4Z5ZA

The 2.5-angstrom crystal structure of mg(2+)-bound pqqb from pseudomonas putida
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
308
structure length
308
Chain Sequence
MMYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIALSDDGVHWILCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLREGCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFPLRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLLVDGTLWEDDEMQRRGVGTRTGREMGHLAQNGPGGTLEVLDGFPRQRKVLIHINNTNPILDENSPERAEVLRRGVEVAFDGMSIELLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures reveal metal-binding plasticity at the active site of PqqB
rcsb
source organism Pseudomonas putida (strain kt2440)
molecule tags Hydrolase
molecule keywords Coenzyme PQQ synthesis protein B
total genus 103
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4z5zA00
3DHCA 1X8GA 3KL7A 4XUKA 5ACSA 5HISA 4Z7RA 3ESHA 4RL0A 4CHLA 1K07A 5EWAA 2Q0IA 2YNTB 3S0ZA 5ACQA 1X8HA 1MQOA 4FSBA 5LM6A 3WXCA 3IE1A 4TZFA 5ACUA 5DPXA 4ZO3A 3DHAA 1QH3A 4PVOA 5AHRA 4YSBA 3SRXA 3I13A 3VPEA 3X2ZA 5LE1A 5KILA 2BIBA 2BC2A 3X30A 5ACTA 2BG7A 3L6NA 2FK6A 1YCGA 3PG4A 5EVKA 4H0DA 2DOOA 2OHJA 4PVTA 5AEBA 1XM8A 4UAMA 3KNSA 4EFZA 2FU8A 2Q9UA 4Z67A 2P18A 2WYMC 2ZZIA 1WUPA 2BR6A 1XTOA 5ACXA 4V0HA 5LLDA 3R2UA 1YCHA 4AWYB 4LE6A 1ZTCA 5A87A 3ZNBA 2R2DA 4GYUA 3G1PA 4D1TA 5LMCA 3VQZA 1DD6A 5LCHA 3IOGA 1VJNA 4UWOB 2UYXA 3FCZA 1DXKA 4TZBA 1Y44A 3Q6VA 1L9YA 5LCFA 2P97A 4D1VA 3SPUA 4C1CA 4GCWA 1A8TA 4HL1A 3IELA 4KEPA 4XWWA 3IEMA 2BFLA 2XR1A 2BGAA 5EH9A 3KNRA 2BFZB 4RM5A 5EV8A 3IOFA 3SFPA 2WRSA 1BVTA 4C1HA 3I14A 5K0WA 1X8IA 2YNVB 4UA4A 4NQ4A 3AF5A 1M2XA 5LSCA 1ZKPA 2BFZA 5EVDA 2M5DA 2YCBA 4J5FA 5HH4A 4Z60A 1HLKA 3T3NA 2WYLA 3I11A 2NZFA 2OHHA 4D02A 5ACPA 3BK2A 2QEDA 2QDTA 4GYQA 1BMCA 2DKFA 2WHGA 4HKYA 3H3EA 4EYBA 2OHIA 4AWZA 4UWRB 1BC2A 2Q0JA 2FM6A 2Y87A 4RBSA 4TZ9A 3FAIA 4HL2A 5HH5A 4F6HA 4YSKA 4O98A 1ZNBA 3ZQ4A 1WW1A 3JXPA 4AX1B 3QH8A 4P62A 2Y8AA 4KEQA 2WYMA 5FQAA 5AXOA 3DH8A 3ADRA 4ZNBA 5HIQA 4EXYA 2ZWRA 2H6AA 3ZR9A 3PY6A 5EHTA 5HIOA 4XWTA 4UWPB 1VMEA 4YSLA 4AD9A 3MD7A 3P2UA 4RL2A 2QINA 3F9OA 4EY2A 5A5ZA 4BP0A 2GFJA 2YNTA 3I15A 1YCFA 4ZO2A 3T3OA 3X2YA 4AX0B 2NYPA 2I7TA 1A7TA 3TP9A 2VW8A 3PY5A 1DDKA 4U4LA 4D1WA 3SD9A 4J5HA 2BMIA 1KO3A 2I7XA 2FHXA 2BG8B 3I0VA 2HB9A 5KIKA 5IQKA 3IE2A 2BFKA 5HIPA 3AJ3A 2M5CA 1JJTA 2A7MA 1QH5A 1JT1A 2NZEA 4ZEJA 2GKLA 2FHXB 3DHBA 2QJSA 2I7VA 5K4NA 3ZWFA 5AHOA 4C1DA 2AIOA 5AYAA 1KR3A 3BV6A 3RKJA 3X2XA 4WD6A 5K4MA 4Z5ZA 5K4KA 4DIKA 4C1GA 2NXAA 1KO2A 5HH6A 3RPCA 4UBQA 5B15A 2XF4A 3RKKA 1E5DA 1WRAA 4RAWA 4NQ2A 3T9MA 3IDZA 4NQ5A 4TZEA 1SMLA 4D1UA 2YNVA 4DILA 4B87A 3IEKA 4TYFA 2YZ3A 2QDSA 4RAMA 2GFKA 4EYFA 4EYLA 4Z5YA 4UWSB 2FU7A 5ACWA 3SBLA 5ACRA 2YNWA 2ZO4A 3A4YA 2P1EA 5FQBA 3SW3A 5B3RA 4NQ6A 2CBNA 5LCAA 2BG2A 5LS3A 2YNUA 2FU6A 5FQCA 5EV6A 4FEKA 2FU9A 3BK1A 4Z6XA 2AZ4A 2GMNA 2BG8A 4JO0A 2E7YA 4EXSA 4C1EA 1JJEA 5B1UA 1WUOA 5A0TA 2BTNA 2GCUA 2Y8BA 4FR7A 5EW0A 5EVBA 2BG6A 4BZ3A 3BC2A 5AXRA 3IE0A 3LVZA 4TYTA 1P9EA 1VGNA 3AF6A 2P4ZA 2ZNBA 5A0VA 4C1FA 2Q42A 4F6ZA 4C09A 5ACVA
chains in the Genus database with same CATH superfamily
3DHCA 1X8GA 3KL7A 4XUKA 5ACSA 5HISA 4Z7RA 3ESHA 4RL0A 4CHLA 1K07A 5EWAA 2Q0IA 2YNTB 3S0ZA 5ACQA 1X8HA 1MQOA 4FSBA 5LM6A 3WXCA 3IE1A 4TZFA 5ACUA 5DPXA 4ZO3A 3DHAA 1QH3A 4PVOA 2CG2A 5AHRA 4YSBA 3SRXA 3I13A 3VPEA 3X2ZA 5LE1A 5KILA 2BIBA 2BC2A 3X30A 5ACTA 2BG7A 3L6NA 2FK6A 1YCGA 3PG4A 5EVKA 4H0DA 2DOOA 2OHJA 4PVTA 5AEBA 1XM8A 4UAMA 3KNSA 4EFZA 2FU8A 2Q9UA 4Z67A 5AJLA 2P18A 2WYMC 2ZZIA 1WUPA 2BR6A 1XTOA 5ACXA 4V0HA 5LLDA 3R2UA 1YCHA 4AWYB 4LE6A 1ZTCA 5A87A 3ZNBA 2R2DA 4GYUA 3G1PA 4D1TA 5LMCA 3VQZA 1DD6A 5LCHA 3IOGA 1VJNA 4UWOB 2UYXA 3FCZA 1DXKA 4TZBA 1Y44A 3Q6VA 1L9YA 5LCFA 2P97A 4D1VA 3SPUA 4C1CA 5A23A 4GCWA 1A8TA 4HL1A 3IELA 4KEPA 4XWWA 3IEMA 2BFLA 2XR1A 2BGAA 5EH9A 3KNRA 2BFZB 4RM5A 5EV8A 3IOFA 3SFPA 2WRSA 1BVTA 4C1HA 3I14A 5K0WA 1X8IA 2YNVB 4UA4A 4NQ4A 3AF5A 1M2XA 5LSCA 1ZKPA 2BFZA 5EVDA 2M5DA 2YCBA 4J5FA 5HH4A 4Z60A 1HLKA 3T3NA 2WYLA 3I11A 2NZFA 2OHHA 4D02A 5ACPA 3BK2A 2QEDA 2QDTA 4GYQA 1BMCA 2DKFA 2WHGA 4HKYA 3H3EA 4EYBA 2OHIA 4AWZA 4UWRB 1BC2A 2Q0JA 2FM6A 2Y87A 4RBSA 4TZ9A 3FAIA 4HL2A 5HH5A 4F6HA 2CFZA 4YSKA 4O98A 1ZNBA 3ZQ4A 1WW1A 3JXPA 4AX1B 3QH8A 4P62A 2Y8AA 4KEQA 2WYMA 5FQAA 5AXOA 3DH8A 3ADRA 4ZNBA 5HIQA 4EXYA 2ZWRA 2H6AA 3ZR9A 3PY6A 5EHTA 5HIOA 4XWTA 4UWPB 1VMEA 4YSLA 4AD9A 3MD7A 3P2UA 4RL2A 2QINA 3F9OA 4EY2A 5A5ZA 4BP0A 2GFJA 2YNTA 3I15A 1YCFA 4ZO2A 3T3OA 3X2YA 4AX0B 2NYPA 2I7TA 1A7TA 3TP9A 2VW8A 3PY5A 1DDKA 4U4LA 4D1WA 3SD9A 4J5HA 2BMIA 1KO3A 2I7XA 2FHXA 2BG8B 3I0VA 2HB9A 5KIKA 5IQKA 3IE2A 2BFKA 4NURA 5HIPA 3AJ3A 2M5CA 1JJTA 2A7MA 1QH5A 1JT1A 2CG3A 2NZEA 4ZEJA 2GKLA 4AV7A 2FHXB 3DHBA 2QJSA 2I7VA 5K4NA 3ZWFA 5AHOA 4C1DA 2AIOA 5AYAA 1KR3A 3BV6A 3RKJA 3X2XA 4WD6A 5K4MA 4Z5ZA 5K4KA 4DIKA 4C1GA 2NXAA 1KO2A 5HH6A 3RPCA 4UBQA 5B15A 2XF4A 3RKKA 1E5DA 1WRAA 4RAWA 4NQ2A 3T9MA 3IDZA 4NQ5A 4TZEA 1SMLA 4D1UA 2YNVA 4DILA 4B87A 3IEKA 4TYFA 2YZ3A 2QDSA 4RAMA 5AIJA 2GFKA 4EYFA 4EYLA 4Z5YA 4UWSB 2FU7A 5ACWA 3SBLA 5ACRA 2YNWA 4PDXA 2ZO4A 3A4YA 2P1EA 5FQBA 3SW3A 5B3RA 4NQ6A 2CBNA 5LCAA 2BG2A 5LS3A 2YNUA 2FU6A 2CFUA 5FQCA 5EV6A 4FEKA 2FU9A 3BK1A 4Z6XA 2AZ4A 2GMNA 2BG8A 4JO0A 2E7YA 4EXSA 4C1EA 1JJEA 5B1UA 1WUOA 5A0TA 2BTNA 2GCUA 2Y8BA 4FR7A 5EW0A 5EVBA 2BG6A 4BZ3A 3BC2A 5AXRA 3IE0A 4AXHA 3LVZA 4TYTA 1P9EA 1VGNA 3AF6A 2P4ZA 2ZNBA 2YHEA 4C1FA 2Q42A 5A0VA 4F6ZA 4C09A 5ACVA
chains in the Genus database with same CATH topology
3DHCA 1X8GA 3KL7A 4XUKA 5ACSA 5HISA 4Z7RA 3ESHA 4RL0A 4CHLA 1K07A 5EWAA 2Q0IA 2YNTB 3S0ZA 5ACQA 1X8HA 1MQOA 4FSBA 5LM6A 3WXCA 3IE1A 4TZFA 5ACUA 5DPXA 4ZO3A 3DHAA 1QH3A 4PVOA 5AHRA 4YSBA 3SRXA 3I13A 3VPEA 3X2ZA 5LE1A 5KILA 2BIBA 2BC2A 3X30A 5ACTA 2BG7A 3L6NA 2FK6A 1YCGA 3PG4A 5EVKA 4H0DA 2DOOA 2OHJA 4PVTA 5AEBA 1XM8A 4UAMA 3KNSA 4EFZA 2FU8A 2Q9UA 4Z67A 2P18A 2WYMC 2ZZIA 1WUPA 2BR6A 1XTOA 5ACXA 4V0HA 5LLDA 3R2UA 1YCHA 4AWYB 4LE6A 1ZTCA 5A87A 3ZNBA 2R2DA 4GYUA 3G1PA 4D1TA 5LMCA 3VQZA 1DD6A 5LCHA 3IOGA 1VJNA 4UWOB 2UYXA 3FCZA 1DXKA 4TZBA 1Y44A 3Q6VA 1L9YA 5LCFA 2P97A 4D1VA 3SPUA 4C1CA 4GCWA 1A8TA 4HL1A 3IELA 4KEPA 4XWWA 3IEMA 2BFLA 2XR1A 2BGAA 5EH9A 3KNRA 2BFZB 4RM5A 5EV8A 3IOFA 3SFPA 2WRSA 1BVTA 4C1HA 3I14A 5K0WA 1X8IA 2YNVB 4UA4A 4NQ4A 3AF5A 1M2XA 5LSCA 1ZKPA 2BFZA 5EVDA 2M5DA 2YCBA 4J5FA 5HH4A 4Z60A 1HLKA 3T3NA 2WYLA 3I11A 2NZFA 2OHHA 4D02A 5ACPA 3BK2A 2QEDA 2QDTA 4GYQA 1BMCA 2DKFA 2WHGA 4HKYA 3H3EA 4EYBA 2OHIA 4AWZA 4UWRB 1BC2A 2Q0JA 2FM6A 2Y87A 4RBSA 4TZ9A 3FAIA 4HL2A 5HH5A 4F6HA 4YSKA 4O98A 1ZNBA 3ZQ4A 1WW1A 3JXPA 4AX1B 3QH8A 4P62A 2Y8AA 4KEQA 2WYMA 5FQAA 5AXOA 3DH8A 3ADRA 4ZNBA 5HIQA 4EXYA 2ZWRA 2H6AA 3ZR9A 3PY6A 5EHTA 5HIOA 4XWTA 4UWPB 1VMEA 4YSLA 4AD9A 3MD7A 3P2UA 4RL2A 2QINA 3F9OA 4EY2A 5A5ZA 4BP0A 2GFJA 2YNTA 3I15A 1YCFA 4ZO2A 3T3OA 3X2YA 4AX0B 2NYPA 2I7TA 1A7TA 3TP9A 2VW8A 3PY5A 1DDKA 4U4LA 4D1WA 3SD9A 4J5HA 2BMIA 1KO3A 2I7XA 2FHXA 2BG8B 3I0VA 2HB9A 5KIKA 5IQKA 3IE2A 2BFKA 5HIPA 3AJ3A 2M5CA 1JJTA 2A7MA 1QH5A 1JT1A 2NZEA 4ZEJA 2GKLA 2FHXB 3DHBA 2QJSA 2I7VA 5K4NA 3ZWFA 5AHOA 4C1DA 2AIOA 5AYAA 1KR3A 3BV6A 3RKJA 3X2XA 4WD6A 5K4MA 4Z5ZA 5K4KA 4DIKA 4C1GA 2NXAA 1KO2A 5HH6A 3RPCA 4UBQA 5B15A 2XF4A 3RKKA 1E5DA 1WRAA 4RAWA 4NQ2A 3T9MA 3IDZA 4NQ5A 4TZEA 1SMLA 4D1UA 2YNVA 4DILA 4B87A 3IEKA 4TYFA 2YZ3A 2QDSA 4RAMA 2GFKA 4EYFA 4EYLA 4Z5YA 4UWSB 2FU7A 5ACWA 3SBLA 5ACRA 2YNWA 2ZO4A 3A4YA 2P1EA 5FQBA 3SW3A 5B3RA 4NQ6A 2CBNA 5LCAA 2BG2A 5LS3A 2YNUA 2FU6A 5FQCA 5EV6A 4FEKA 2FU9A 3BK1A 4Z6XA 2AZ4A 2GMNA 2BG8A 4JO0A 2E7YA 4EXSA 4C1EA 1JJEA 5B1UA 1WUOA 5A0TA 2BTNA 2GCUA 2Y8BA 4FR7A 5EW0A 5EVBA 2BG6A 4BZ3A 3BC2A 5AXRA 3IE0A 3LVZA 4TYTA 1P9EA 1VGNA 3AF6A 2P4ZA 2ZNBA 5A0VA 4C1FA 2Q42A 4F6ZA 4C09A 5ACVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DHC A;  1X8G A;  3KL7 A;  4XUK A;  5ACS A;  5HIS A;  4Z7R A;  3ESH A;  4RL0 A;  4CHL A;  1K07 A;  5EWA A;  2Q0I A;  2YNT B;  3S0Z A;  5ACQ A;  1X8H A;  1MQO A;  4FSB A;  5LM6 A;  3WXC A;  3IE1 A;  4TZF A;  5ACU A;  5DPX A;  4ZO3 A;  3DHA A;  1QH3 A;  4PVO A;  5AHR A;  4YSB A;  3SRX A;  3I13 A;  3VPE A;  3X2Z A;  5LE1 A;  5KIL A;  2BIB A;  2BC2 A;  3X30 A;  5ACT A;  2BG7 A;  3L6N A;  2FK6 A;  1YCG A;  3PG4 A;  5EVK A;  4H0D A;  2DOO A;  2OHJ A;  4PVT A;  5AEB A;  1XM8 A;  4UAM A;  3KNS A;  4EFZ A;  2FU8 A;  2Q9U A;  4Z67 A;  2P18 A;  2WYM C;  2ZZI A;  1WUP A;  2BR6 A;  1XTO A;  5ACX A;  4V0H A;  5LLD A;  3R2U A;  1YCH A;  4AWY B;  4LE6 A;  1ZTC A;  5A87 A;  3ZNB A;  2R2D A;  4GYU A;  3G1P A;  4D1T A;  5LMC A;  3VQZ A;  1DD6 A;  5LCH A;  3IOG A;  1VJN A;  4UWO B;  2UYX A;  3FCZ A;  1DXK A;  4TZB A;  1Y44 A;  3Q6V A;  1L9Y A;  5LCF A;  2P97 A;  4D1V A;  3SPU A;  4C1C A;  4GCW A;  1A8T A;  4HL1 A;  3IEL A;  4KEP A;  4XWW A;  3IEM A;  2BFL A;  2XR1 A;  2BGA A;  5EH9 A;  3KNR A;  2BFZ B;  4RM5 A;  5EV8 A;  3IOF A;  3SFP A;  2WRS A;  1BVT A;  4C1H A;  3I14 A;  5K0W A;  1X8I A;  2YNV B;  4UA4 A;  4NQ4 A;  3AF5 A;  1M2X A;  5LSC A;  1ZKP A;  2BFZ A;  5EVD A;  2M5D A;  2YCB A;  4J5F A;  5HH4 A;  4Z60 A;  1HLK A;  3T3N A;  2WYL A;  3I11 A;  2NZF A;  2OHH A;  4D02 A;  5ACP A;  3BK2 A;  2QED A;  2QDT A;  4GYQ A;  1BMC A;  2DKF A;  2WHG A;  4HKY A;  3H3E A;  4EYB A;  2OHI A;  4AWZ A;  4UWR B;  1BC2 A;  2Q0J A;  2FM6 A;  2Y87 A;  4RBS A;  4TZ9 A;  3FAI A;  4HL2 A;  5HH5 A;  4F6H A;  4YSK A;  4O98 A;  1ZNB A;  3ZQ4 A;  1WW1 A;  3JXP A;  4AX1 B;  3QH8 A;  4P62 A;  2Y8A A;  4KEQ A;  2WYM A;  5FQA A;  5AXO A;  3DH8 A;  3ADR A;  4ZNB A;  5HIQ A;  4EXY A;  2ZWR A;  2H6A A;  3ZR9 A;  3PY6 A;  5EHT A;  5HIO A;  4XWT A;  4UWP B;  1VME A;  4YSL A;  4AD9 A;  3MD7 A;  3P2U A;  4RL2 A;  2QIN A;  3F9O A;  4EY2 A;  5A5Z A;  4BP0 A;  2GFJ A;  2YNT A;  3I15 A;  1YCF A;  4ZO2 A;  3T3O A;  3X2Y A;  4AX0 B;  2NYP A;  2I7T A;  1A7T A;  3TP9 A;  2VW8 A;  3PY5 A;  1DDK A;  4U4L A;  4D1W A;  3SD9 A;  4J5H A;  2BMI A;  1KO3 A;  2I7X A;  2FHX A;  2BG8 B;  3I0V A;  2HB9 A;  5KIK A;  5IQK A;  3IE2 A;  2BFK A;  5HIP A;  3AJ3 A;  2M5C A;  1JJT A;  2A7M A;  1QH5 A;  1JT1 A;  2NZE A;  4ZEJ A;  2GKL A;  2FHX B;  3DHB A;  2QJS A;  2I7V A;  5K4N A;  3ZWF A;  5AHO A;  4C1D A;  2AIO A;  5AYA A;  1KR3 A;  3BV6 A;  3RKJ A;  3X2X A;  4WD6 A;  5K4M A;  4Z5Z A;  5K4K A;  4DIK A;  4C1G A;  2NXA A;  1KO2 A;  5HH6 A;  3RPC A;  4UBQ A;  5B15 A;  2XF4 A;  3RKK A;  1E5D A;  1WRA A;  4RAW A;  4NQ2 A;  3T9M A;  3IDZ A;  4NQ5 A;  4TZE A;  1SML A;  4D1U A;  2YNV A;  4DIL A;  4B87 A;  3IEK A;  4TYF A;  2YZ3 A;  2QDS A;  4RAM A;  2GFK A;  4EYF A;  4EYL A;  4Z5Y A;  4UWS B;  2FU7 A;  5ACW A;  3SBL A;  5ACR A;  2YNW A;  2ZO4 A;  3A4Y A;  2P1E A;  5FQB A;  3SW3 A;  5B3R A;  4NQ6 A;  2CBN A;  5LCA A;  2BG2 A;  5LS3 A;  2YNU A;  2FU6 A;  5FQC A;  5EV6 A;  4FEK A;  2FU9 A;  3BK1 A;  4Z6X A;  2AZ4 A;  2GMN A;  2BG8 A;  4JO0 A;  2E7Y A;  4EXS A;  4C1E A;  1JJE A;  5B1U A;  1WUO A;  5A0T A;  2BTN A;  2GCU A;  2Y8B A;  4FR7 A;  5EW0 A;  5EVB A;  2BG6 A;  4BZ3 A;  3BC2 A;  5AXR A;  3IE0 A;  3LVZ A;  4TYT A;  1P9E A;  1VGN A;  3AF6 A;  2P4Z A;  2ZNB A;  5A0V A;  4C1F A;  2Q42 A;  4F6Z A;  4C09 A;  5ACV A; 
#chains in the Genus database with same CATH topology
 3DHC A;  1X8G A;  3KL7 A;  4XUK A;  5ACS A;  5HIS A;  4Z7R A;  3ESH A;  4RL0 A;  4CHL A;  1K07 A;  5EWA A;  2Q0I A;  2YNT B;  3S0Z A;  5ACQ A;  1X8H A;  1MQO A;  4FSB A;  5LM6 A;  3WXC A;  3IE1 A;  4TZF A;  5ACU A;  5DPX A;  4ZO3 A;  3DHA A;  1QH3 A;  4PVO A;  2CG2 A;  5AHR A;  4YSB A;  3SRX A;  3I13 A;  3VPE A;  3X2Z A;  5LE1 A;  5KIL A;  2BIB A;  2BC2 A;  3X30 A;  5ACT A;  2BG7 A;  3L6N A;  2FK6 A;  1YCG A;  3PG4 A;  5EVK A;  4H0D A;  2DOO A;  2OHJ A;  4PVT A;  5AEB A;  1XM8 A;  4UAM A;  3KNS A;  4EFZ A;  2FU8 A;  2Q9U A;  4Z67 A;  5AJL A;  2P18 A;  2WYM C;  2ZZI A;  1WUP A;  2BR6 A;  1XTO A;  5ACX A;  4V0H A;  5LLD A;  3R2U A;  1YCH A;  4AWY B;  4LE6 A;  1ZTC A;  5A87 A;  3ZNB A;  2R2D A;  4GYU A;  3G1P A;  4D1T A;  5LMC A;  3VQZ A;  1DD6 A;  5LCH A;  3IOG A;  1VJN A;  4UWO B;  2UYX A;  3FCZ A;  1DXK A;  4TZB A;  1Y44 A;  3Q6V A;  1L9Y A;  5LCF A;  2P97 A;  4D1V A;  3SPU A;  4C1C A;  5A23 A;  4GCW A;  1A8T A;  4HL1 A;  3IEL A;  4KEP A;  4XWW A;  3IEM A;  2BFL A;  2XR1 A;  2BGA A;  5EH9 A;  3KNR A;  2BFZ B;  4RM5 A;  5EV8 A;  3IOF A;  3SFP A;  2WRS A;  1BVT A;  4C1H A;  3I14 A;  5K0W A;  1X8I A;  2YNV B;  4UA4 A;  4NQ4 A;  3AF5 A;  1M2X A;  5LSC A;  1ZKP A;  2BFZ A;  5EVD A;  2M5D A;  2YCB A;  4J5F A;  5HH4 A;  4Z60 A;  1HLK A;  3T3N A;  2WYL A;  3I11 A;  2NZF A;  2OHH A;  4D02 A;  5ACP A;  3BK2 A;  2QED A;  2QDT A;  4GYQ A;  1BMC A;  2DKF A;  2WHG A;  4HKY A;  3H3E A;  4EYB A;  2OHI A;  4AWZ A;  4UWR B;  1BC2 A;  2Q0J A;  2FM6 A;  2Y87 A;  4RBS A;  4TZ9 A;  3FAI A;  4HL2 A;  5HH5 A;  4F6H A;  2CFZ A;  4YSK A;  4O98 A;  1ZNB A;  3ZQ4 A;  1WW1 A;  3JXP A;  4AX1 B;  3QH8 A;  4P62 A;  2Y8A A;  4KEQ A;  2WYM A;  5FQA A;  5AXO A;  3DH8 A;  3ADR A;  4ZNB A;  5HIQ A;  4EXY A;  2ZWR A;  2H6A A;  3ZR9 A;  3PY6 A;  5EHT A;  5HIO A;  4XWT A;  4UWP B;  1VME A;  4YSL A;  4AD9 A;  3MD7 A;  3P2U A;  4RL2 A;  2QIN A;  3F9O A;  4EY2 A;  5A5Z A;  4BP0 A;  2GFJ A;  2YNT A;  3I15 A;  1YCF A;  4ZO2 A;  3T3O A;  3X2Y A;  4AX0 B;  2NYP A;  2I7T A;  1A7T A;  3TP9 A;  2VW8 A;  3PY5 A;  1DDK A;  4U4L A;  4D1W A;  3SD9 A;  4J5H A;  2BMI A;  1KO3 A;  2I7X A;  2FHX A;  2BG8 B;  3I0V A;  2HB9 A;  5KIK A;  5IQK A;  3IE2 A;  2BFK A;  4NUR A;  5HIP A;  3AJ3 A;  2M5C A;  1JJT A;  2A7M A;  1QH5 A;  1JT1 A;  2CG3 A;  2NZE A;  4ZEJ A;  2GKL A;  4AV7 A;  2FHX B;  3DHB A;  2QJS A;  2I7V A;  5K4N A;  3ZWF A;  5AHO A;  4C1D A;  2AIO A;  5AYA A;  1KR3 A;  3BV6 A;  3RKJ A;  3X2X A;  4WD6 A;  5K4M A;  4Z5Z A;  5K4K A;  4DIK A;  4C1G A;  2NXA A;  1KO2 A;  5HH6 A;  3RPC A;  4UBQ A;  5B15 A;  2XF4 A;  3RKK A;  1E5D A;  1WRA A;  4RAW A;  4NQ2 A;  3T9M A;  3IDZ A;  4NQ5 A;  4TZE A;  1SML A;  4D1U A;  2YNV A;  4DIL A;  4B87 A;  3IEK A;  4TYF A;  2YZ3 A;  2QDS A;  4RAM A;  5AIJ A;  2GFK A;  4EYF A;  4EYL A;  4Z5Y A;  4UWS B;  2FU7 A;  5ACW A;  3SBL A;  5ACR A;  2YNW A;  4PDX A;  2ZO4 A;  3A4Y A;  2P1E A;  5FQB A;  3SW3 A;  5B3R A;  4NQ6 A;  2CBN A;  5LCA A;  2BG2 A;  5LS3 A;  2YNU A;  2FU6 A;  2CFU A;  5FQC A;  5EV6 A;  4FEK A;  2FU9 A;  3BK1 A;  4Z6X A;  2AZ4 A;  2GMN A;  2BG8 A;  4JO0 A;  2E7Y A;  4EXS A;  4C1E A;  1JJE A;  5B1U A;  1WUO A;  5A0T A;  2BTN A;  2GCU A;  2Y8B A;  4FR7 A;  5EW0 A;  5EVB A;  2BG6 A;  4BZ3 A;  3BC2 A;  5AXR A;  3IE0 A;  4AXH A;  3LVZ A;  4TYT A;  1P9E A;  1VGN A;  3AF6 A;  2P4Z A;  2ZNB A;  2YHE A;  4C1F A;  2Q42 A;  5A0V A;  4F6Z A;  4C09 A;  5ACV A; 
#chains in the Genus database with same CATH homology
 3DHC A;  1X8G A;  3KL7 A;  4XUK A;  5ACS A;  5HIS A;  4Z7R A;  3ESH A;  4RL0 A;  4CHL A;  1K07 A;  5EWA A;  2Q0I A;  2YNT B;  3S0Z A;  5ACQ A;  1X8H A;  1MQO A;  4FSB A;  5LM6 A;  3WXC A;  3IE1 A;  4TZF A;  5ACU A;  5DPX A;  4ZO3 A;  3DHA A;  1QH3 A;  4PVO A;  5AHR A;  4YSB A;  3SRX A;  3I13 A;  3VPE A;  3X2Z A;  5LE1 A;  5KIL A;  2BIB A;  2BC2 A;  3X30 A;  5ACT A;  2BG7 A;  3L6N A;  2FK6 A;  1YCG A;  3PG4 A;  5EVK A;  4H0D A;  2DOO A;  2OHJ A;  4PVT A;  5AEB A;  1XM8 A;  4UAM A;  3KNS A;  4EFZ A;  2FU8 A;  2Q9U A;  4Z67 A;  2P18 A;  2WYM C;  2ZZI A;  1WUP A;  2BR6 A;  1XTO A;  5ACX A;  4V0H A;  5LLD A;  3R2U A;  1YCH A;  4AWY B;  4LE6 A;  1ZTC A;  5A87 A;  3ZNB A;  2R2D A;  4GYU A;  3G1P A;  4D1T A;  5LMC A;  3VQZ A;  1DD6 A;  5LCH A;  3IOG A;  1VJN A;  4UWO B;  2UYX A;  3FCZ A;  1DXK A;  4TZB A;  1Y44 A;  3Q6V A;  1L9Y A;  5LCF A;  2P97 A;  4D1V A;  3SPU A;  4C1C A;  4GCW A;  1A8T A;  4HL1 A;  3IEL A;  4KEP A;  4XWW A;  3IEM A;  2BFL A;  2XR1 A;  2BGA A;  5EH9 A;  3KNR A;  2BFZ B;  4RM5 A;  5EV8 A;  3IOF A;  3SFP A;  2WRS A;  1BVT A;  4C1H A;  3I14 A;  5K0W A;  1X8I A;  2YNV B;  4UA4 A;  4NQ4 A;  3AF5 A;  1M2X A;  5LSC A;  1ZKP A;  2BFZ A;  5EVD A;  2M5D A;  2YCB A;  4J5F A;  5HH4 A;  4Z60 A;  1HLK A;  3T3N A;  2WYL A;  3I11 A;  2NZF A;  2OHH A;  4D02 A;  5ACP A;  3BK2 A;  2QED A;  2QDT A;  4GYQ A;  1BMC A;  2DKF A;  2WHG A;  4HKY A;  3H3E A;  4EYB A;  2OHI A;  4AWZ A;  4UWR B;  1BC2 A;  2Q0J A;  2FM6 A;  2Y87 A;  4RBS A;  4TZ9 A;  3FAI A;  4HL2 A;  5HH5 A;  4F6H A;  4YSK A;  4O98 A;  1ZNB A;  3ZQ4 A;  1WW1 A;  3JXP A;  4AX1 B;  3QH8 A;  4P62 A;  2Y8A A;  4KEQ A;  2WYM A;  5FQA A;  5AXO A;  3DH8 A;  3ADR A;  4ZNB A;  5HIQ A;  4EXY A;  2ZWR A;  2H6A A;  3ZR9 A;  3PY6 A;  5EHT A;  5HIO A;  4XWT A;  4UWP B;  1VME A;  4YSL A;  4AD9 A;  3MD7 A;  3P2U A;  4RL2 A;  2QIN A;  3F9O A;  4EY2 A;  5A5Z A;  4BP0 A;  2GFJ A;  2YNT A;  3I15 A;  1YCF A;  4ZO2 A;  3T3O A;  3X2Y A;  4AX0 B;  2NYP A;  2I7T A;  1A7T A;  3TP9 A;  2VW8 A;  3PY5 A;  1DDK A;  4U4L A;  4D1W A;  3SD9 A;  4J5H A;  2BMI A;  1KO3 A;  2I7X A;  2FHX A;  2BG8 B;  3I0V A;  2HB9 A;  5KIK A;  5IQK A;  3IE2 A;  2BFK A;  5HIP A;  3AJ3 A;  2M5C A;  1JJT A;  2A7M A;  1QH5 A;  1JT1 A;  2NZE A;  4ZEJ A;  2GKL A;  2FHX B;  3DHB A;  2QJS A;  2I7V A;  5K4N A;  3ZWF A;  5AHO A;  4C1D A;  2AIO A;  5AYA A;  1KR3 A;  3BV6 A;  3RKJ A;  3X2X A;  4WD6 A;  5K4M A;  4Z5Z A;  5K4K A;  4DIK A;  4C1G A;  2NXA A;  1KO2 A;  5HH6 A;  3RPC A;  4UBQ A;  5B15 A;  2XF4 A;  3RKK A;  1E5D A;  1WRA A;  4RAW A;  4NQ2 A;  3T9M A;  3IDZ A;  4NQ5 A;  4TZE A;  1SML A;  4D1U A;  2YNV A;  4DIL A;  4B87 A;  3IEK A;  4TYF A;  2YZ3 A;  2QDS A;  4RAM A;  2GFK A;  4EYF A;  4EYL A;  4Z5Y A;  4UWS B;  2FU7 A;  5ACW A;  3SBL A;  5ACR A;  2YNW A;  2ZO4 A;  3A4Y A;  2P1E A;  5FQB A;  3SW3 A;  5B3R A;  4NQ6 A;  2CBN A;  5LCA A;  2BG2 A;  5LS3 A;  2YNU A;  2FU6 A;  5FQC A;  5EV6 A;  4FEK A;  2FU9 A;  3BK1 A;  4Z6X A;  2AZ4 A;  2GMN A;  2BG8 A;  4JO0 A;  2E7Y A;  4EXS A;  4C1E A;  1JJE A;  5B1U A;  1WUO A;  5A0T A;  2BTN A;  2GCU A;  2Y8B A;  4FR7 A;  5EW0 A;  5EVB A;  2BG6 A;  4BZ3 A;  3BC2 A;  5AXR A;  3IE0 A;  3LVZ A;  4TYT A;  1P9E A;  1VGN A;  3AF6 A;  2P4Z A;  2ZNB A;  5A0V A;  4C1F A;  2Q42 A;  4F6Z A;  4C09 A;  5ACV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...