J A;  5EVD A;  2GFJ A;  4C1F A;  3VPE A;  2Q0I A;  2BFK A;  2BC2 A;  2QJS A;  4UWR B;  4C1D A;  5EVB A;  4BP0 A;  5LM6 A;  4NQ4 A;  4RAW A;  3RKJ A;  2E7Y A;  3BC2 A;  4D1W A;  3KNS A;  4BZ3 A;  2FU7 A;  4LE6 A;  2YZ3 A;  2BR6 A;  2WRS A;  1E5D A;  5ACP A;  3QH8 A;  2Q9U A;  1L9Y A;  1MQO A;  4NQ5 A;  4ZEJ A;  1ZTC A;  1HLK A;  4WD6 A;  1BVT A;  1DDK A;  4UAM A;  4AX1 B;  2NXA A;  2YCB A;  4C09 A;  4C1E A;  4NQ6 A;  2WYL A;  5AXR A;  1BMC A;  1KR3 A;  4C1C A;  3KNR A;  3FAI A;  5LE1 A;  4HL1 A;  3LVZ A;  4P62 A;  3T9M A;  4V0H A;  4PVT A;  5ACV A;  5AXO A;  3S0Z A;  5HIP A;  3SBL A;  3IOG A;  3A4Y A;  2BGA A;  3ESH A;  1XM8 A;  3I11 A;  2M5D A;  3PG4 A;  4O98 A;  4UBQ A;  3X2Y A;  2I7V A;  5EW0 A;  4RL0 A;  1XTO A;  2YNT B;  3WXC A;  4EXY A;  3MD7 A;  1VJN A;  2BIB A;  3I13 A;  4F6Z A;  4B87 A;  5LS3 A;  3IOF A;  1VGN A;  2WYM C;  5LMC A;  2VW8 A;  1A8T A;  2ZWR A;  2GMN A;  5HH5 A;  3AF5 A;  4EY2 A;  3I0V A;  4D1U A;  5KIK A;  1QH5 A;  2FHX B;  2UYX A;  2AIO A;  3I14 A;  2YNV B;  2XF4 A;  4C1H A;  1KO3 A;  2P1E A;  2QDS A;  2P4Z A;  4FEK A;  4TZ9 A;  1DXK A;  5KIL A;  4RM5 A;  2OHJ A;  4RAM A;  2GKL A;  5ACS A;  2ZO4 A;  2OHI A;  3I15 A;  5FQB A;  2WYM A;  4GYU A;  3PY5 A;  5LCH A;  5A5Z A;  4XUK A;  1A7T A;  5FQC A;  4TZF A;  5EV6 A;  4TZE A;  4YSK A;  3X2Z A;  3DH8 A;  2QED A;  2GFK A;  2BG2 A;  5A87 A;  3KL7 A;  1BC2 A;  2BMI A;  2Y8A A;  3IEL A;  1YCH A;  1M2X A;  4J5H A;  4TYT A;  1Y44 A;  3SW3 A;  4AX0 B;  2BG6 A;  2HB9 A;  2XR1 A;  4F6H A;  4CHL A;  3RKK A;  2YNU A;  5ACR A;  4J5F A;  5EHT A;  2QDT A;  4KEP A;  4D1V A; 
#chains in the Genus database with same CATH topology
 3PY6 A;  2QIN A;  5A0T A;  1YCF A;  4U4L A;  4FSB A;  5K4M A;  3DHA A;  3L6N A;  2YNW A;  5HIO A;  1P9E A;  1WUO A;  1YCG A;  5EV8 A;  5FQA A;  2CFU A;  1ZKP A;  3X30 A;  3SD9 A;  3ZR9 A;  3X2X A;  4YSB A;  4Z5Y A;  3P2U A;  2NZF A;  5IQK A;  4HL2 A;  3ADR A;  1WW1 A;  4ZO3 A;  4AD9 A;  4PDX A;  3BV6 A;  3IE1 A;  4FR7 A;  4C1G A;  3TP9 A;  4GCW A;  2ZZI A;  3IDZ A;  2ZNB A;  5ACQ A;  5K0W A;  3H3E A;  3ZWF A;  4H0D A;  4UWO B;  2FU6 A;  4Z67 A;  1X8H A;  5LLD A;  5ACX A;  5K4K A;  3IEM A;  5DPX A;  2BG7 A;  3AJ3 A;  4TYF A;  3R2U A;  2I7X A;  4GYQ A;  5EWA A;  3T3O A;  4EYL A;  2BTN A;  5A0V A;  2P97 A;  4EFZ A;  3SPU A;  2Y87 A;  4EYF A;  4UWS B;  2YNV A;  3IE0 A;  1K07 A;  2A7M A;  1JJT A;  4JO0 A;  2H6A A;  3DHC A;  1DD6 A;  4AWY B;  3RPC A;  2OHH A;  1JT1 A;  1SML A;  2YNT A;  4D02 A;  5AHO A;  4Z6X A;  5B1U A;  3SFP A;  3T3N A;  5ACT A;  5EH9 A;  3VQZ A;  1X8I A;  3IE2 A;  2BG8 A;  5LCF A;  2BG8 B;  3JXP A;  5K4N A;  1KO2 A;  4HKY A;  4Z7R A;  4RBS A;  2BFZ B;  2NZE A;  4DIL A;  1VME A;  1QH3 A;  5ACU A;  3DHB A;  4YSL A;  1ZNB A;  4Z5Z A;  5AYA A;  4UA4 A;  4EYB A;  3BK1 A;  3IEK A;  3FCZ A;  1JJE A;  4AWZ A;  3SRX A;  5LSC A;  2CBN A;  2FHX A;  2Y8B A;  4NQ2 A;  4UWP B;  3ZQ4 A;  2GCU A;  1X8G A;  5HH6 A;  2YHE A;  4KEQ A;  5AHR A;  5LCA A;  2P18 A;  3BK2 A;  5B15 A;  5ACW A;  2FU8 A;  2BFL A;  2Q42 A;  2FM6 A;  3AF6 A;  2CG3 A;  2DKF A;  1WUP A;  2M5C A;  4ZO2 A;  2AZ4 A;  2WHG A;  5B3R A;  3Q6V A;  4TZB A;  2DOO A;  5EVK A;  4EXS A;  5HIS A;  4D1T A;  2FK6 A;  4RL2 A;  2R2D A;  4XWT A;  4PVO A;  2FU9 A;  2CFZ A;  3ZNB A;  2I7T A;  4DIK A;  2BFZ A;  5HH4 A;  4ZNB A;  2NYP A;  5HIQ A;  3F9O A;  4Z60 A;  4XWW A;  3G1P A;  5AEB A;  1WRA A;  2Q0J A;  5EVD A;  2GFJ A;  4C1F A;  3VPE A;  2Q0I A;  2BFK A;  2BC2 A;  2QJS A;  4UWR B;  4C1D A;  5EVB A;  4BP0 A;  4NQ4 A;  4RAW A;  3RKJ A;  5LM6 A;  2E7Y A;  3BC2 A;  4D1W A;  3KNS A;  4BZ3 A;  2FU7 A;  4LE6 A;  2YZ3 A;  2BR6 A;  2WRS A;  1E5D A;  5ACP A;  3QH8 A;  2Q9U A;  1L9Y A;  1MQO A;  4NQ5 A;  4ZEJ A;  1ZTC A;  1HLK A;  4WD6 A;  1BVT A;  1DDK A;  4UAM A;  4AX1 B;  2NXA A;  2YCB A;  4C09 A;  4C1E A;  4NQ6 A;  2WYL A;  5AXR A;  1BMC A;  1KR3 A;  4C1C A;  3KNR A;  3FAI A;  5LE1 A;  4HL1 A;  3LVZ A;  4P62 A;  3T9M A;  4V0H A;  4PVT A;  5ACV A;  5AXO A;  3S0Z A;  5HIP A;  3SBL A;  3IOG A;  3A4Y A;  2BGA A;  3ESH A;  1XM8 A;  3I11 A;  2M5D A;  3PG4 A;  4O98 A;  4UBQ A;  3X2Y A;  2I7V A;  5EW0 A;  4RL0 A;  1XTO A;  2YNT B;  3WXC A;  4EXY A;  3MD7 A;  1VJN A;  2BIB A;  3I13 A;  4F6Z A;  4B87 A;  5LS3 A;  3IOF A;  1VGN A;  2CG2 A;  2WYM C;  5LMC A;  2VW8 A;  1A8T A;  2ZWR A;  2GMN A;  5HH5 A;  3AF5 A;  4EY2 A;  3I0V A;  4D1U A;  5AJL A;  5KIK A;  1QH5 A;  2FHX B;  2UYX A;  2AIO A;  3I14 A;  2YNV B;  2XF4 A;  4AXH A;  4C1H A;  1KO3 A;  2P1E A;  2QDS A;  2P4Z A;  4NUR A;  4FEK A;  4TZ9 A;  1DXK A;  5KIL A;  4RM5 A;  2OHJ A;  4RAM A;  2GKL A;  5ACS A;  2ZO4 A;  4AV7 A;  2OHI A;  3I15 A;  5FQB A;  2WYM A;  4GYU A;  5AIJ A;  3PY5 A;  5LCH A;  5A5Z A;  4XUK A;  1A7T A;  5FQC A;  4TZF A;  5EV6 A;  4TZE A;  4YSK A;  3X2Z A;  3DH8 A;  2QED A;  2GFK A;  5A23 A;  2BG2 A;  5A87 A;  3KL7 A;  1BC2 A;  2BMI A;  2Y8A A;  3IEL A;  1YCH A;  1M2X A;  4J5H A;  4TYT A;  1Y44 A;  3SW3 A;  4AX0 B;  2BG6 A;  2HB9 A;  2XR1 A;  4F6H A;  4CHL A;  3RKK A;  2YNU A;  5ACR A;  4J5F A;  5EHT A;  2QDT A;  4KEP A;  4D1V A; 
#chains in the Genus database with same CATH homology
 3PY6 A;  2QIN A;  5A0T A;  1YCF A;  4U4L A;  4FSB A;  5K4M A;  3DHA A;  3L6N A;  2YNW A;  5HIO A;  1P9E A;  1WUO A;  1YCG A;  5EV8 A;  5FQA A;  1ZKP A;  3X30 A;  3SD9 A;  3ZR9 A;  3X2X A;  4YSB A;  4Z5Y A;  3P2U A;  2NZF A;  5IQK A;  4HL2 A;  3ADR A;  1WW1 A;  4ZO3 A;  4AD9 A;  3IE1 A;  3BV6 A;  4FR7 A;  4C1G A;  3TP9 A;  4GCW A;  2ZZI A;  3IDZ A;  2ZNB A;  5ACQ A;  5K0W A;  3H3E A;  3ZWF A;  4H0D A;  4UWO B;  2FU6 A;  4Z67 A;  1X8H A;  5LLD A;  5ACX A;  5K4K A;  3IEM A;  5DPX A;  2BG7 A;  3AJ3 A;  4TYF A;  3R2U A;  2I7X A;  4GYQ A;  5EWA A;  3T3O A;  4EYL A;  2BTN A;  5A0V A;  2P97 A;  4EFZ A;  3SPU A;  2Y87 A;  4EYF A;  4UWS B;  2YNV A;  3IE0 A;  1K07 A;  2A7M A;  1JJT A;  4JO0 A;  2H6A A;  3DHC A;  1DD6 A;  4AWY B;  3RPC A;  2OHH A;  1JT1 A;  1SML A;  2YNT A;  4D02 A;  5AHO A;  4Z6X A;  5B1U A;  3SFP A;  3T3N A;  5ACT A;  5EH9 A;  3VQZ A;  1X8I A;  3IE2 A;  2BG8 A;  5LCF A;  2BG8 B;  3JXP A;  5K4N A;  1KO2 A;  4HKY A;  4Z7R A;  4RBS A;  2BFZ B;  2NZE A;  4DIL A;  1VME A;  1QH3 A;  5ACU A;  3DHB A;  4YSL A;  1ZNB A;  4Z5Z A;  5AYA A;  4UA4 A;  4EYB A;  3BK1 A;  3IEK A;  3FCZ A;  1JJE A;  4AWZ A;  3SRX A;  5LSC A;  2CBN A;  2FHX A;  2Y8B A;  4NQ2 A;  4UWP B;  3ZQ4 A;  2GCU A;  1X8G A;  5HH6 A;  4KEQ A;  5AHR A;  5LCA A;  2P18 A;  3BK2 A;  5B15 A;  5ACW A;  2FU8 A;  2BFL A;  2Q42 A;  2FM6 A;  3AF6 A;  2DKF A;  1WUP A;  2M5C A;  4ZO2 A;  2AZ4 A;  2WHG A;  5B3R A;  3Q6V A;  4TZB A;  2DOO A;  5EVK A;  4EXS A;  5HIS A;  4D1T A;  2FK6 A;  4RL2 A;  2R2D A;  4XWT A;  4PVO A;  2FU9 A;  3ZNB A;  2I7T A;  4DIK A;  2BFZ A;  5HH4 A;  4ZNB A;  2NYP A;  5HIQ A;  3F9O A;  4Z60 A;  4XWW A;  3G1P A;  5AEB A;  1WRA A;  2Q0J A;  5EVD A;  2GFJ A;  4C1F A;  3VPE A;  2Q0I A;  2BFK A;  2BC2 A;  2QJS A;  4UWR B;  4C1D A;  5EVB A;  4BP0 A;  5LM6 A;  4NQ4 A;  4RAW A;  3RKJ A;  2E7Y A;  3BC2 A;  4D1W A;  3KNS A;  4BZ3 A;  2FU7 A;  4LE6 A;  2YZ3 A;  2BR6 A;  2WRS A;  1E5D A;  5ACP A;  3QH8 A;  2Q9U A;  1L9Y A;  1MQO A;  4NQ5 A;  4ZEJ A;  1ZTC A;  1HLK A;  4WD6 A;  1BVT A;  1DDK A;  4UAM A;  4AX1 B;  2NXA A;  2YCB A;  4C09 A;  4C1E A;  4NQ6 A;  2WYL A;  5AXR A;  1BMC A;  1KR3 A;  4C1C A;  3KNR A;  3FAI A;  5LE1 A;  4HL1 A;  3LVZ A;  4P62 A;  3T9M A;  4V0H A;  4PVT A;  5ACV A;  5AXO A;  3S0Z A;  5HIP A;  3SBL A;  3IOG A;  3A4Y A;  2BGA A;  3ESH A;  1XM8 A;  3I11 A;  2M5D A;  3PG4 A;  4O98 A;  4UBQ A;  3X2Y A;  2I7V A;  5EW0 A;  4RL0 A;  1XTO A;  2YNT B;  3WXC A;  4EXY A;  3MD7 A;  1VJN A;  2BIB A;  3I13 A;  4F6Z A;  4B87 A;  5LS3 A;  3IOF A;  1VGN A;  2WYM C;  5LMC A;  2VW8 A;  1A8T A;  2ZWR A;  2GMN A;  5HH5 A;  3AF5 A;  4EY2 A;  3I0V A;  4D1U A;  5KIK A;  1QH5 A;  2FHX B;  2UYX A;  2AIO A;  3I14 A;  2YNV B;  2XF4 A;  4C1H A;  1KO3 A;  2P1E A;  2QDS A;  2P4Z A;  4FEK A;  4TZ9 A;  1DXK A;  5KIL A;  4RM5 A;  2OHJ A;  4RAM A;  2GKL A;  5ACS A;  2ZO4 A;  2OHI A;  3I15 A;  5FQB A;  2WYM A;  4GYU A;  3PY5 A;  5LCH A;  5A5Z A;  4XUK A;  1A7T A;  5FQC A;  4TZF A;  5EV6 A;  4TZE A;  4YSK A;  3X2Z A;  3DH8 A;  2QED A;  2GFK A;  2BG2 A;  5A87 A;  3KL7 A;  1BC2 A;  2BMI A;  2Y8A A;  3IEL A;  1YCH A;  1M2X A;  4J5H A;  4TYT A;  1Y44 A;  3SW3 A;  4AX0 B;  2BG6 A;  2HB9 A;  2XR1 A;  4F6H A;  4CHL A;  3RKK A;  2YNU A;  5ACR A;  4J5F A;  5EHT A;  2QDT A;  4KEP A;  4D1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...