4Z5ZA

The 2.5-angstrom crystal structure of mg(2+)-bound pqqb from pseudomonas putida
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
308
structure length
308
Chain Sequence
MMYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIALSDDGVHWILCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLREGCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFPLRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLLVDGTLWEDDEMQRRGVGTRTGREMGHLAQNGPGGTLEVLDGFPRQRKVLIHINNTNPILDENSPERAEVLRRGVEVAFDGMSIELLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coenzyme PQQ synthesis protein B
publication title Crystal structures reveal metal-binding plasticity at the active site of PqqB
rcsb
source organism Pseudomonas putida (strain kt2440)
molecule tags Hydrolase
total genus 103
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4z5zA00
4GCWA 1XTOA 5FQBA 3DHAA 3ZR9A 2CBNA 1X8IA 5B3RA 1KR3A 3ADRA 3A4YA 4RL2A 1P9EA 1L9YA 2QJSA 2HB9A 4PVOA 4D1TA 4DIKA 3KL7A 2FK6A 4TZEA 4NQ2A 3SPUA 5LS3A 3IEKA 2H6AA 4AX1B 3ZWFA 4TZFA 5B1UA 3SFPA 1MQOA 2I7VA 2WYLA 2OHJA 4EYLA 5ACVA 1M2XA 3LVZA 4C1HA 4UA4A 2OHHA 4GYUA 2ZZIA 4ZO3A 5EVKA 5EVDA 2NYPA 4Z7RA 4AWYB 3IELA 2OHIA 5HISA 2I7TA 2I7XA 3IOFA 3DHBA 2BGAA 3QH8A 2P4ZA 3FCZA 4RAMA 4XWWA 2Q0IA 2YZ3A 4O98A 1K07A 2QDTA 2QEDA 1ZKPA 3L6NA 4TZBA 2AZ4A 5HH5A 4HL1A 1JJEA 2A7MA 4CHLA 2ZO4A 1XM8A 4GYQA 2BFZB 4D1WA 2NXAA 1DD6A 5AHRA 5EV8A 3IE1A 4WD6A 2GMNA 4TZ9A 1JT1A 2BG8B 4ZNBA 5LM6A 3VPEA 4P62A 3RPCA 4C1EA 1ZTCA 5LLDA 3AF6A 5EHTA 2BMIA 3BK1A 2FU6A 2FHXA 2BG7A 2XR1A 4NQ4A 5A87A 5LE1A 3T9MA 2NZFA 4D1UA 1DDKA 2Y8AA 4EYFA 3MD7A 4AX0B 3SD9A 5K0WA 5FQAA 5LCAA 4KEPA 5ACWA 4UAMA 4Z5ZA 5HIQA 1BVTA 5LMCA 4EYBA 3Q6VA 4LE6A 3IEMA 4NQ6A 5LCHA 2YNVA 2YNTA 4H0DA 2Q0JA 3AJ3A 4U4LA 5K4KA 2Q42A 3IE2A 1VMEA 1WRAA 5DPXA 3R2UA 1QH3A 5EVBA 4C09A 1X8HA 3I0VA 5AYAA 2BC2A 4V0HA 3FAIA 2BG6A 4UWOB 4D02A 1BMCA 4Z5YA 1JJTA 3G1PA 3KNSA 4AWZA 1A8TA 3H3EA 3X2YA 2QINA 2WRSA 5KILA 5AHOA 4D1VA 1QH5A 3T3OA 5EWAA 2ZNBA 3IDZA 4J5HA 2FU7A 2WYMC 3BC2A 4Z60A 1E5DA 5A0VA 1VGNA 3IOGA 2BFLA 4C1GA 4F6ZA 4ZEJA 3BV6A 2GFJA 2FM6A 2DOOA 2AIOA 1WUOA 4F6HA 1A7TA 3PY6A 4DILA 2FU9A 5IQKA 3SBLA 4BZ3A 2FU8A 5ACUA 2P18A 4EXYA 1YCFA 4PVTA 5ACSA 2QDSA 5LSCA 3VQZA 5FQCA 3SRXA 2FHXB 3BK2A 1WW1A 3P2UA 4AD9A 2YNWA 2VW8A 5ACXA 3ESHA 5LCFA 2Q9UA 2BIBA 4EXSA 2P97A 2XF4A 2Y87A 3DH8A 4J5FA 3I15A 3IE0A 4UWRB 5EV6A 3KNRA 4C1CA 5B15A 4UWPB 5HH6A 5ACPA 3JXPA 1Y44A 4EY2A 4KEQA 4Z6XA 1VJNA 4RL0A 4HKYA 3I13A 3ZNBA 2YNVB 2YNTB 3I11A 4FEKA 4EFZA 4FR7A 3I14A 2BG2A 5EW0A 1X8GA 2R2DA 1YCHA 3S0ZA 2WHGA 2BR6A 5AXRA 1KO3A 5K4NA 2E7YA 4YSKA 2GKLA 5HIPA 4BP0A 5EH9A 5HH4A 4TYFA 4B87A 4C1DA 3X2ZA 4UBQA 2YCBA 3X30A 4NQ5A 4RM5A 4HL2A 4YSLA 2M5CA 5AXOA 2Y8BA 4Z67A 1KO2A 2UYXA 2M5DA 2BFKA 2ZWRA 4XWTA 2NZEA 2DKFA 5ACRA 2P1EA 4FSBA 5A0TA 3DHCA 3TP9A 2BFZA 4ZO2A 1WUPA 5AEBA 1ZNBA 5K4MA 1DXKA 3T3NA 2YNUA 2GCUA 2GFKA 3PG4A 3PY5A 3X2XA 2BG8A 1HLKA 4JO0A 4RBSA 3RKJA 3RKKA 1SMLA 4YSBA 2BTNA 4TYTA 5KIKA 4RAWA 3AF5A 5HIOA 3F9OA 1YCGA 4UWSB 3ZQ4A 5A5ZA 3SW3A 1BC2A 3WXCA 2WYMA 4C1FA 5ACTA 5ACQA 4XUKA
chains in the Genus database with same CATH superfamily
4GCWA 1XTOA 5FQBA 3DHAA 3ZR9A 2CBNA 1X8IA 5B3RA 1KR3A 3ADRA 3A4YA 4RL2A 1P9EA 1L9YA 2QJSA 2HB9A 4PVOA 4D1TA 4DIKA 3KL7A 2FK6A 4TZEA 4NQ2A 3SPUA 5LS3A 3IEKA 2H6AA 4AX1B 3ZWFA 4TZFA 5B1UA 3SFPA 1MQOA 2I7VA 2WYLA 2OHJA 4EYLA 5ACVA 1M2XA 3LVZA 4C1HA 4UA4A 2OHHA 4GYUA 2ZZIA 4ZO3A 5EVKA 5EVDA 2NYPA 4Z7RA 4AWYB 3IELA 2OHIA 5HISA 2I7TA 2I7XA 3IOFA 3DHBA 2BGAA 3QH8A 2P4ZA 3FCZA 4RAMA 4XWWA 2Q0IA 2YZ3A 4O98A 2CG2A 1K07A 2QDTA 2QEDA 1ZKPA 3L6NA 4TZBA 2AZ4A 5HH5A 4HL1A 1JJEA 2A7MA 4CHLA 2ZO4A 1XM8A 4GYQA 2BFZB 4D1WA 2NXAA 1DD6A 5AHRA 5EV8A 3IE1A 4WD6A 2GMNA 4TZ9A 2YHEA 1JT1A 2BG8B 4ZNBA 4PDXA 5LM6A 4AV7A 3VPEA 4P62A 3RPCA 4C1EA 1ZTCA 5LLDA 3AF6A 5EHTA 2BMIA 3BK1A 2FU6A 2FHXA 2BG7A 2XR1A 4NQ4A 5A87A 5LE1A 3T9MA 2NZFA 4D1UA 1DDKA 2Y8AA 4EYFA 3MD7A 4AX0B 3SD9A 5K0WA 5FQAA 5LCAA 4AXHA 4KEPA 5AJLA 5ACWA 4UAMA 4Z5ZA 5HIQA 1BVTA 5LMCA 4EYBA 3Q6VA 4LE6A 3IEMA 4NQ6A 5LCHA 2YNVA 2YNTA 4H0DA 2Q0JA 3AJ3A 4U4LA 5K4KA 2Q42A 3IE2A 1VMEA 1WRAA 5DPXA 3R2UA 1QH3A 5EVBA 4C09A 1X8HA 3I0VA 5AYAA 2BC2A 4V0HA 3FAIA 2BG6A 4UWOB 4D02A 1BMCA 4Z5YA 1JJTA 3G1PA 3KNSA 4AWZA 1A8TA 3H3EA 3X2YA 2QINA 2WRSA 5KILA 5AHOA 4D1VA 1QH5A 3T3OA 5AIJA 5EWAA 2ZNBA 3IDZA 4J5HA 2FU7A 2WYMC 3BC2A 4Z60A 1E5DA 5A0VA 1VGNA 2CFZA 3IOGA 2BFLA 4C1GA 4F6ZA 4ZEJA 3BV6A 2GFJA 2FM6A 2DOOA 2AIOA 1WUOA 4F6HA 1A7TA 3PY6A 4DILA 2FU9A 2CG3A 5IQKA 3SBLA 4BZ3A 2FU8A 5ACUA 2P18A 4EXYA 1YCFA 4PVTA 5ACSA 2QDSA 5LSCA 3VQZA 2CFUA 5FQCA 3SRXA 2FHXB 3BK2A 1WW1A 3P2UA 4AD9A 2YNWA 2VW8A 5ACXA 3ESHA 5LCFA 2Q9UA 2BIBA 4EXSA 2P97A 2XF4A 4NURA 2Y87A 3DH8A 4J5FA 3I15A 3IE0A 4UWRB 5EV6A 3KNRA 4C1CA 5B15A 4UWPB 5HH6A 5ACPA 3JXPA 1Y44A 4EY2A 4KEQA 4Z6XA 1VJNA 4RL0A 4HKYA 3I13A 3ZNBA 2YNVB 2YNTB 3I11A 4FEKA 4EFZA 4FR7A 3I14A 2BG2A 5EW0A 1X8GA 2R2DA 1YCHA 3S0ZA 2WHGA 2BR6A 5AXRA 1KO3A 5K4NA 2E7YA 4YSKA 2GKLA 5HIPA 4BP0A 5EH9A 5HH4A 4TYFA 4B87A 4C1DA 3X2ZA 4UBQA 2YCBA 3X30A 4NQ5A 4RM5A 4HL2A 4YSLA 2M5CA 5AXOA 2Y8BA 4Z67A 1KO2A 2UYXA 2M5DA 2BFKA 2ZWRA 4XWTA 2NZEA 2DKFA 5ACRA 2P1EA 4FSBA 5A0TA 3DHCA 3TP9A 2BFZA 4ZO2A 1WUPA 5AEBA 1ZNBA 5K4MA 5A23A 1DXKA 3T3NA 2YNUA 2GCUA 2GFKA 3PG4A 3PY5A 3X2XA 2BG8A 1HLKA 4JO0A 4RBSA 3RKJA 3RKKA 1SMLA 4YSBA 2BTNA 4TYTA 5KIKA 4RAWA 3AF5A 5HIOA 3F9OA 1YCGA 4UWSB 3ZQ4A 5A5ZA 3SW3A 1BC2A 3WXCA 2WYMA 4C1FA 5ACTA 5ACQA 4XUKA
chains in the Genus database with same CATH topology
4GCWA 1XTOA 5FQBA 3DHAA 3ZR9A 2CBNA 1X8IA 5B3RA 1KR3A 3ADRA 3A4YA 4RL2A 1P9EA 1L9YA 2QJSA 2HB9A 4PVOA 4D1TA 4DIKA 3KL7A 2FK6A 4TZEA 4NQ2A 3SPUA 5LS3A 3IEKA 2H6AA 4AX1B 3ZWFA 4TZFA 5B1UA 3SFPA 1MQOA 2I7VA 2WYLA 2OHJA 4EYLA 5ACVA 1M2XA 3LVZA 4C1HA 4UA4A 2OHHA 4GYUA 2ZZIA 4ZO3A 5EVKA 5EVDA 2NYPA 4Z7RA 4AWYB 3IELA 2OHIA 5HISA 2I7TA 2I7XA 3IOFA 3DHBA 2BGAA 3QH8A 2P4ZA 3FCZA 4RAMA 4XWWA 2Q0IA 2YZ3A 4O98A 1K07A 2QDTA 2QEDA 1ZKPA 3L6NA 4TZBA 2AZ4A 5HH5A 4HL1A 1JJEA 2A7MA 4CHLA 2ZO4A 1XM8A 4GYQA 2BFZB 4D1WA 2NXAA 1DD6A 5AHRA 5EV8A 3IE1A 4WD6A 2GMNA 4TZ9A 1JT1A 2BG8B 4ZNBA 5LM6A 3VPEA 4P62A 3RPCA 4C1EA 1ZTCA 5LLDA 3AF6A 5EHTA 2BMIA 3BK1A 2FU6A 2FHXA 2BG7A 2XR1A 4NQ4A 5A87A 5LE1A 3T9MA 2NZFA 4D1UA 1DDKA 2Y8AA 4EYFA 3MD7A 4AX0B 3SD9A 5K0WA 5FQAA 5LCAA 4KEPA 5ACWA 4UAMA 4Z5ZA 5HIQA 1BVTA 5LMCA 4EYBA 3Q6VA 4LE6A 3IEMA 4NQ6A 5LCHA 2YNVA 2YNTA 4H0DA 2Q0JA 3AJ3A 4U4LA 5K4KA 2Q42A 3IE2A 1VMEA 1WRAA 5DPXA 3R2UA 1QH3A 5EVBA 4C09A 1X8HA 3I0VA 5AYAA 2BC2A 4V0HA 3FAIA 2BG6A 4UWOB 4D02A 1BMCA 4Z5YA 1JJTA 3G1PA 3KNSA 4AWZA 1A8TA 3H3EA 3X2YA 2QINA 2WRSA 5KILA 5AHOA 4D1VA 1QH5A 3T3OA 5EWAA 2ZNBA 3IDZA 4J5HA 2FU7A 2WYMC 3BC2A 4Z60A 1E5DA 5A0VA 1VGNA 3IOGA 2BFLA 4C1GA 4F6ZA 4ZEJA 3BV6A 2GFJA 2FM6A 2DOOA 2AIOA 1WUOA 4F6HA 1A7TA 3PY6A 4DILA 2FU9A 5IQKA 3SBLA 4BZ3A 2FU8A 5ACUA 2P18A 4EXYA 1YCFA 4PVTA 5ACSA 2QDSA 5LSCA 3VQZA 5FQCA 3SRXA 2FHXB 3BK2A 1WW1A 3P2UA 4AD9A 2YNWA 2VW8A 5ACXA 3ESHA 5LCFA 2Q9UA 2BIBA 4EXSA 2P97A 2XF4A 2Y87A 3DH8A 4J5FA 3I15A 3IE0A 4UWRB 5EV6A 3KNRA 4C1CA 5B15A 4UWPB 5HH6A 5ACPA 3JXPA 1Y44A 4EY2A 4KEQA 4Z6XA 1VJNA 4RL0A 4HKYA 3I13A 3ZNBA 2YNVB 2YNTB 3I11A 4FEKA 4EFZA 4FR7A 3I14A 2BG2A 5EW0A 1X8GA 2R2DA 1YCHA 3S0ZA 2WHGA 2BR6A 5AXRA 1KO3A 5K4NA 2E7YA 4YSKA 2GKLA 5HIPA 4BP0A 5EH9A 5HH4A 4TYFA 4B87A 4C1DA 3X2ZA 4UBQA 2YCBA 3X30A 4NQ5A 4RM5A 4HL2A 4YSLA 2M5CA 5AXOA 2Y8BA 4Z67A 1KO2A 2UYXA 2M5DA 2BFKA 2ZWRA 4XWTA 2NZEA 2DKFA 5ACRA 2P1EA 4FSBA 5A0TA 3DHCA 3TP9A 2BFZA 4ZO2A 1WUPA 5AEBA 1ZNBA 5K4MA 1DXKA 3T3NA 2YNUA 2GCUA 2GFKA 3PG4A 3PY5A 3X2XA 2BG8A 1HLKA 4JO0A 4RBSA 3RKJA 3RKKA 1SMLA 4YSBA 2BTNA 4TYTA 5KIKA 4RAWA 3AF5A 5HIOA 3F9OA 1YCGA 4UWSB 3ZQ4A 5A5ZA 3SW3A 1BC2A 3WXCA 2WYMA 4C1FA 5ACTA 5ACQA 4XUKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GCW A;  1XTO A;  5FQB A;  3DHA A;  3ZR9 A;  2CBN A;  1X8I A;  5B3R A;  1KR3 A;  3ADR A;  3A4Y A;  4RL2 A;  1P9E A;  1L9Y A;  2QJS A;  2HB9 A;  4PVO A;  4D1T A;  4DIK A;  3KL7 A;  2FK6 A;  4TZE A;  4NQ2 A;  3SPU A;  5LS3 A;  3IEK A;  2H6A A;  4AX1 B;  3ZWF A;  4TZF A;  5B1U A;  3SFP A;  1MQO A;  2I7V A;  2WYL A;  2OHJ A;  4EYL A;  5ACV A;  1M2X A;  3LVZ A;  4C1H A;  4UA4 A;  2OHH A;  4GYU A;  2ZZI A;  4ZO3 A;  5EVK A;  5EVD A;  2NYP A;  4Z7R A;  4AWY B;  3IEL A;  2OHI A;  5HIS A;  2I7T A;  2I7X A;  3IOF A;  3DHB A;  2BGA A;  3QH8 A;  2P4Z A;  3FCZ A;  4RAM A;  4XWW A;  2Q0I A;  2YZ3 A;  4O98 A;  1K07 A;  2QDT A;  2QED A;  1ZKP A;  3L6N A;  4TZB A;  2AZ4 A;  5HH5 A;  4HL1 A;  1JJE A;  2A7M A;  4CHL A;  2ZO4 A;  1XM8 A;  4GYQ A;  2BFZ B;  4D1W A;  2NXA A;  1DD6 A;  5AHR A;  5EV8 A;  3IE1 A;  4WD6 A;  2GMN A;  4TZ9 A;  1JT1 A;  2BG8 B;  4ZNB A;  5LM6 A;  3VPE A;  4P62 A;  3RPC A;  4C1E A;  1ZTC A;  5LLD A;  3AF6 A;  5EHT A;  2BMI A;  3BK1 A;  2FU6 A;  2FHX A;  2BG7 A;  2XR1 A;  4NQ4 A;  5A87 A;  5LE1 A;  3T9M A;  2NZF A;  4D1U A;  1DDK A;  2Y8A A;  4EYF A;  3MD7 A;  4AX0 B;  3SD9 A;  5K0W A;  5FQA A;  5LCA A;  4KEP A;  5ACW A;  4UAM A;  4Z5Z A;  5HIQ A;  1BVT A;  5LMC A;  4EYB A;  3Q6V A;  4LE6 A;  3IEM A;  4NQ6 A;  5LCH A;  2YNV A;  2YNT A;  4H0D A;  2Q0J A;  3AJ3 A;  4U4L A;  5K4K A;  2Q42 A;  3IE2 A;  1VME A;  1WRA A;  5DPX A;  3R2U A;  1QH3 A;  5EVB A;  4C09 A;  1X8H A;  3I0V A;  5AYA A;  2BC2 A;  4V0H A;  3FAI A;  2BG6 A;  4UWO B;  4D02 A;  1BMC A;  4Z5Y A;  1JJT A;  3G1P A;  3KNS A;  4AWZ A;  1A8T A;  3H3E A;  3X2Y A;  2QIN A;  2WRS A;  5KIL A;  5AHO A;  4D1V A;  1QH5 A;  3T3O A;  5EWA A;  2ZNB A;  3IDZ A;  4J5H A;  2FU7 A;  2WYM C;  3BC2 A;  4Z60 A;  1E5D A;  5A0V A;  1VGN A;  3IOG A;  2BFL A;  4C1G A;  4F6Z A;  4ZEJ A;  3BV6 A;  2GFJ A;  2FM6 A;  2DOO A;  2AIO A;  1WUO A;  4F6H A;  1A7T A;  3PY6 A;  4DIL A;  2FU9 A;  5IQK A;  3SBL A;  4BZ3 A;  2FU8 A;  5ACU A;  2P18 A;  4EXY A;  1YCF A;  4PVT A;  5ACS A;  2QDS A;  5LSC A;  3VQZ A;  5FQC A;  3SRX A;  2FHX B;  3BK2 A;  1WW1 A;  3P2U A;  4AD9 A;  2YNW A;  2VW8 A;  5ACX A;  3ESH A;  5LCF A;  2Q9U A;  2BIB A;  4EXS A;  2P97 A;  2XF4 A;  2Y87 A;  3DH8 A;  4J5F A;  3I15 A;  3IE0 A;  4UWR B;  5EV6 A;  3KNR A;  4C1C A;  5B15 A;  4UWP B;  5HH6 A;  5ACP A;  3JXP A;  1Y44 A;  4EY2 A;  4KEQ A;  4Z6X A;  1VJN A;  4RL0 A;  4HKY A;  3I13 A;  3ZNB A;  2YNV B;  2YNT B;  3I11 A;  4FEK A;  4EFZ A;  4FR7 A;  3I14 A;  2BG2 A;  5EW0 A;  1X8G A;  2R2D A;  1YCH A;  3S0Z A;  2WHG A;  2BR6 A;  5AXR A;  1KO3 A;  5K4N A;  2E7Y A;  4YSK A;  2GKL A;  5HIP A;  4BP0 A;  5EH9 A;  5HH4 A;  4TYF A;  4B87 A;  4C1D A;  3X2Z A;  4UBQ A;  2YCB A;  3X30 A;  4NQ5 A;  4RM5 A;  4HL2 A;  4YSL A;  2M5C A;  5AXO A;  2Y8B A;  4Z67 A;  1KO2 A;  2UYX A;  2M5D A;  2BFK A;  2ZWR A;  4XWT A;  2NZE A;  2DKF A;  5ACR A;  2P1E A;  4FSB A;  5A0T A;  3DHC A;  3TP9 A;  2BFZ A;  4ZO2 A;  1WUP A;  5AEB A;  1ZNB A;  5K4M A;  1DXK A;  3T3N A;  2YNU A;  2GCU A;  2GFK A;  3PG4 A;  3PY5 A;  3X2X A;  2BG8 A;  1HLK A;  4JO0 A;  4RBS A;  3RKJ A;  3RKK A;  1SML A;  4YSB A;  2BTN A;  4TYT A;  5KIK A;  4RAW A;  3AF5 A;  5HIO A;  3F9O A;  1YCG A;  4UWS B;  3ZQ4 A;  5A5Z A;  3SW3 A;  1BC2 A;  3WXC A;  2WYM A;  4C1F A;  5ACT A;  5ACQ A;  4XUK A; 
#chains in the Genus database with same CATH topology
 4GCW A;  1XTO A;  5FQB A;  3DHA A;  3ZR9 A;  2CBN A;  1X8I A;  5B3R A;  1KR3 A;  3ADR A;  3A4Y A;  4RL2 A;  1P9E A;  1L9Y A;  2QJS A;  2HB9 A;  4PVO A;  4D1T A;  4DIK A;  3KL7 A;  2FK6 A;  4TZE A;  4NQ2 A;  3SPU A;  5LS3 A;  3IEK A;  2H6A A;  4AX1 B;  3ZWF A;  4TZF A;  5B1U A;  3SFP A;  1MQO A;  2I7V A;  2WYL A;  2OHJ A;  4EYL A;  5ACV A;  1M2X A;  3LVZ A;  4C1H A;  4UA4 A;  2OHH A;  4GYU A;  2ZZI A;  4ZO3 A;  5EVK A;  5EVD A;  2NYP A;  4Z7R A;  4AWY B;  3IEL A;  2OHI A;  5HIS A;  2I7T A;  2I7X A;  3IOF A;  3DHB A;  2BGA A;  3QH8 A;  2P4Z A;  3FCZ A;  4RAM A;  4XWW A;  2Q0I A;  2YZ3 A;  4O98 A;  2CG2 A;  1K07 A;  2QDT A;  2QED A;  1ZKP A;  3L6N A;  4TZB A;  2AZ4 A;  5HH5 A;  4HL1 A;  1JJE A;  2A7M A;  4CHL A;  2ZO4 A;  1XM8 A;  4GYQ A;  2BFZ B;  4D1W A;  2NXA A;  1DD6 A;  5AHR A;  5EV8 A;  3IE1 A;  4WD6 A;  2GMN A;  4TZ9 A;  2YHE A;  1JT1 A;  2BG8 B;  4ZNB A;  4PDX A;  5LM6 A;  4AV7 A;  3VPE A;  4P62 A;  3RPC A;  4C1E A;  1ZTC A;  5LLD A;  3AF6 A;  5EHT A;  2BMI A;  3BK1 A;  2FU6 A;  2FHX A;  2BG7 A;  2XR1 A;  4NQ4 A;  5A87 A;  5LE1 A;  3T9M A;  2NZF A;  4D1U A;  1DDK A;  2Y8A A;  4EYF A;  3MD7 A;  4AX0 B;  3SD9 A;  5K0W A;  5FQA A;  5LCA A;  4AXH A;  4KEP A;  5AJL A;  5ACW A;  4UAM A;  4Z5Z A;  5HIQ A;  1BVT A;  5LMC A;  4EYB A;  3Q6V A;  4LE6 A;  3IEM A;  4NQ6 A;  5LCH A;  2YNV A;  2YNT A;  4H0D A;  2Q0J A;  3AJ3 A;  4U4L A;  5K4K A;  2Q42 A;  3IE2 A;  1VME A;  1WRA A;  5DPX A;  3R2U A;  1QH3 A;  5EVB A;  4C09 A;  1X8H A;  3I0V A;  5AYA A;  2BC2 A;  4V0H A;  3FAI A;  2BG6 A;  4UWO B;  4D02 A;  1BMC A;  4Z5Y A;  1JJT A;  3G1P A;  3KNS A;  4AWZ A;  1A8T A;  3H3E A;  3X2Y A;  2QIN A;  2WRS A;  5KIL A;  5AHO A;  4D1V A;  1QH5 A;  3T3O A;  5AIJ A;  5EWA A;  2ZNB A;  3IDZ A;  4J5H A;  2FU7 A;  2WYM C;  3BC2 A;  4Z60 A;  1E5D A;  5A0V A;  1VGN A;  2CFZ A;  3IOG A;  2BFL A;  4C1G A;  4F6Z A;  4ZEJ A;  3BV6 A;  2GFJ A;  2FM6 A;  2DOO A;  2AIO A;  1WUO A;  4F6H A;  1A7T A;  3PY6 A;  4DIL A;  2FU9 A;  2CG3 A;  5IQK A;  3SBL A;  4BZ3 A;  2FU8 A;  5ACU A;  2P18 A;  4EXY A;  1YCF A;  4PVT A;  5ACS A;  2QDS A;  5LSC A;  3VQZ A;  2CFU A;  5FQC A;  3SRX A;  2FHX B;  3BK2 A;  1WW1 A;  3P2U A;  4AD9 A;  2YNW A;  2VW8 A;  5ACX A;  3ESH A;  5LCF A;  2Q9U A;  2BIB A;  4EXS A;  2P97 A;  2XF4 A;  4NUR A;  2Y87 A;  3DH8 A;  4J5F A;  3I15 A;  3IE0 A;  4UWR B;  5EV6 A;  3KNR A;  4C1C A;  5B15 A;  4UWP B;  5HH6 A;  5ACP A;  3JXP A;  1Y44 A;  4EY2 A;  4KEQ A;  4Z6X A;  1VJN A;  4RL0 A;  4HKY A;  3I13 A;  3ZNB A;  2YNV B;  2YNT B;  3I11 A;  4FEK A;  4EFZ A;  4FR7 A;  3I14 A;  2BG2 A;  5EW0 A;  1X8G A;  2R2D A;  1YCH A;  3S0Z A;  2WHG A;  2BR6 A;  5AXR A;  1KO3 A;  5K4N A;  2E7Y A;  4YSK A;  2GKL A;  5HIP A;  4BP0 A;  5EH9 A;  5HH4 A;  4TYF A;  4B87 A;  4C1D A;  3X2Z A;  4UBQ A;  2YCB A;  3X30 A;  4NQ5 A;  4RM5 A;  4HL2 A;  4YSL A;  2M5C A;  5AXO A;  2Y8B A;  4Z67 A;  1KO2 A;  2UYX A;  2M5D A;  2BFK A;  2ZWR A;  4XWT A;  2NZE A;  2DKF A;  5ACR A;  2P1E A;  4FSB A;  5A0T A;  3DHC A;  3TP9 A;  2BFZ A;  4ZO2 A;  1WUP A;  5AEB A;  1ZNB A;  5K4M A;  5A23 A;  1DXK A;  3T3N A;  2YNU A;  2GCU A;  2GFK A;  3PG4 A;  3PY5 A;  3X2X A;  2BG8 A;  1HLK A;  4JO0 A;  4RBS A;  3RKJ A;  3RKK A;  1SML A;  4YSB A;  2BTN A;  4TYT A;  5KIK A;  4RAW A;  3AF5 A;  5HIO A;  3F9O A;  1YCG A;  4UWS B;  3ZQ4 A;  5A5Z A;  3SW3 A;  1BC2 A;  3WXC A;  2WYM A;  4C1F A;  5ACT A;  5ACQ A;  4XUK A; 
#chains in the Genus database with same CATH homology
 4GCW A;  1XTO A;  5FQB A;  3DHA A;  3ZR9 A;  2CBN A;  1X8I A;  5B3R A;  1KR3 A;  3ADR A;  3A4Y A;  4RL2 A;  1P9E A;  1L9Y A;  2QJS A;  2HB9 A;  4PVO A;  4D1T A;  4DIK A;  3KL7 A;  2FK6 A;  4TZE A;  4NQ2 A;  3SPU A;  5LS3 A;  3IEK A;  2H6A A;  4AX1 B;  3ZWF A;  4TZF A;  5B1U A;  3SFP A;  1MQO A;  2I7V A;  2WYL A;  2OHJ A;  4EYL A;  5ACV A;  1M2X A;  3LVZ A;  4C1H A;  4UA4 A;  2OHH A;  4GYU A;  2ZZI A;  4ZO3 A;  5EVK A;  5EVD A;  2NYP A;  4Z7R A;  4AWY B;  3IEL A;  2OHI A;  5HIS A;  2I7T A;  2I7X A;  3IOF A;  3DHB A;  2BGA A;  3QH8 A;  2P4Z A;  3FCZ A;  4RAM A;  4XWW A;  2Q0I A;  2YZ3 A;  4O98 A;  1K07 A;  2QDT A;  2QED A;  1ZKP A;  3L6N A;  4TZB A;  2AZ4 A;  5HH5 A;  4HL1 A;  1JJE A;  2A7M A;  4CHL A;  2ZO4 A;  1XM8 A;  4GYQ A;  2BFZ B;  4D1W A;  2NXA A;  1DD6 A;  5AHR A;  5EV8 A;  3IE1 A;  4WD6 A;  2GMN A;  4TZ9 A;  1JT1 A;  2BG8 B;  4ZNB A;  5LM6 A;  3VPE A;  4P62 A;  3RPC A;  4C1E A;  1ZTC A;  5LLD A;  3AF6 A;  5EHT A;  2BMI A;  3BK1 A;  2FU6 A;  2FHX A;  2BG7 A;  2XR1 A;  4NQ4 A;  5A87 A;  5LE1 A;  3T9M A;  2NZF A;  4D1U A;  1DDK A;  2Y8A A;  4EYF A;  3MD7 A;  4AX0 B;  3SD9 A;  5K0W A;  5FQA A;  5LCA A;  4KEP A;  5ACW A;  4UAM A;  4Z5Z A;  5HIQ A;  1BVT A;  5LMC A;  4EYB A;  3Q6V A;  4LE6 A;  3IEM A;  4NQ6 A;  5LCH A;  2YNV A;  2YNT A;  4H0D A;  2Q0J A;  3AJ3 A;  4U4L A;  5K4K A;  2Q42 A;  3IE2 A;  1VME A;  1WRA A;  5DPX A;  3R2U A;  1QH3 A;  5EVB A;  4C09 A;  1X8H A;  3I0V A;  5AYA A;  2BC2 A;  4V0H A;  3FAI A;  2BG6 A;  4UWO B;  4D02 A;  1BMC A;  4Z5Y A;  1JJT A;  3G1P A;  3KNS A;  4AWZ A;  1A8T A;  3H3E A;  3X2Y A;  2QIN A;  2WRS A;  5KIL A;  5AHO A;  4D1V A;  1QH5 A;  3T3O A;  5EWA A;  2ZNB A;  3IDZ A;  4J5H A;  2FU7 A;  2WYM C;  3BC2 A;  4Z60 A;  1E5D A;  5A0V A;  1VGN A;  3IOG A;  2BFL A;  4C1G A;  4F6Z A;  4ZEJ A;  3BV6 A;  2GFJ A;  2FM6 A;  2DOO A;  2AIO A;  1WUO A;  4F6H A;  1A7T A;  3PY6 A;  4DIL A;  2FU9 A;  5IQK A;  3SBL A;  4BZ3 A;  2FU8 A;  5ACU A;  2P18 A;  4EXY A;  1YCF A;  4PVT A;  5ACS A;  2QDS A;  5LSC A;  3VQZ A;  5FQC A;  3SRX A;  2FHX B;  3BK2 A;  1WW1 A;  3P2U A;  4AD9 A;  2YNW A;  2VW8 A;  5ACX A;  3ESH A;  5LCF A;  2Q9U A;  2BIB A;  4EXS A;  2P97 A;  2XF4 A;  2Y87 A;  3DH8 A;  4J5F A;  3I15 A;  3IE0 A;  4UWR B;  5EV6 A;  3KNR A;  4C1C A;  5B15 A;  4UWP B;  5HH6 A;  5ACP A;  3JXP A;  1Y44 A;  4EY2 A;  4KEQ A;  4Z6X A;  1VJN A;  4RL0 A;  4HKY A;  3I13 A;  3ZNB A;  2YNV B;  2YNT B;  3I11 A;  4FEK A;  4EFZ A;  4FR7 A;  3I14 A;  2BG2 A;  5EW0 A;  1X8G A;  2R2D A;  1YCH A;  3S0Z A;  2WHG A;  2BR6 A;  5AXR A;  1KO3 A;  5K4N A;  2E7Y A;  4YSK A;  2GKL A;  5HIP A;  4BP0 A;  5EH9 A;  5HH4 A;  4TYF A;  4B87 A;  4C1D A;  3X2Z A;  4UBQ A;  2YCB A;  3X30 A;  4NQ5 A;  4RM5 A;  4HL2 A;  4YSL A;  2M5C A;  5AXO A;  2Y8B A;  4Z67 A;  1KO2 A;  2UYX A;  2M5D A;  2BFK A;  2ZWR A;  4XWT A;  2NZE A;  2DKF A;  5ACR A;  2P1E A;  4FSB A;  5A0T A;  3DHC A;  3TP9 A;  2BFZ A;  4ZO2 A;  1WUP A;  5AEB A;  1ZNB A;  5K4M A;  1DXK A;  3T3N A;  2YNU A;  2GCU A;  2GFK A;  3PG4 A;  3PY5 A;  3X2X A;  2BG8 A;  1HLK A;  4JO0 A;  4RBS A;  3RKJ A;  3RKK A;  1SML A;  4YSB A;  2BTN A;  4TYT A;  5KIK A;  4RAW A;  3AF5 A;  5HIO A;  3F9O A;  1YCG A;  4UWS B;  3ZQ4 A;  5A5Z A;  3SW3 A;  1BC2 A;  3WXC A;  2WYM A;  4C1F A;  5ACT A;  5ACQ A;  4XUK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...