4Z5ZA

The 2.5-angstrom crystal structure of mg(2+)-bound pqqb from pseudomonas putida
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
308
structure length
308
Chain Sequence
MMYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIALSDDGVHWILCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLREGCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFPLRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLLVDGTLWEDDEMQRRGVGTRTGREMGHLAQNGPGGTLEVLDGFPRQRKVLIHINNTNPILDENSPERAEVLRRGVEVAFDGMSIELLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Coenzyme PQQ synthesis protein B
publication title Crystal structures reveal metal-binding plasticity at the active site of PqqB
rcsb
source organism Pseudomonas putida (strain kt2440)
total genus 103
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4z5zA00
2DKFA 3LVZA 4LE6A 3IOFA 4TYFA 3ESHA 2Y87A 2QDTA 3DHCA 3ADRA 3ZR9A 2NZFA 5AXRA 4FSBA 1P9EA 3BV6A 1WUPA 5EHTA 1KO3A 5ACQA 5LE1A 3I0VA 4UWPB 1A7TA 2ZZIA 5AHRA 1DXKA 2CBNA 2BG8B 2BG7A 1YCHA 4P62A 2BIBA 2P18A 5EV8A 3SFPA 5A0VA 4WD6A 2QJSA 1BMCA 1L9YA 2YNWA 3IOGA 3AJ3A 2P1EA 4XWWA 3T9MA 3DHBA 2GFJA 2BFZA 1XM8A 4KEPA 4Z6XA 4EYBA 1YCGA 3IE1A 2ZWRA 2I7TA 5ACSA 5DPXA 3PY5A 2XF4A 3I13A 4EFZA 3IEMA 2BFKA 4AD9A 1VJNA 3SRXA 5EV6A 2AZ4A 5HIPA 5ACRA 2OHIA 4AX0B 5K4MA 3RKJA 2ZNBA 4DIKA 2H6AA 4HL2A 2GFKA 4C1HA 4D1TA 4ZNBA 5EH9A 5ACWA 1KR3A 4XWTA 4C1EA 2BFZB 3RPCA 4TZBA 5HIQA 4JO0A 4ZO3A 1VMEA 3IELA 1WUOA 4EYLA 1M2XA 3BK1A 3KNRA 4FR7A 2NZEA 3X2YA 2YZ3A 5FQAA 4BP0A 4NQ4A 4GCWA 4GYQA 5LCAA 5HIOA 3SW3A 5K0WA 2GKLA 4PVTA 2BG2A 3X2XA 2WYLA 4UBQA 1JJEA 4D1VA 2R2DA 5LLDA 1XTOA 4ZEJA 2WRSA 3S0ZA 4UWOB 5HH4A 4FEKA 1E5DA 4KEQA 3JXPA 5HH5A 1KO2A 3BK2A 4C1CA 3I15A 2WHGA 3VQZA 1ZKPA 4RL2A 2Q0JA 4PVOA 2FU7A 1BVTA 1MQOA 4NQ6A 2YNTA 1VGNA 5EVBA 1DDKA 4D1WA 2GCUA 2FHXA 4C1GA 2UYXA 3T3OA 4ZO2A 1ZNBA 3WXCA 5HH6A 4DILA 3DH8A 2YNVA 2P97A 5ACUA 1K07A 3F9OA 2QDSA 3ZNBA 5AEBA 4RBSA 4YSBA 3X2ZA 5A87A 4HL1A 2Y8AA 4GYUA 4NQ5A 4F6HA 4AWZA 4RM5A 2OHJA 3Q6VA 3AF5A 2BGAA 4D02A 2A7MA 5HISA 5ACXA 4UWRB 5A0TA 4UAMA 1QH5A 1HLKA 4RAMA 1ZTCA 3AF6A 2M5DA 4Z5YA 2M5CA 3KL7A 1X8GA 2BFLA 2YNTB 3L6NA 4AX1B 3I14A 2FHXB 4Z5ZA 3IE2A 5EWAA 2BR6A 3T3NA 4AWYB 3P2UA 4NQ2A 5AYAA 2YNVB 1DD6A 3BC2A 2WYMC 1QH3A 2YNUA 4Z67A 1X8IA 5ACVA 1WRAA 4XUKA 5B3RA 5LM6A 5FQBA 2GMNA 2BMIA 4RL0A 5A5ZA 2I7XA 5AHOA 4J5HA 4C09A 2YCBA 3G1PA 3A4YA 4EYFA 4EY2A 4U4LA 5ACTA 4C1FA 5KIKA 2Q0IA 3TP9A 1BC2A 4CHLA 2Q42A 4EXYA 2OHHA 3IDZA 5LCHA 4F6ZA 2FU8A 4YSKA 3ZQ4A 4TYTA 4TZFA 4V0HA 4Z7RA 2DOOA 2NXAA 1Y44A 1JT1A 5LCFA 4C1DA 2FK6A 2Y8BA 2E7YA 3MD7A 4BZ3A 3SPUA 5B1UA 3IEKA 2FU9A 2XR1A 2I7VA 2P4ZA 3QH8A 4HKYA 5LMCA 5EW0A 5EVKA 4TZ9A 5IQKA 4H0DA 3X30A 4RAWA 5LSCA 2BG6A 5B15A 5K4NA 3DHAA 3R2UA 2FM6A 1A8TA 3SBLA 3PY6A 2QINA 2FU6A 5KILA 2ZO4A 4B87A 2BTNA 4EXSA 5LS3A 3FCZA 2QEDA 2AIOA 3KNSA 4J5FA 1X8HA 2VW8A 5EVDA 2BC2A 3FAIA 3H3EA 3PG4A 2NYPA 3VPEA 5ACPA 3ZWFA 4TZEA 3RKKA 3IE0A 4O98A 4UA4A 1WW1A 1JJTA 4Z60A 4UWSB 3I11A 2WYMA 2Q9UA 1SMLA 2BG8A 1YCFA 4YSLA 3SD9A 5AXOA 4D1UA 2HB9A 5K4KA 5FQCA
chains in the Genus database with same CATH superfamily
2DKFA 3LVZA 4LE6A 3IOFA 4TYFA 3ESHA 2Y87A 2QDTA 3DHCA 3ADRA 3ZR9A 2NZFA 5AXRA 4FSBA 1P9EA 3BV6A 1WUPA 5EHTA 1KO3A 5ACQA 5LE1A 3I0VA 4UWPB 1A7TA 2ZZIA 5AHRA 1DXKA 2CBNA 2BG8B 2BG7A 1YCHA 4P62A 2BIBA 2P18A 5EV8A 5AJLA 3SFPA 5A0VA 4WD6A 2QJSA 5AIJA 1BMCA 1L9YA 2YNWA 3IOGA 3AJ3A 2P1EA 4XWWA 3T9MA 3DHBA 2GFJA 2BFZA 1XM8A 4KEPA 4Z6XA 4EYBA 1YCGA 3IE1A 2ZWRA 2CFZA 2I7TA 5ACSA 5DPXA 3PY5A 2XF4A 3I13A 4EFZA 3IEMA 4PDXA 2BFKA 4AD9A 1VJNA 3SRXA 5EV6A 2AZ4A 5HIPA 5ACRA 2OHIA 4AX0B 5K4MA 3RKJA 2ZNBA 4DIKA 2H6AA 4HL2A 2GFKA 4C1HA 4D1TA 4ZNBA 5EH9A 5ACWA 1KR3A 4XWTA 4C1EA 2BFZB 3RPCA 4TZBA 5HIQA 4JO0A 4ZO3A 1VMEA 3IELA 1WUOA 4EYLA 1M2XA 3BK1A 3KNRA 4FR7A 2NZEA 3X2YA 2YZ3A 5FQAA 2CG3A 4BP0A 4NQ4A 4GCWA 4GYQA 5LCAA 5HIOA 3SW3A 5K0WA 2GKLA 4PVTA 2BG2A 3X2XA 2WYLA 4UBQA 1JJEA 4D1VA 2R2DA 5LLDA 1XTOA 4ZEJA 2WRSA 3S0ZA 4UWOB 5HH4A 4FEKA 2YHEA 1E5DA 4KEQA 3JXPA 5HH5A 1KO2A 3BK2A 4C1CA 3I15A 2WHGA 3VQZA 1ZKPA 4RL2A 2Q0JA 4PVOA 2FU7A 1BVTA 1MQOA 4NQ6A 2YNTA 1VGNA 5EVBA 1DDKA 4D1WA 2GCUA 2FHXA 4C1GA 2UYXA 3T3OA 2CFUA 1ZNBA 4ZO2A 3WXCA 5HH6A 4DILA 3DH8A 2YNVA 2P97A 4NURA 5ACUA 1K07A 3F9OA 2QDSA 4AV7A 3ZNBA 5AEBA 4RBSA 4YSBA 3X2ZA 5A87A 4HL1A 2Y8AA 4GYUA 4NQ5A 4F6HA 4AWZA 4RM5A 2OHJA 3Q6VA 3AF5A 2BGAA 4D02A 2A7MA 5HISA 5ACXA 4UWRB 5A0TA 4UAMA 1QH5A 1HLKA 4RAMA 1ZTCA 3AF6A 2M5DA 4Z5YA 2M5CA 3KL7A 1X8GA 2BFLA 2YNTB 3L6NA 4AX1B 3I14A 5A23A 4AXHA 2FHXB 4Z5ZA 3IE2A 5EWAA 2BR6A 3T3NA 4AWYB 3P2UA 4NQ2A 5AYAA 2YNVB 1DD6A 3BC2A 2WYMC 1QH3A 2YNUA 4Z67A 1X8IA 5ACVA 1WRAA 4XUKA 5B3RA 5LM6A 5FQBA 2GMNA 2BMIA 4RL0A 5A5ZA 2I7XA 5AHOA 4J5HA 4C09A 2YCBA 3G1PA 3A4YA 4EYFA 4EY2A 4U4LA 5ACTA 4C1FA 5KIKA 2Q0IA 3TP9A 1BC2A 4CHLA 2Q42A 4EXYA 2OHHA 3IDZA 5LCHA 4F6ZA 2FU8A 4YSKA 3ZQ4A 4TYTA 4TZFA 4V0HA 4Z7RA 2DOOA 2NXAA 1Y44A 1JT1A 5LCFA 4C1DA 2FK6A 2Y8BA 2E7YA 3MD7A 4BZ3A 3SPUA 5B1UA 3IEKA 2FU9A 2XR1A 2I7VA 2P4ZA 3QH8A 4HKYA 5LMCA 5EW0A 5EVKA 2CG2A 4TZ9A 5IQKA 4H0DA 3X30A 4RAWA 5LSCA 2BG6A 5B15A 5K4NA 3DHAA 3R2UA 2FM6A 1A8TA 3SBLA 3PY6A 2QINA 2FU6A 5KILA 2ZO4A 4B87A 2BTNA 4EXSA 5LS3A 3FCZA 2QEDA 2AIOA 3KNSA 4J5FA 1X8HA 2VW8A 5EVDA 2BC2A 3FAIA 3H3EA 3PG4A 2NYPA 3VPEA 5ACPA 3ZWFA 4TZEA 3RKKA 3IE0A 4O98A 4UA4A 1WW1A 1JJTA 4Z60A 4UWSB 3I11A 2WYMA 2Q9UA 1SMLA 2BG8A 1YCFA 4YSLA 3SD9A 5AXOA 4D1UA 2HB9A 5K4KA 5FQCA
chains in the Genus database with same CATH topology
2DKFA 3LVZA 4LE6A 3IOFA 4TYFA 3ESHA 2Y87A 2QDTA 3DHCA 3ADRA 3ZR9A 2NZFA 5AXRA 4FSBA 1P9EA 3BV6A 1WUPA 5EHTA 1KO3A 5ACQA 5LE1A 3I0VA 4UWPB 1A7TA 2ZZIA 5AHRA 1DXKA 2CBNA 2BG8B 2BG7A 1YCHA 4P62A 2BIBA 2P18A 5EV8A 3SFPA 5A0VA 4WD6A 2QJSA 1BMCA 1L9YA 2YNWA 3IOGA 3AJ3A 2P1EA 4XWWA 3T9MA 3DHBA 2GFJA 2BFZA 1XM8A 4KEPA 4Z6XA 4EYBA 1YCGA 3IE1A 2ZWRA 2I7TA 5ACSA 5DPXA 3PY5A 2XF4A 3I13A 4EFZA 3IEMA 2BFKA 4AD9A 1VJNA 3SRXA 5EV6A 2AZ4A 5HIPA 5ACRA 2OHIA 4AX0B 5K4MA 3RKJA 2ZNBA 4DIKA 2H6AA 4HL2A 2GFKA 4C1HA 4D1TA 4ZNBA 5EH9A 5ACWA 1KR3A 4XWTA 4C1EA 2BFZB 3RPCA 4TZBA 5HIQA 4JO0A 4ZO3A 1VMEA 3IELA 1WUOA 4EYLA 1M2XA 3BK1A 3KNRA 4FR7A 2NZEA 3X2YA 2YZ3A 5FQAA 4BP0A 4NQ4A 4GCWA 4GYQA 5LCAA 5HIOA 3SW3A 5K0WA 2GKLA 4PVTA 2BG2A 3X2XA 2WYLA 4UBQA 1JJEA 4D1VA 2R2DA 5LLDA 1XTOA 4ZEJA 2WRSA 3S0ZA 4UWOB 5HH4A 4FEKA 1E5DA 4KEQA 3JXPA 5HH5A 1KO2A 3BK2A 4C1CA 3I15A 2WHGA 3VQZA 1ZKPA 4RL2A 2Q0JA 4PVOA 2FU7A 1BVTA 1MQOA 4NQ6A 2YNTA 1VGNA 5EVBA 1DDKA 4D1WA 2GCUA 2FHXA 4C1GA 2UYXA 3T3OA 4ZO2A 1ZNBA 3WXCA 5HH6A 4DILA 3DH8A 2YNVA 2P97A 5ACUA 1K07A 3F9OA 2QDSA 3ZNBA 5AEBA 4RBSA 4YSBA 3X2ZA 5A87A 4HL1A 2Y8AA 4GYUA 4NQ5A 4F6HA 4AWZA 4RM5A 2OHJA 3Q6VA 3AF5A 2BGAA 4D02A 2A7MA 5HISA 5ACXA 4UWRB 5A0TA 4UAMA 1QH5A 1HLKA 4RAMA 1ZTCA 3AF6A 2M5DA 4Z5YA 2M5CA 3KL7A 1X8GA 2BFLA 2YNTB 3L6NA 4AX1B 3I14A 2FHXB 4Z5ZA 3IE2A 5EWAA 2BR6A 3T3NA 4AWYB 3P2UA 4NQ2A 5AYAA 2YNVB 1DD6A 3BC2A 2WYMC 1QH3A 2YNUA 4Z67A 1X8IA 5ACVA 1WRAA 4XUKA 5B3RA 5LM6A 5FQBA 2GMNA 2BMIA 4RL0A 5A5ZA 2I7XA 5AHOA 4J5HA 4C09A 2YCBA 3G1PA 3A4YA 4EYFA 4EY2A 4U4LA 5ACTA 4C1FA 5KIKA 2Q0IA 3TP9A 1BC2A 4CHLA 2Q42A 4EXYA 2OHHA 3IDZA 5LCHA 4F6ZA 2FU8A 4YSKA 3ZQ4A 4TYTA 4TZFA 4V0HA 4Z7RA 2DOOA 2NXAA 1Y44A 1JT1A 5LCFA 4C1DA 2FK6A 2Y8BA 2E7YA 3MD7A 4BZ3A 3SPUA 5B1UA 3IEKA 2FU9A 2XR1A 2I7VA 2P4ZA 3QH8A 4HKYA 5LMCA 5EW0A 5EVKA 4TZ9A 5IQKA 4H0DA 3X30A 4RAWA 5LSCA 2BG6A 5B15A 5K4NA 3DHAA 3R2UA 2FM6A 1A8TA 3SBLA 3PY6A 2QINA 2FU6A 5KILA 2ZO4A 4B87A 2BTNA 4EXSA 5LS3A 3FCZA 2QEDA 2AIOA 3KNSA 4J5FA 1X8HA 2VW8A 5EVDA 2BC2A 3FAIA 3H3EA 3PG4A 2NYPA 3VPEA 5ACPA 3ZWFA 4TZEA 3RKKA 3IE0A 4O98A 4UA4A 1WW1A 1JJTA 4Z60A 4UWSB 3I11A 2WYMA 2Q9UA 1SMLA 2BG8A 1YCFA 4YSLA 3SD9A 5AXOA 4D1UA 2HB9A 5K4KA 5FQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DKF A;  3LVZ A;  4LE6 A;  3IOF A;  4TYF A;  3ESH A;  2Y87 A;  2QDT A;  3DHC A;  3ADR A;  3ZR9 A;  2NZF A;  5AXR A;  4FSB A;  1P9E A;  3BV6 A;  1WUP A;  5EHT A;  1KO3 A;  5ACQ A;  5LE1 A;  3I0V A;  4UWP B;  1A7T A;  2ZZI A;  5AHR A;  1DXK A;  2CBN A;  2BG8 B;  2BG7 A;  1YCH A;  4P62 A;  2BIB A;  2P18 A;  5EV8 A;  3SFP A;  5A0V A;  4WD6 A;  2QJS A;  1BMC A;  1L9Y A;  2YNW A;  3IOG A;  3AJ3 A;  2P1E A;  4XWW A;  3T9M A;  3DHB A;  2GFJ A;  2BFZ A;  1XM8 A;  4KEP A;  4Z6X A;  4EYB A;  1YCG A;  3IE1 A;  2ZWR A;  2I7T A;  5ACS A;  5DPX A;  3PY5 A;  2XF4 A;  3I13 A;  4EFZ A;  3IEM A;  2BFK A;  4AD9 A;  1VJN A;  3SRX A;  5EV6 A;  2AZ4 A;  5HIP A;  5ACR A;  2OHI A;  4AX0 B;  5K4M A;  3RKJ A;  2ZNB A;  4DIK A;  2H6A A;  4HL2 A;  2GFK A;  4C1H A;  4D1T A;  4ZNB A;  5EH9 A;  5ACW A;  1KR3 A;  4XWT A;  4C1E A;  2BFZ B;  3RPC A;  4TZB A;  5HIQ A;  4JO0 A;  4ZO3 A;  1VME A;  3IEL A;  1WUO A;  4EYL A;  1M2X A;  3BK1 A;  3KNR A;  4FR7 A;  2NZE A;  3X2Y A;  2YZ3 A;  5FQA A;  4BP0 A;  4NQ4 A;  4GCW A;  4GYQ A;  5LCA A;  5HIO A;  3SW3 A;  5K0W A;  2GKL A;  4PVT A;  2BG2 A;  3X2X A;  2WYL A;  4UBQ A;  1JJE A;  4D1V A;  2R2D A;  5LLD A;  1XTO A;  4ZEJ A;  2WRS A;  3S0Z A;  4UWO B;  5HH4 A;  4FEK A;  1E5D A;  4KEQ A;  3JXP A;  5HH5 A;  1KO2 A;  3BK2 A;  4C1C A;  3I15 A;  2WHG A;  3VQZ A;  1ZKP A;  4RL2 A;  2Q0J A;  4PVO A;  2FU7 A;  1BVT A;  1MQO A;  4NQ6 A;  2YNT A;  1VGN A;  5EVB A;  1DDK A;  4D1W A;  2GCU A;  2FHX A;  4C1G A;  2UYX A;  3T3O A;  4ZO2 A;  1ZNB A;  3WXC A;  5HH6 A;  4DIL A;  3DH8 A;  2YNV A;  2P97 A;  5ACU A;  1K07 A;  3F9O A;  2QDS A;  3ZNB A;  5AEB A;  4RBS A;  4YSB A;  3X2Z A;  5A87 A;  4HL1 A;  2Y8A A;  4GYU A;  4NQ5 A;  4F6H A;  4AWZ A;  4RM5 A;  2OHJ A;  3Q6V A;  3AF5 A;  2BGA A;  4D02 A;  2A7M A;  5HIS A;  5ACX A;  4UWR B;  5A0T A;  4UAM A;  1QH5 A;  1HLK A;  4RAM A;  1ZTC A;  3AF6 A;  2M5D A;  4Z5Y A;  2M5C A;  3KL7 A;  1X8G A;  2BFL A;  2YNT B;  3L6N A;  4AX1 B;  3I14 A;  2FHX B;  4Z5Z A;  3IE2 A;  5EWA A;  2BR6 A;  3T3N A;  4AWY B;  3P2U A;  4NQ2 A;  5AYA A;  2YNV B;  1DD6 A;  3BC2 A;  2WYM C;  1QH3 A;  2YNU A;  4Z67 A;  1X8I A;  5ACV A;  1WRA A;  4XUK A;  5B3R A;  5LM6 A;  5FQB A;  2GMN A;  2BMI A;  4RL0 A;  5A5Z A;  2I7X A;  5AHO A;  4J5H A;  4C09 A;  2YCB A;  3G1P A;  3A4Y A;  4EYF A;  4EY2 A;  4U4L A;  5ACT A;  4C1F A;  5KIK A;  2Q0I A;  3TP9 A;  1BC2 A;  4CHL A;  2Q42 A;  4EXY A;  2OHH A;  3IDZ A;  5LCH A;  4F6Z A;  2FU8 A;  4YSK A;  3ZQ4 A;  4TYT A;  4TZF A;  4V0H A;  4Z7R A;  2DOO A;  2NXA A;  1Y44 A;  1JT1 A;  5LCF A;  4C1D A;  2FK6 A;  2Y8B A;  2E7Y A;  3MD7 A;  4BZ3 A;  3SPU A;  5B1U A;  3IEK A;  2FU9 A;  2XR1 A;  2I7V A;  2P4Z A;  3QH8 A;  4HKY A;  5LMC A;  5EW0 A;  5EVK A;  4TZ9 A;  5IQK A;  4H0D A;  3X30 A;  4RAW A;  5LSC A;  2BG6 A;  5B15 A;  5K4N A;  3DHA A;  3R2U A;  2FM6 A;  1A8T A;  3SBL A;  3PY6 A;  2QIN A;  2FU6 A;  5KIL A;  2ZO4 A;  4B87 A;  2BTN A;  4EXS A;  5LS3 A;  3FCZ A;  2QED A;  2AIO A;  3KNS A;  4J5F A;  1X8H A;  2VW8 A;  5EVD A;  2BC2 A;  3FAI A;  3H3E A;  3PG4 A;  2NYP A;  3VPE A;  5ACP A;  3ZWF A;  4TZE A;  3RKK A;  3IE0 A;  4O98 A;  4UA4 A;  1WW1 A;  1JJT A;  4Z60 A;  4UWS B;  3I11 A;  2WYM A;  2Q9U A;  1SML A;  2BG8 A;  1YCF A;  4YSL A;  3SD9 A;  5AXO A;  4D1U A;  2HB9 A;  5K4K A;  5FQC A; 
#chains in the Genus database with same CATH topology
 2DKF A;  3LVZ A;  4LE6 A;  3IOF A;  4TYF A;  3ESH A;  2Y87 A;  2QDT A;  3DHC A;  3ADR A;  3ZR9 A;  2NZF A;  5AXR A;  4FSB A;  1P9E A;  3BV6 A;  1WUP A;  5EHT A;  1KO3 A;  5ACQ A;  5LE1 A;  3I0V A;  4UWP B;  1A7T A;  2ZZI A;  5AHR A;  1DXK A;  2CBN A;  2BG8 B;  2BG7 A;  1YCH A;  4P62 A;  2BIB A;  2P18 A;  5EV8 A;  5AJL A;  3SFP A;  5A0V A;  4WD6 A;  2QJS A;  5AIJ A;  1BMC A;  1L9Y A;  2YNW A;  3IOG A;  3AJ3 A;  2P1E A;  4XWW A;  3T9M A;  3DHB A;  2GFJ A;  2BFZ A;  1XM8 A;  4KEP A;  4Z6X A;  4EYB A;  1YCG A;  3IE1 A;  2ZWR A;  2CFZ A;  2I7T A;  5ACS A;  5DPX A;  3PY5 A;  2XF4 A;  3I13 A;  4EFZ A;  3IEM A;  4PDX A;  2BFK A;  4AD9 A;  1VJN A;  3SRX A;  5EV6 A;  2AZ4 A;  5HIP A;  5ACR A;  2OHI A;  4AX0 B;  5K4M A;  3RKJ A;  2ZNB A;  4DIK A;  2H6A A;  4HL2 A;  2GFK A;  4C1H A;  4D1T A;  4ZNB A;  5EH9 A;  5ACW A;  1KR3 A;  4XWT A;  4C1E A;  2BFZ B;  3RPC A;  4TZB A;  5HIQ A;  4JO0 A;  4ZO3 A;  1VME A;  3IEL A;  1WUO A;  4EYL A;  1M2X A;  3BK1 A;  3KNR A;  4FR7 A;  2NZE A;  3X2Y A;  2YZ3 A;  5FQA A;  2CG3 A;  4BP0 A;  4NQ4 A;  4GCW A;  4GYQ A;  5LCA A;  5HIO A;  3SW3 A;  5K0W A;  2GKL A;  4PVT A;  2BG2 A;  3X2X A;  2WYL A;  4UBQ A;  1JJE A;  4D1V A;  2R2D A;  5LLD A;  1XTO A;  4ZEJ A;  2WRS A;  3S0Z A;  4UWO B;  5HH4 A;  4FEK A;  2YHE A;  1E5D A;  4KEQ A;  3JXP A;  5HH5 A;  1KO2 A;  3BK2 A;  4C1C A;  3I15 A;  2WHG A;  3VQZ A;  1ZKP A;  4RL2 A;  2Q0J A;  4PVO A;  2FU7 A;  1BVT A;  1MQO A;  4NQ6 A;  2YNT A;  1VGN A;  5EVB A;  1DDK A;  4D1W A;  2GCU A;  2FHX A;  4C1G A;  2UYX A;  3T3O A;  2CFU A;  1ZNB A;  4ZO2 A;  3WXC A;  5HH6 A;  4DIL A;  3DH8 A;  2YNV A;  2P97 A;  4NUR A;  5ACU A;  1K07 A;  3F9O A;  2QDS A;  4AV7 A;  3ZNB A;  5AEB A;  4RBS A;  4YSB A;  3X2Z A;  5A87 A;  4HL1 A;  2Y8A A;  4GYU A;  4NQ5 A;  4F6H A;  4AWZ A;  4RM5 A;  2OHJ A;  3Q6V A;  3AF5 A;  2BGA A;  4D02 A;  2A7M A;  5HIS A;  5ACX A;  4UWR B;  5A0T A;  4UAM A;  1QH5 A;  1HLK A;  4RAM A;  1ZTC A;  3AF6 A;  2M5D A;  4Z5Y A;  2M5C A;  3KL7 A;  1X8G A;  2BFL A;  2YNT B;  3L6N A;  4AX1 B;  3I14 A;  5A23 A;  4AXH A;  2FHX B;  4Z5Z A;  3IE2 A;  5EWA A;  2BR6 A;  3T3N A;  4AWY B;  3P2U A;  4NQ2 A;  5AYA A;  2YNV B;  1DD6 A;  3BC2 A;  2WYM C;  1QH3 A;  2YNU A;  4Z67 A;  1X8I A;  5ACV A;  1WRA A;  4XUK A;  5B3R A;  5LM6 A;  5FQB A;  2GMN A;  2BMI A;  4RL0 A;  5A5Z A;  2I7X A;  5AHO A;  4J5H A;  4C09 A;  2YCB A;  3G1P A;  3A4Y A;  4EYF A;  4EY2 A;  4U4L A;  5ACT A;  4C1F A;  5KIK A;  2Q0I A;  3TP9 A;  1BC2 A;  4CHL A;  2Q42 A;  4EXY A;  2OHH A;  3IDZ A;  5LCH A;  4F6Z A;  2FU8 A;  4YSK A;  3ZQ4 A;  4TYT A;  4TZF A;  4V0H A;  4Z7R A;  2DOO A;  2NXA A;  1Y44 A;  1JT1 A;  5LCF A;  4C1D A;  2FK6 A;  2Y8B A;  2E7Y A;  3MD7 A;  4BZ3 A;  3SPU A;  5B1U A;  3IEK A;  2FU9 A;  2XR1 A;  2I7V A;  2P4Z A;  3QH8 A;  4HKY A;  5LMC A;  5EW0 A;  5EVK A;  2CG2 A;  4TZ9 A;  5IQK A;  4H0D A;  3X30 A;  4RAW A;  5LSC A;  2BG6 A;  5B15 A;  5K4N A;  3DHA A;  3R2U A;  2FM6 A;  1A8T A;  3SBL A;  3PY6 A;  2QIN A;  2FU6 A;  5KIL A;  2ZO4 A;  4B87 A;  2BTN A;  4EXS A;  5LS3 A;  3FCZ A;  2QED A;  2AIO A;  3KNS A;  4J5F A;  1X8H A;  2VW8 A;  5EVD A;  2BC2 A;  3FAI A;  3H3E A;  3PG4 A;  2NYP A;  3VPE A;  5ACP A;  3ZWF A;  4TZE A;  3RKK A;  3IE0 A;  4O98 A;  4UA4 A;  1WW1 A;  1JJT A;  4Z60 A;  4UWS B;  3I11 A;  2WYM A;  2Q9U A;  1SML A;  2BG8 A;  1YCF A;  4YSL A;  3SD9 A;  5AXO A;  4D1U A;  2HB9 A;  5K4K A;  5FQC A; 
#chains in the Genus database with same CATH homology
 2DKF A;  3LVZ A;  4LE6 A;  3IOF A;  4TYF A;  3ESH A;  2Y87 A;  2QDT A;  3DHC A;  3ADR A;  3ZR9 A;  2NZF A;  5AXR A;  4FSB A;  1P9E A;  3BV6 A;  1WUP A;  5EHT A;  1KO3 A;  5ACQ A;  5LE1 A;  3I0V A;  4UWP B;  1A7T A;  2ZZI A;  5AHR A;  1DXK A;  2CBN A;  2BG8 B;  2BG7 A;  1YCH A;  4P62 A;  2BIB A;  2P18 A;  5EV8 A;  3SFP A;  5A0V A;  4WD6 A;  2QJS A;  1BMC A;  1L9Y A;  2YNW A;  3IOG A;  3AJ3 A;  2P1E A;  4XWW A;  3T9M A;  3DHB A;  2GFJ A;  2BFZ A;  1XM8 A;  4KEP A;  4Z6X A;  4EYB A;  1YCG A;  3IE1 A;  2ZWR A;  2I7T A;  5ACS A;  5DPX A;  3PY5 A;  2XF4 A;  3I13 A;  4EFZ A;  3IEM A;  2BFK A;  4AD9 A;  1VJN A;  3SRX A;  5EV6 A;  2AZ4 A;  5HIP A;  5ACR A;  2OHI A;  4AX0 B;  5K4M A;  3RKJ A;  2ZNB A;  4DIK A;  2H6A A;  4HL2 A;  2GFK A;  4C1H A;  4D1T A;  4ZNB A;  5EH9 A;  5ACW A;  1KR3 A;  4XWT A;  4C1E A;  2BFZ B;  3RPC A;  4TZB A;  5HIQ A;  4JO0 A;  4ZO3 A;  1VME A;  3IEL A;  1WUO A;  4EYL A;  1M2X A;  3BK1 A;  3KNR A;  4FR7 A;  2NZE A;  3X2Y A;  2YZ3 A;  5FQA A;  4BP0 A;  4NQ4 A;  4GCW A;  4GYQ A;  5LCA A;  5HIO A;  3SW3 A;  5K0W A;  2GKL A;  4PVT A;  2BG2 A;  3X2X A;  2WYL A;  4UBQ A;  1JJE A;  4D1V A;  2R2D A;  5LLD A;  1XTO A;  4ZEJ A;  2WRS A;  3S0Z A;  4UWO B;  5HH4 A;  4FEK A;  1E5D A;  4KEQ A;  3JXP A;  5HH5 A;  1KO2 A;  3BK2 A;  4C1C A;  3I15 A;  2WHG A;  3VQZ A;  1ZKP A;  4RL2 A;  2Q0J A;  4PVO A;  2FU7 A;  1BVT A;  1MQO A;  4NQ6 A;  2YNT A;  1VGN A;  5EVB A;  1DDK A;  4D1W A;  2GCU A;  2FHX A;  4C1G A;  2UYX A;  3T3O A;  4ZO2 A;  1ZNB A;  3WXC A;  5HH6 A;  4DIL A;  3DH8 A;  2YNV A;  2P97 A;  5ACU A;  1K07 A;  3F9O A;  2QDS A;  3ZNB A;  5AEB A;  4RBS A;  4YSB A;  3X2Z A;  5A87 A;  4HL1 A;  2Y8A A;  4GYU A;  4NQ5 A;  4F6H A;  4AWZ A;  4RM5 A;  2OHJ A;  3Q6V A;  3AF5 A;  2BGA A;  4D02 A;  2A7M A;  5HIS A;  5ACX A;  4UWR B;  5A0T A;  4UAM A;  1QH5 A;  1HLK A;  4RAM A;  1ZTC A;  3AF6 A;  2M5D A;  4Z5Y A;  2M5C A;  3KL7 A;  1X8G A;  2BFL A;  2YNT B;  3L6N A;  4AX1 B;  3I14 A;  2FHX B;  4Z5Z A;  3IE2 A;  5EWA A;  2BR6 A;  3T3N A;  4AWY B;  3P2U A;  4NQ2 A;  5AYA A;  2YNV B;  1DD6 A;  3BC2 A;  2WYM C;  1QH3 A;  2YNU A;  4Z67 A;  1X8I A;  5ACV A;  1WRA A;  4XUK A;  5B3R A;  5LM6 A;  5FQB A;  2GMN A;  2BMI A;  4RL0 A;  5A5Z A;  2I7X A;  5AHO A;  4J5H A;  4C09 A;  2YCB A;  3G1P A;  3A4Y A;  4EYF A;  4EY2 A;  4U4L A;  5ACT A;  4C1F A;  5KIK A;  2Q0I A;  3TP9 A;  1BC2 A;  4CHL A;  2Q42 A;  4EXY A;  2OHH A;  3IDZ A;  5LCH A;  4F6Z A;  2FU8 A;  4YSK A;  3ZQ4 A;  4TYT A;  4TZF A;  4V0H A;  4Z7R A;  2DOO A;  2NXA A;  1Y44 A;  1JT1 A;  5LCF A;  4C1D A;  2FK6 A;  2Y8B A;  2E7Y A;  3MD7 A;  4BZ3 A;  3SPU A;  5B1U A;  3IEK A;  2FU9 A;  2XR1 A;  2I7V A;  2P4Z A;  3QH8 A;  4HKY A;  5LMC A;  5EW0 A;  5EVK A;  4TZ9 A;  5IQK A;  4H0D A;  3X30 A;  4RAW A;  5LSC A;  2BG6 A;  5B15 A;  5K4N A;  3DHA A;  3R2U A;  2FM6 A;  1A8T A;  3SBL A;  3PY6 A;  2QIN A;  2FU6 A;  5KIL A;  2ZO4 A;  4B87 A;  2BTN A;  4EXS A;  5LS3 A;  3FCZ A;  2QED A;  2AIO A;  3KNS A;  4J5F A;  1X8H A;  2VW8 A;  5EVD A;  2BC2 A;  3FAI A;  3H3E A;  3PG4 A;  2NYP A;  3VPE A;  5ACP A;  3ZWF A;  4TZE A;  3RKK A;  3IE0 A;  4O98 A;  4UA4 A;  1WW1 A;  1JJT A;  4Z60 A;  4UWS B;  3I11 A;  2WYM A;  2Q9U A;  1SML A;  2BG8 A;  1YCF A;  4YSL A;  3SD9 A;  5AXO A;  4D1U A;  2HB9 A;  5K4K A;  5FQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...