4Z5ZA

The 2.5-angstrom crystal structure of mg(2+)-bound pqqb from pseudomonas putida
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
308
structure length
308
Chain Sequence
b'MMYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIALSDDGVHWILCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLREGCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFPLRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLLVDGTLWEDDEMQRRGVGTRTGREMGHLAQNGPGGTLEVLDGFPRQRKVLIHINNTNPILDENSPERAEVLRRGVEVAFDGMSIELLEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coenzyme PQQ synthesis protein B
publication title Crystal structures reveal metal-binding plasticity at the active site of PqqB
rcsb
source organism Pseudomonas putida (strain kt2440)
molecule tags Hydrolase
total genus 103
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4z5zA00
3LVZA 1DXKA 1WW1A 4RM5A 2FHXA 3RKJA 4UWSB 4TYFA 5EVBA 5KIKA 3JXPA 3X2XA 1K07A 4YSKA 5ACQA 5LS3A 2GMNA 2P97A 4D1TA 3IOGA 3T9MA 4ZNBA 3Q6VA 5AEBA 1KR3A 2CBNA 4AWYB 5ACSA 5LCFA 5A0TA 3VQZA 3ADRA 1VJNA 5A0VA 4NQ4A 4AD9A 3DHBA 4PVTA 3SW3A 3KNRA 4C1GA 5AHOA 4BP0A 3KL7A 2BFZA 4Z5ZA 1BMCA 2BGAA 3P2UA 2NZFA 2P18A 5LLDA 1QH3A 1WUOA 4Z67A 1KO3A 4GYQA 4NQ2A 3ZNBA 1KO2A 4DIKA 3BC2A 1DD6A 2BMIA 2GCUA 2FU6A 2OHHA 4KEQA 4D1WA 3FAIA 5ACTA 3H3EA 5EV8A 5AHRA 3I14A 2YNWA 5K4KA 2FU9A 2GFJA 3BV6A 5FQAA 1MQOA 1VMEA 3I0VA 2I7XA 1SMLA 2BIBA 3A4YA 5K0WA 4WD6A 2BFZB 4TZFA 2HB9A 3T3OA 2I7VA 4EY2A 2FU8A 5HIQA 1P9EA 4HL2A 4EXYA 3RKKA 3IE0A 3FCZA 2FU7A 2QDSA 3IEKA 5B15A 5LSCA 1ZTCA 1YCGA 2BG7A 4TZEA 4XWTA 4D1UA 4P62A 3PY5A 3ZR9A 2R2DA 4UAMA 1Y44A 4EYLA 1ZKPA 5AXRA 5EH9A 4C1HA 2P4ZA 1XTOA 4FEKA 4RAMA 4UWPB 2YNVA 2FK6A 4RL2A 4ZO2A 1WRAA 5FQCA 2Q42A 2XR1A 3T3NA 1DDKA 5ACVA 2YNTA 3PG4A 5B3RA 1BC2A 5A5ZA 3PY6A 1X8GA 3L6NA 4EXSA 3IEMA 3IELA 3RPCA 4RAWA 2Y8BA 4J5HA 4C1CA 1WUPA 3F9OA 1VGNA 3S0ZA 4GYUA 2NZEA 3X2YA 3AJ3A 4NQ6A 3SFPA 4EYBA 4CHLA 4YSBA 5LCHA 3IOFA 3IE1A 4C1DA 4C09A 4TYTA 4JO0A 3I11A 4ZEJA 4RBSA 5HH5A 5LMCA 5EWAA 3I15A 4PVOA 2FM6A 2Y8AA 2NXAA 2NYPA 5EHTA 3AF6A 2WYMC 4EYFA 4F6ZA 4Z60A 5K4NA 2AIOA 4DILA 2BG8A 2YNVB 1YCFA 3DHCA 4D02A 4F6HA 1L9YA 3DHAA 2VW8A 2QEDA 5HISA 4EFZA 2YCBA 2GFKA 2ZZIA 1A7TA 2YNTB 4TZBA 5AYAA 2E7YA 2H6AA 3BK1A 5EVDA 2OHIA 2BG2A 1BVTA 5HIOA 2BG6A 2ZO4A 5EVKA 3ZWFA 5ACXA 2Q0IA 4U4LA 5K4MA 3MD7A 2GKLA 4XUKA 3I13A 4BZ3A 3DH8A 5B1UA 5DPXA 2ZNBA 3X30A 1XM8A 3IE2A 2BFKA 5IQKA 4B87A 5HIPA 2DOOA 2P1EA 5HH6A 5LE1A 4D1VA 4AX0B 4FSBA 2WHGA 4UBQA 1QH5A 2BFLA 2DKFA 2BG8B 4Z5YA 5ACPA 4FR7A 2WYMA 4V0HA 5LM6A 3SD9A 3VPEA 4C1EA 3R2UA 2M5CA 5AXOA 1A8TA 1X8HA 4J5FA 3SBLA 4ZO3A 2YNUA 4UA4A 1JT1A 3X2ZA 2BR6A 3SPUA 2QJSA 4HL1A 2YZ3A 1E5DA 2BC2A 3TP9A 1HLKA 4KEPA 2M5DA 2A7MA 5A87A 2I7TA 2XF4A 4C1FA 5EV6A 3ESHA 4NQ5A 4UWRB 2FHXB 2Q0JA 4XWWA 3WXCA 4HKYA 2AZ4A 5ACRA 4GCWA 4AX1B 2BTNA 2Q9UA 4YSLA 5KILA 4AWZA 2WYLA 4O98A 4Z7RA 3IDZA 1X8IA 3KNSA 1JJEA 1M2XA 2QINA 2Y87A 3SRXA 1JJTA 4RL0A 1YCHA 4LE6A 3QH8A 2WRSA 3BK2A 4TZ9A 2OHJA 1ZNBA 2QDTA 4Z6XA 3AF5A 4UWOB 5HH4A 5ACUA 2UYXA 3G1PA 2ZWRA 5EW0A 5FQBA 4H0DA 3ZQ4A 5LCAA 5ACWA
chains in the Genus database with same CATH superfamily
3LVZA 1DXKA 1WW1A 4RM5A 2FHXA 3RKJA 4UWSB 4TYFA 5EVBA 5KIKA 3JXPA 3X2XA 1K07A 4YSKA 5ACQA 5LS3A 2GMNA 2P97A 4D1TA 3IOGA 3T9MA 4ZNBA 3Q6VA 5AEBA 1KR3A 2CBNA 4AWYB 5ACSA 5LCFA 5A0TA 3VQZA 3ADRA 1VJNA 5A0VA 4NQ4A 4AD9A 3DHBA 4PVTA 3SW3A 3KNRA 4C1GA 5AHOA 4BP0A 5A23A 3KL7A 2BFZA 4Z5ZA 1BMCA 2BGAA 3P2UA 2NZFA 2P18A 5LLDA 1QH3A 1WUOA 4Z67A 1KO3A 4GYQA 4NQ2A 3ZNBA 1KO2A 4DIKA 3BC2A 1DD6A 2BMIA 2GCUA 2FU6A 2OHHA 4KEQA 4D1WA 3FAIA 5ACTA 3H3EA 5EV8A 5AHRA 3I14A 2YNWA 5K4KA 2FU9A 2GFJA 3BV6A 5FQAA 1MQOA 1VMEA 3I0VA 2I7XA 1SMLA 2BIBA 3A4YA 5K0WA 4WD6A 2BFZB 4TZFA 2HB9A 3T3OA 2I7VA 4EY2A 2FU8A 5HIQA 1P9EA 4NURA 4HL2A 4AXHA 4EXYA 3RKKA 3IE0A 3FCZA 2FU7A 2QDSA 3IEKA 5B15A 5LSCA 1ZTCA 1YCGA 2BG7A 4TZEA 4XWTA 4D1UA 4P62A 3PY5A 3ZR9A 2R2DA 4UAMA 1Y44A 4EYLA 1ZKPA 5AXRA 5EH9A 4C1HA 2P4ZA 1XTOA 4FEKA 4RAMA 4UWPB 2YNVA 2FK6A 4RL2A 4ZO2A 1WRAA 5FQCA 2Q42A 2XR1A 3T3NA 1DDKA 5ACVA 2YNTA 3PG4A 5B3RA 1BC2A 5A5ZA 3PY6A 2YHEA 1X8GA 3L6NA 4EXSA 3IEMA 3IELA 3RPCA 4RAWA 2Y8BA 4J5HA 4C1CA 1WUPA 3F9OA 1VGNA 3S0ZA 4GYUA 2NZEA 3X2YA 3AJ3A 4NQ6A 3SFPA 4EYBA 4CHLA 4YSBA 5LCHA 3IOFA 3IE1A 4C1DA 4C09A 4TYTA 4JO0A 3I11A 4ZEJA 4RBSA 5HH5A 5LMCA 5EWAA 3I15A 4PVOA 2FM6A 2Y8AA 2NXAA 2NYPA 5EHTA 3AF6A 2WYMC 4EYFA 4F6ZA 4Z60A 5K4NA 2AIOA 4DILA 2BG8A 2YNVB 1YCFA 3DHCA 4D02A 4F6HA 1L9YA 3DHAA 2VW8A 2QEDA 5HISA 4EFZA 2YCBA 2GFKA 2ZZIA 1A7TA 2YNTB 4TZBA 5AYAA 2E7YA 2H6AA 3BK1A 5EVDA 2OHIA 2BG2A 1BVTA 5HIOA 2BG6A 2ZO4A 2CG3A 5EVKA 3ZWFA 5ACXA 2Q0IA 4U4LA 5K4MA 3MD7A 2GKLA 4XUKA 3I13A 4BZ3A 3DH8A 5AIJA 5B1UA 5DPXA 2ZNBA 3X30A 1XM8A 3IE2A 2BFKA 5IQKA 4B87A 5HIPA 2DOOA 2P1EA 5HH6A 5LE1A 4D1VA 4AX0B 4FSBA 2WHGA 4UBQA 1QH5A 2BFLA 2DKFA 2BG8B 4Z5YA 5ACPA 4FR7A 2WYMA 4V0HA 5LM6A 3SD9A 3VPEA 4C1EA 3R2UA 2M5CA 4PDXA 5AXOA 1A8TA 1X8HA 4J5FA 3SBLA 4ZO3A 2YNUA 4UA4A 1JT1A 3X2ZA 2BR6A 3SPUA 2QJSA 4HL1A 2YZ3A 1E5DA 2BC2A 3TP9A 1HLKA 4KEPA 2M5DA 2A7MA 5A87A 2I7TA 2XF4A 4C1FA 5EV6A 5AJLA 3ESHA 4NQ5A 4AV7A 4UWRB 2FHXB 2Q0JA 2CFZA 4XWWA 3WXCA 4HKYA 2AZ4A 5ACRA 4GCWA 4AX1B 2BTNA 2Q9UA 4YSLA 5KILA 4AWZA 2WYLA 4O98A 4Z7RA 3IDZA 1X8IA 3KNSA 1JJEA 1M2XA 2QINA 2Y87A 3SRXA 1JJTA 4RL0A 1YCHA 4LE6A 3QH8A 2CG2A 2WRSA 2CFUA 3BK2A 4TZ9A 2OHJA 1ZNBA 2QDTA 4Z6XA 3AF5A 4UWOB 5HH4A 5ACUA 2UYXA 3G1PA 2ZWRA 5EW0A 5FQBA 4H0DA 3ZQ4A 5LCAA 5ACWA
chains in the Genus database with same CATH topology
3LVZA 1DXKA 1WW1A 4RM5A 2FHXA 3RKJA 4UWSB 4TYFA 5EVBA 5KIKA 3JXPA 3X2XA 1K07A 4YSKA 5ACQA 5LS3A 2GMNA 2P97A 4D1TA 3IOGA 3T9MA 4ZNBA 3Q6VA 5AEBA 1KR3A 2CBNA 4AWYB 5ACSA 5LCFA 5A0TA 3VQZA 3ADRA 1VJNA 5A0VA 4NQ4A 4AD9A 3DHBA 4PVTA 3SW3A 3KNRA 4C1GA 5AHOA 4BP0A 3KL7A 2BFZA 4Z5ZA 1BMCA 2BGAA 3P2UA 2NZFA 2P18A 5LLDA 1QH3A 1WUOA 4Z67A 1KO3A 4GYQA 4NQ2A 3ZNBA 1KO2A 4DIKA 3BC2A 1DD6A 2BMIA 2GCUA 2FU6A 2OHHA 4KEQA 4D1WA 3FAIA 5ACTA 3H3EA 5EV8A 5AHRA 3I14A 2YNWA 5K4KA 2FU9A 2GFJA 3BV6A 5FQAA 1MQOA 1VMEA 3I0VA 2I7XA 1SMLA 2BIBA 3A4YA 5K0WA 4WD6A 2BFZB 4TZFA 2HB9A 3T3OA 2I7VA 4EY2A 2FU8A 5HIQA 1P9EA 4HL2A 4EXYA 3RKKA 3IE0A 3FCZA 2FU7A 2QDSA 3IEKA 5B15A 5LSCA 1ZTCA 1YCGA 2BG7A 4TZEA 4XWTA 4D1UA 4P62A 3PY5A 3ZR9A 2R2DA 4UAMA 1Y44A 4EYLA 1ZKPA 5AXRA 5EH9A 4C1HA 2P4ZA 1XTOA 4FEKA 4RAMA 4UWPB 2YNVA 2FK6A 4RL2A 4ZO2A 1WRAA 5FQCA 2Q42A 2XR1A 3T3NA 1DDKA 5ACVA 2YNTA 3PG4A 5B3RA 1BC2A 5A5ZA 3PY6A 1X8GA 3L6NA 4EXSA 3IEMA 3IELA 3RPCA 4RAWA 2Y8BA 4J5HA 4C1CA 1WUPA 3F9OA 1VGNA 3S0ZA 4GYUA 2NZEA 3X2YA 3AJ3A 4NQ6A 3SFPA 4EYBA 4CHLA 4YSBA 5LCHA 3IOFA 3IE1A 4C1DA 4C09A 4TYTA 4JO0A 3I11A 4ZEJA 4RBSA 5HH5A 5LMCA 5EWAA 3I15A 4PVOA 2FM6A 2Y8AA 2NXAA 2NYPA 5EHTA 3AF6A 2WYMC 4EYFA 4F6ZA 4Z60A 5K4NA 2AIOA 4DILA 2BG8A 2YNVB 1YCFA 3DHCA 4D02A 4F6HA 1L9YA 3DHAA 2VW8A 2QEDA 5HISA 4EFZA 2YCBA 2GFKA 2ZZIA 1A7TA 2YNTB 4TZBA 5AYAA 2E7YA 2H6AA 3BK1A 5EVDA 2OHIA 2BG2A 1BVTA 5HIOA 2BG6A 2ZO4A 5EVKA 3ZWFA 5ACXA 2Q0IA 4U4LA 5K4MA 3MD7A 2GKLA 4XUKA 3I13A 4BZ3A 3DH8A 5B1UA 5DPXA 2ZNBA 3X30A 1XM8A 3IE2A 2BFKA 5IQKA 4B87A 5HIPA 2DOOA 2P1EA 5HH6A 5LE1A 4D1VA 4AX0B 4FSBA 2WHGA 4UBQA 1QH5A 2BFLA 2DKFA 2BG8B 4Z5YA 5ACPA 4FR7A 2WYMA 4V0HA 5LM6A 3SD9A 3VPEA 4C1EA 3R2UA 2M5CA 5AXOA 1A8TA 1X8HA 4J5FA 3SBLA 4ZO3A 2YNUA 4UA4A 1JT1A 3X2ZA 2BR6A 3SPUA 2QJSA 4HL1A 2YZ3A 1E5DA 2BC2A 3TP9A 1HLKA 4KEPA 2M5DA 2A7MA 5A87A 2I7TA 2XF4A 4C1FA 5EV6A 3ESHA 4NQ5A 4UWRB 2FHXB 2Q0JA 4XWWA 3WXCA 4HKYA 2AZ4A 5ACRA 4GCWA 4AX1B 2BTNA 2Q9UA 4YSLA 5KILA 4AWZA 2WYLA 4O98A 4Z7RA 3IDZA 1X8IA 3KNSA 1JJEA 1M2XA 2QINA 2Y87A 3SRXA 1JJTA 4RL0A 1YCHA 4LE6A 3QH8A 2WRSA 3BK2A 4TZ9A 2OHJA 1ZNBA 2QDTA 4Z6XA 3AF5A 4UWOB 5HH4A 5ACUA 2UYXA 3G1PA 2ZWRA 5EW0A 5FQBA 4H0DA 3ZQ4A 5LCAA 5ACWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LVZ A;  1DXK A;  1WW1 A;  4RM5 A;  2FHX A;  3RKJ A;  4UWS B;  4TYF A;  5EVB A;  5KIK A;  3JXP A;  3X2X A;  1K07 A;  4YSK A;  5ACQ A;  5LS3 A;  2GMN A;  2P97 A;  4D1T A;  3IOG A;  3T9M A;  4ZNB A;  3Q6V A;  5AEB A;  1KR3 A;  2CBN A;  4AWY B;  5ACS A;  5LCF A;  5A0T A;  3VQZ A;  3ADR A;  1VJN A;  5A0V A;  4NQ4 A;  4AD9 A;  3DHB A;  4PVT A;  3SW3 A;  3KNR A;  4C1G A;  5AHO A;  4BP0 A;  3KL7 A;  2BFZ A;  4Z5Z A;  1BMC A;  2BGA A;  3P2U A;  2NZF A;  2P18 A;  5LLD A;  1QH3 A;  1WUO A;  4Z67 A;  1KO3 A;  4GYQ A;  4NQ2 A;  3ZNB A;  1KO2 A;  4DIK A;  3BC2 A;  1DD6 A;  2BMI A;  2GCU A;  2FU6 A;  2OHH A;  4KEQ A;  4D1W A;  3FAI A;  5ACT A;  3H3E A;  5EV8 A;  5AHR A;  3I14 A;  2YNW A;  5K4K A;  2FU9 A;  2GFJ A;  3BV6 A;  5FQA A;  1MQO A;  1VME A;  3I0V A;  2I7X A;  1SML A;  2BIB A;  3A4Y A;  5K0W A;  4WD6 A;  2BFZ B;  4TZF A;  2HB9 A;  3T3O A;  2I7V A;  4EY2 A;  2FU8 A;  5HIQ A;  1P9E A;  4HL2 A;  4EXY A;  3RKK A;  3IE0 A;  3FCZ A;  2FU7 A;  2QDS A;  3IEK A;  5B15 A;  5LSC A;  1ZTC A;  1YCG A;  2BG7 A;  4TZE A;  4XWT A;  4D1U A;  4P62 A;  3PY5 A;  3ZR9 A;  2R2D A;  4UAM A;  1Y44 A;  4EYL A;  1ZKP A;  5AXR A;  5EH9 A;  4C1H A;  2P4Z A;  1XTO A;  4FEK A;  4RAM A;  4UWP B;  2YNV A;  2FK6 A;  4RL2 A;  4ZO2 A;  1WRA A;  5FQC A;  2Q42 A;  2XR1 A;  3T3N A;  1DDK A;  5ACV A;  2YNT A;  3PG4 A;  5B3R A;  1BC2 A;  5A5Z A;  3PY6 A;  1X8G A;  3L6N A;  4EXS A;  3IEM A;  3IEL A;  3RPC A;  4RAW A;  2Y8B A;  4J5H A;  4C1C A;  1WUP A;  3F9O A;  1VGN A;  3S0Z A;  4GYU A;  2NZE A;  3X2Y A;  3AJ3 A;  4NQ6 A;  3SFP A;  4EYB A;  4CHL A;  4YSB A;  5LCH A;  3IOF A;  3IE1 A;  4C1D A;  4C09 A;  4TYT A;  4JO0 A;  3I11 A;  4ZEJ A;  4RBS A;  5HH5 A;  5LMC A;  5EWA A;  3I15 A;  4PVO A;  2FM6 A;  2Y8A A;  2NXA A;  2NYP A;  5EHT A;  3AF6 A;  2WYM C;  4EYF A;  4F6Z A;  4Z60 A;  5K4N A;  2AIO A;  4DIL A;  2BG8 A;  2YNV B;  1YCF A;  3DHC A;  4D02 A;  4F6H A;  1L9Y A;  3DHA A;  2VW8 A;  2QED A;  5HIS A;  4EFZ A;  2YCB A;  2GFK A;  2ZZI A;  1A7T A;  2YNT B;  4TZB A;  5AYA A;  2E7Y A;  2H6A A;  3BK1 A;  5EVD A;  2OHI A;  2BG2 A;  1BVT A;  5HIO A;  2BG6 A;  2ZO4 A;  5EVK A;  3ZWF A;  5ACX A;  2Q0I A;  4U4L A;  5K4M A;  3MD7 A;  2GKL A;  4XUK A;  3I13 A;  4BZ3 A;  3DH8 A;  5B1U A;  5DPX A;  2ZNB A;  3X30 A;  1XM8 A;  3IE2 A;  2BFK A;  5IQK A;  4B87 A;  5HIP A;  2DOO A;  2P1E A;  5HH6 A;  5LE1 A;  4D1V A;  4AX0 B;  4FSB A;  2WHG A;  4UBQ A;  1QH5 A;  2BFL A;  2DKF A;  2BG8 B;  4Z5Y A;  5ACP A;  4FR7 A;  2WYM A;  4V0H A;  5LM6 A;  3SD9 A;  3VPE A;  4C1E A;  3R2U A;  2M5C A;  5AXO A;  1A8T A;  1X8H A;  4J5F A;  3SBL A;  4ZO3 A;  2YNU A;  4UA4 A;  1JT1 A;  3X2Z A;  2BR6 A;  3SPU A;  2QJS A;  4HL1 A;  2YZ3 A;  1E5D A;  2BC2 A;  3TP9 A;  1HLK A;  4KEP A;  2M5D A;  2A7M A;  5A87 A;  2I7T A;  2XF4 A;  4C1F A;  5EV6 A;  3ESH A;  4NQ5 A;  4UWR B;  2FHX B;  2Q0J A;  4XWW A;  3WXC A;  4HKY A;  2AZ4 A;  5ACR A;  4GCW A;  4AX1 B;  2BTN A;  2Q9U A;  4YSL A;  5KIL A;  4AWZ A;  2WYL A;  4O98 A;  4Z7R A;  3IDZ A;  1X8I A;  3KNS A;  1JJE A;  1M2X A;  2QIN A;  2Y87 A;  3SRX A;  1JJT A;  4RL0 A;  1YCH A;  4LE6 A;  3QH8 A;  2WRS A;  3BK2 A;  4TZ9 A;  2OHJ A;  1ZNB A;  2QDT A;  4Z6X A;  3AF5 A;  4UWO B;  5HH4 A;  5ACU A;  2UYX A;  3G1P A;  2ZWR A;  5EW0 A;  5FQB A;  4H0D A;  3ZQ4 A;  5LCA A;  5ACW A; 
#chains in the Genus database with same CATH topology
 3LVZ A;  1DXK A;  1WW1 A;  4RM5 A;  2FHX A;  3RKJ A;  4UWS B;  4TYF A;  5EVB A;  5KIK A;  3JXP A;  3X2X A;  1K07 A;  4YSK A;  5ACQ A;  5LS3 A;  2GMN A;  2P97 A;  4D1T A;  3IOG A;  3T9M A;  4ZNB A;  3Q6V A;  5AEB A;  1KR3 A;  2CBN A;  4AWY B;  5ACS A;  5LCF A;  5A0T A;  3VQZ A;  3ADR A;  1VJN A;  5A0V A;  4NQ4 A;  4AD9 A;  3DHB A;  4PVT A;  3SW3 A;  3KNR A;  4C1G A;  5AHO A;  4BP0 A;  5A23 A;  3KL7 A;  2BFZ A;  4Z5Z A;  1BMC A;  2BGA A;  3P2U A;  2NZF A;  2P18 A;  5LLD A;  1QH3 A;  1WUO A;  4Z67 A;  1KO3 A;  4GYQ A;  4NQ2 A;  3ZNB A;  1KO2 A;  4DIK A;  3BC2 A;  1DD6 A;  2BMI A;  2GCU A;  2FU6 A;  2OHH A;  4KEQ A;  4D1W A;  3FAI A;  5ACT A;  3H3E A;  5EV8 A;  5AHR A;  3I14 A;  2YNW A;  5K4K A;  2FU9 A;  2GFJ A;  3BV6 A;  5FQA A;  1MQO A;  1VME A;  3I0V A;  2I7X A;  1SML A;  2BIB A;  3A4Y A;  5K0W A;  4WD6 A;  2BFZ B;  4TZF A;  2HB9 A;  3T3O A;  2I7V A;  4EY2 A;  2FU8 A;  5HIQ A;  1P9E A;  4NUR A;  4HL2 A;  4AXH A;  4EXY A;  3RKK A;  3IE0 A;  3FCZ A;  2FU7 A;  2QDS A;  3IEK A;  5B15 A;  5LSC A;  1ZTC A;  1YCG A;  2BG7 A;  4TZE A;  4XWT A;  4D1U A;  4P62 A;  3PY5 A;  3ZR9 A;  2R2D A;  4UAM A;  1Y44 A;  4EYL A;  1ZKP A;  5AXR A;  5EH9 A;  4C1H A;  2P4Z A;  1XTO A;  4FEK A;  4RAM A;  4UWP B;  2YNV A;  2FK6 A;  4RL2 A;  4ZO2 A;  1WRA A;  5FQC A;  2Q42 A;  2XR1 A;  3T3N A;  1DDK A;  5ACV A;  2YNT A;  3PG4 A;  5B3R A;  1BC2 A;  5A5Z A;  3PY6 A;  2YHE A;  1X8G A;  3L6N A;  4EXS A;  3IEM A;  3IEL A;  3RPC A;  4RAW A;  2Y8B A;  4J5H A;  4C1C A;  1WUP A;  3F9O A;  1VGN A;  3S0Z A;  4GYU A;  2NZE A;  3X2Y A;  3AJ3 A;  4NQ6 A;  3SFP A;  4EYB A;  4CHL A;  4YSB A;  5LCH A;  3IOF A;  3IE1 A;  4C1D A;  4C09 A;  4TYT A;  4JO0 A;  3I11 A;  4ZEJ A;  4RBS A;  5HH5 A;  5LMC A;  5EWA A;  3I15 A;  4PVO A;  2FM6 A;  2Y8A A;  2NXA A;  2NYP A;  5EHT A;  3AF6 A;  2WYM C;  4EYF A;  4F6Z A;  4Z60 A;  5K4N A;  2AIO A;  4DIL A;  2BG8 A;  2YNV B;  1YCF A;  3DHC A;  4D02 A;  4F6H A;  1L9Y A;  3DHA A;  2VW8 A;  2QED A;  5HIS A;  4EFZ A;  2YCB A;  2GFK A;  2ZZI A;  1A7T A;  2YNT B;  4TZB A;  5AYA A;  2E7Y A;  2H6A A;  3BK1 A;  5EVD A;  2OHI A;  2BG2 A;  1BVT A;  5HIO A;  2BG6 A;  2ZO4 A;  2CG3 A;  5EVK A;  3ZWF A;  5ACX A;  2Q0I A;  4U4L A;  5K4M A;  3MD7 A;  2GKL A;  4XUK A;  3I13 A;  4BZ3 A;  3DH8 A;  5AIJ A;  5B1U A;  5DPX A;  2ZNB A;  3X30 A;  1XM8 A;  3IE2 A;  2BFK A;  5IQK A;  4B87 A;  5HIP A;  2DOO A;  2P1E A;  5HH6 A;  5LE1 A;  4D1V A;  4AX0 B;  4FSB A;  2WHG A;  4UBQ A;  1QH5 A;  2BFL A;  2DKF A;  2BG8 B;  4Z5Y A;  5ACP A;  4FR7 A;  2WYM A;  4V0H A;  5LM6 A;  3SD9 A;  3VPE A;  4C1E A;  3R2U A;  2M5C A;  4PDX A;  5AXO A;  1A8T A;  1X8H A;  4J5F A;  3SBL A;  4ZO3 A;  2YNU A;  4UA4 A;  1JT1 A;  3X2Z A;  2BR6 A;  3SPU A;  2QJS A;  4HL1 A;  2YZ3 A;  1E5D A;  2BC2 A;  3TP9 A;  1HLK A;  4KEP A;  2M5D A;  2A7M A;  5A87 A;  2I7T A;  2XF4 A;  4C1F A;  5EV6 A;  5AJL A;  3ESH A;  4NQ5 A;  4AV7 A;  4UWR B;  2FHX B;  2Q0J A;  2CFZ A;  4XWW A;  3WXC A;  4HKY A;  2AZ4 A;  5ACR A;  4GCW A;  4AX1 B;  2BTN A;  2Q9U A;  4YSL A;  5KIL A;  4AWZ A;  2WYL A;  4O98 A;  4Z7R A;  3IDZ A;  1X8I A;  3KNS A;  1JJE A;  1M2X A;  2QIN A;  2Y87 A;  3SRX A;  1JJT A;  4RL0 A;  1YCH A;  4LE6 A;  3QH8 A;  2CG2 A;  2WRS A;  2CFU A;  3BK2 A;  4TZ9 A;  2OHJ A;  1ZNB A;  2QDT A;  4Z6X A;  3AF5 A;  4UWO B;  5HH4 A;  5ACU A;  2UYX A;  3G1P A;  2ZWR A;  5EW0 A;  5FQB A;  4H0D A;  3ZQ4 A;  5LCA A;  5ACW A; 
#chains in the Genus database with same CATH homology
 3LVZ A;  1DXK A;  1WW1 A;  4RM5 A;  2FHX A;  3RKJ A;  4UWS B;  4TYF A;  5EVB A;  5KIK A;  3JXP A;  3X2X A;  1K07 A;  4YSK A;  5ACQ A;  5LS3 A;  2GMN A;  2P97 A;  4D1T A;  3IOG A;  3T9M A;  4ZNB A;  3Q6V A;  5AEB A;  1KR3 A;  2CBN A;  4AWY B;  5ACS A;  5LCF A;  5A0T A;  3VQZ A;  3ADR A;  1VJN A;  5A0V A;  4NQ4 A;  4AD9 A;  3DHB A;  4PVT A;  3SW3 A;  3KNR A;  4C1G A;  5AHO A;  4BP0 A;  3KL7 A;  2BFZ A;  4Z5Z A;  1BMC A;  2BGA A;  3P2U A;  2NZF A;  2P18 A;  5LLD A;  1QH3 A;  1WUO A;  4Z67 A;  1KO3 A;  4GYQ A;  4NQ2 A;  3ZNB A;  1KO2 A;  4DIK A;  3BC2 A;  1DD6 A;  2BMI A;  2GCU A;  2FU6 A;  2OHH A;  4KEQ A;  4D1W A;  3FAI A;  5ACT A;  3H3E A;  5EV8 A;  5AHR A;  3I14 A;  2YNW A;  5K4K A;  2FU9 A;  2GFJ A;  3BV6 A;  5FQA A;  1MQO A;  1VME A;  3I0V A;  2I7X A;  1SML A;  2BIB A;  3A4Y A;  5K0W A;  4WD6 A;  2BFZ B;  4TZF A;  2HB9 A;  3T3O A;  2I7V A;  4EY2 A;  2FU8 A;  5HIQ A;  1P9E A;  4HL2 A;  4EXY A;  3RKK A;  3IE0 A;  3FCZ A;  2FU7 A;  2QDS A;  3IEK A;  5B15 A;  5LSC A;  1ZTC A;  1YCG A;  2BG7 A;  4TZE A;  4XWT A;  4D1U A;  4P62 A;  3PY5 A;  3ZR9 A;  2R2D A;  4UAM A;  1Y44 A;  4EYL A;  1ZKP A;  5AXR A;  5EH9 A;  4C1H A;  2P4Z A;  1XTO A;  4FEK A;  4RAM A;  4UWP B;  2YNV A;  2FK6 A;  4RL2 A;  4ZO2 A;  1WRA A;  5FQC A;  2Q42 A;  2XR1 A;  3T3N A;  1DDK A;  5ACV A;  2YNT A;  3PG4 A;  5B3R A;  1BC2 A;  5A5Z A;  3PY6 A;  1X8G A;  3L6N A;  4EXS A;  3IEM A;  3IEL A;  3RPC A;  4RAW A;  2Y8B A;  4J5H A;  4C1C A;  1WUP A;  3F9O A;  1VGN A;  3S0Z A;  4GYU A;  2NZE A;  3X2Y A;  3AJ3 A;  4NQ6 A;  3SFP A;  4EYB A;  4CHL A;  4YSB A;  5LCH A;  3IOF A;  3IE1 A;  4C1D A;  4C09 A;  4TYT A;  4JO0 A;  3I11 A;  4ZEJ A;  4RBS A;  5HH5 A;  5LMC A;  5EWA A;  3I15 A;  4PVO A;  2FM6 A;  2Y8A A;  2NXA A;  2NYP A;  5EHT A;  3AF6 A;  2WYM C;  4EYF A;  4F6Z A;  4Z60 A;  5K4N A;  2AIO A;  4DIL A;  2BG8 A;  2YNV B;  1YCF A;  3DHC A;  4D02 A;  4F6H A;  1L9Y A;  3DHA A;  2VW8 A;  2QED A;  5HIS A;  4EFZ A;  2YCB A;  2GFK A;  2ZZI A;  1A7T A;  2YNT B;  4TZB A;  5AYA A;  2E7Y A;  2H6A A;  3BK1 A;  5EVD A;  2OHI A;  2BG2 A;  1BVT A;  5HIO A;  2BG6 A;  2ZO4 A;  5EVK A;  3ZWF A;  5ACX A;  2Q0I A;  4U4L A;  5K4M A;  3MD7 A;  2GKL A;  4XUK A;  3I13 A;  4BZ3 A;  3DH8 A;  5B1U A;  5DPX A;  2ZNB A;  3X30 A;  1XM8 A;  3IE2 A;  2BFK A;  5IQK A;  4B87 A;  5HIP A;  2DOO A;  2P1E A;  5HH6 A;  5LE1 A;  4D1V A;  4AX0 B;  4FSB A;  2WHG A;  4UBQ A;  1QH5 A;  2BFL A;  2DKF A;  2BG8 B;  4Z5Y A;  5ACP A;  4FR7 A;  2WYM A;  4V0H A;  5LM6 A;  3SD9 A;  3VPE A;  4C1E A;  3R2U A;  2M5C A;  5AXO A;  1A8T A;  1X8H A;  4J5F A;  3SBL A;  4ZO3 A;  2YNU A;  4UA4 A;  1JT1 A;  3X2Z A;  2BR6 A;  3SPU A;  2QJS A;  4HL1 A;  2YZ3 A;  1E5D A;  2BC2 A;  3TP9 A;  1HLK A;  4KEP A;  2M5D A;  2A7M A;  5A87 A;  2I7T A;  2XF4 A;  4C1F A;  5EV6 A;  3ESH A;  4NQ5 A;  4UWR B;  2FHX B;  2Q0J A;  4XWW A;  3WXC A;  4HKY A;  2AZ4 A;  5ACR A;  4GCW A;  4AX1 B;  2BTN A;  2Q9U A;  4YSL A;  5KIL A;  4AWZ A;  2WYL A;  4O98 A;  4Z7R A;  3IDZ A;  1X8I A;  3KNS A;  1JJE A;  1M2X A;  2QIN A;  2Y87 A;  3SRX A;  1JJT A;  4RL0 A;  1YCH A;  4LE6 A;  3QH8 A;  2WRS A;  3BK2 A;  4TZ9 A;  2OHJ A;  1ZNB A;  2QDT A;  4Z6X A;  3AF5 A;  4UWO B;  5HH4 A;  5ACU A;  2UYX A;  3G1P A;  2ZWR A;  5EW0 A;  5FQB A;  4H0D A;  3ZQ4 A;  5LCA A;  5ACW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...