3X2YA

Crystal structure of metallo-beta-lactamase h8a from thermotoga maritima
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
227
structure length
227
Chain Sequence
b'GMKVTFLGAAVVLIEGKKNIIIDPFISGNPVCPVKLEGLPKIDYILVTHGHGDHLGDAVEIAKKNDATVISNYEICHYLGKKGVKTHAMHIGGSYLFDFGRVKMTPAVHGSGILDGDSMIYGGNPSGFLITIEGKKIYHAGDTGLTREMELLAEENVDVAFLPIGGNFVMDVEDAVRAAVMIKPKKVVPMHYGTWELIFADVELFKKKVEEKGVECVILEPGESLEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0173 metal-dependent hydrolase TM_1162
publication title Crystal structure of metallo-beta-lactamase H8A from Thermotoga maritima
rcsb
source organism Thermotoga maritima msb8
molecule tags Hydrolase
total genus 61
structure length 227
sequence length 227
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3x2yA00
5AXRA 3T9MA 4EXYA 1HLKA 3SRXA 5KILA 3FAIA 4RBSA 1WUOA 3DHBA 1L9YA 4TZ9A 5EV8A 4UWOB 4RM5A 3I0VA 4TZBA 3X2YA 4WD6A 2ZWRA 3X30A 2WYMC 3IELA 1YCHA 2Y87A 5ACTA 3AF5A 1VGNA 3SBLA 2Q0IA 4C1HA 4C1GA 4ZO2A 3I11A 5ACWA 4NQ6A 4UWPB 2BC2A 2BIBA 2E7YA 5DPXA 3RKJA 3KNRA 5LMCA 5ACQA 4EY2A 5AHRA 5EWAA 3KNSA 4F6ZA 3IEKA 4KEQA 1ZTCA 5AHOA 2FM6A 4HL2A 5A5ZA 3ADRA 2P97A 5K4MA 1ZKPA 3SPUA 2H6AA 2QDTA 1A8TA 1MQOA 3IEMA 1WW1A 2WYLA 3WXCA 4UBQA 3ZWFA 4AWYB 4FEKA 3ZR9A 2P4ZA 3PY5A 3AF6A 4RL0A 2BG8A 4RAMA 4DILA 2BG7A 2QINA 1BMCA 2AIOA 3ESHA 4V0HA 5AXOA 3MD7A 5EVBA 3BC2A 3IOGA 5LM6A 2DOOA 5KIKA 3VPEA 3DHCA 2FU7A 4Z5YA 3ZQ4A 3P2UA 3QH8A 4AX0B 2QEDA 1M2XA 2YNTA 5K0WA 4ZO3A 5HIOA 4EYLA 4TYFA 3ZNBA 3I15A 5A0VA 1QH5A 4AWZA 2YNVB 2YNTB 4EYBA 4EYFA 2BG6A 2NZEA 5HIPA 1XTOA 4EFZA 3S0ZA 4NQ5A 2FU6A 3LVZA 3A4YA 4XWTA 4Z7RA 5IQKA 5EH9A 1ZNBA 1YCFA 1VJNA 2OHHA 4RL2A 1A7TA 3PY6A 2ZZIA 5ACUA 4Z6XA 4TZFA 2BFZA 3T3OA 1DDKA 1P9EA 2WYMA 5A87A 2WHGA 5FQCA 2BFZB 3DHAA 2Y8AA 4DIKA 1X8IA 4TZEA 3I14A 1JJEA 1JJTA 5LCFA 2OHIA 1SMLA 4KEPA 5HH5A 3H3EA 3SFPA 3BK2A 4J5FA 2CBNA 1Y44A 4C1DA 3SD9A 5K4KA 4F6HA 3T3NA 4O98A 4Z60A 1KO2A 2GFJA 5A0TA 2UYXA 4H0DA 2Q42A 2BR6A 4YSLA 5EVDA 2BTNA 5HH6A 2NYPA 2OHJA 4YSKA 4Z67A 1YCGA 2Y8BA 3PG4A 4NQ4A 4RAWA 4BP0A 4D02A 3IE2A 4FSBA 5FQAA 5EVKA 5LE1A 3RKKA 5ACSA 2NZFA 1DXKA 3JXPA 4J5HA 4B87A 3IE1A 5LLDA 2Q9UA 4UWSB 4XWWA 4D1VA 2BGAA 5B1UA 2P18A 2GFKA 2HB9A 3DH8A 2GKLA 1KR3A 4PVOA 2YNVA 2FU9A 1KO3A 1BC2A 4TYTA 1E5DA 4GYQA 2GMNA 2FHXB 2GCUA 2A7MA 5ACXA 2FU8A 5ACVA 3X2ZA 3RPCA 2ZO4A 3IE0A 4U4LA 3L6NA 4GYUA 2YNUA 3F9OA 3X2XA 2Q0JA 3IDZA 4HL1A 4LE6A 3FCZA 4C09A 5LCHA 5LCAA 2I7XA 3I13A 4UA4A 3TP9A 1X8HA 4AX1B 5EW0A 4XUKA 4PVTA 2AZ4A 5EV6A 3G1PA 5K4NA 2FK6A 5HISA 2M5CA 1WRAA 4UAMA 2R2DA 5HH4A 2P1EA 2DKFA 5LSCA 3SW3A 4HKYA 4EXSA 3R2UA 1QH3A 2QJSA 3Q6VA 5B15A 1JT1A 2I7VA 2M5DA 3BK1A 4Z5ZA 4ZEJA 2NXAA 1XM8A 4C1FA 4YSBA 1WUPA 3IOFA 4BZ3A 5AYAA 2VW8A 5B3RA 2YCBA 4D1WA 2BFKA 3AJ3A 1K07A 5EHTA 2WRSA 4CHLA 4JO0A 2BMIA 5LS3A 4UWRB 2BFLA 4P62A 4GCWA 3BV6A 4FR7A 4C1EA 5HIQA 2ZNBA 1BVTA 1DD6A 5ACRA 2I7TA 2QDSA 4NQ2A 5AEBA 5ACPA 2YNWA 2XR1A 4ZNBA 4D1TA 5FQBA 4D1UA 4C1CA 2BG8B 4AD9A 3KL7A 2YZ3A 2FHXA 2XF4A 3VQZA 1VMEA 1X8GA 2BG2A
chains in the Genus database with same CATH superfamily
5AXRA 3T9MA 4EXYA 1HLKA 3SRXA 5KILA 3FAIA 4RBSA 1WUOA 3DHBA 1L9YA 4TZ9A 5EV8A 4UWOB 4RM5A 3I0VA 4TZBA 3X2YA 4WD6A 2ZWRA 3X30A 2WYMC 3IELA 1YCHA 2Y87A 5ACTA 3AF5A 1VGNA 3SBLA 2Q0IA 4C1HA 4C1GA 4ZO2A 3I11A 5ACWA 4NQ6A 4UWPB 2BC2A 5AJLA 2BIBA 2E7YA 5DPXA 3RKJA 3KNRA 5LMCA 5ACQA 4EY2A 5AHRA 5EWAA 3KNSA 4F6ZA 3IEKA 4KEQA 1ZTCA 5AHOA 2FM6A 4HL2A 5A5ZA 3ADRA 2P97A 5K4MA 2YHEA 1ZKPA 3SPUA 2H6AA 2QDTA 1A8TA 1MQOA 3IEMA 1WW1A 2WYLA 3WXCA 4UBQA 3ZWFA 4AWYB 4FEKA 3ZR9A 2P4ZA 3PY5A 3AF6A 4RL0A 2BG8A 4RAMA 4DILA 5AIJA 2BG7A 2QINA 1BMCA 2AIOA 3ESHA 4V0HA 5AXOA 3MD7A 5EVBA 3BC2A 3IOGA 5LM6A 2DOOA 5KIKA 3VPEA 3DHCA 2FU7A 4Z5YA 3ZQ4A 3P2UA 4AV7A 3QH8A 4AX0B 2QEDA 1M2XA 2YNTA 5K0WA 4ZO3A 5HIOA 4EYLA 4TYFA 3ZNBA 3I15A 5A0VA 1QH5A 4NURA 4AWZA 2YNVB 2YNTB 4EYBA 4EYFA 2BG6A 2NZEA 5HIPA 1XTOA 4EFZA 3S0ZA 4NQ5A 2FU6A 3LVZA 3A4YA 4XWTA 4Z7RA 5IQKA 5EH9A 1ZNBA 1YCFA 1VJNA 2OHHA 4RL2A 1A7TA 3PY6A 2ZZIA 5ACUA 4Z6XA 4TZFA 2BFZA 3T3OA 1DDKA 1P9EA 2WYMA 5A87A 2WHGA 5FQCA 2BFZB 3DHAA 2Y8AA 4DIKA 1X8IA 4TZEA 3I14A 1JJEA 1JJTA 5LCFA 2OHIA 1SMLA 4KEPA 5HH5A 3H3EA 3SFPA 3BK2A 4J5FA 2CBNA 1Y44A 4C1DA 3SD9A 5K4KA 4F6HA 3T3NA 4O98A 4Z60A 1KO2A 2GFJA 5A0TA 2UYXA 4H0DA 2Q42A 2BR6A 4YSLA 5EVDA 2BTNA 5HH6A 2NYPA 2OHJA 4YSKA 4Z67A 1YCGA 2Y8BA 3PG4A 4NQ4A 4RAWA 4BP0A 4D02A 3IE2A 4FSBA 5FQAA 5EVKA 5LE1A 3RKKA 5ACSA 2NZFA 1DXKA 3JXPA 4J5HA 4B87A 3IE1A 5LLDA 2Q9UA 4UWSB 4XWWA 4D1VA 2BGAA 5B1UA 2P18A 2GFKA 2HB9A 3DH8A 2GKLA 1KR3A 4PVOA 2YNVA 2FU9A 1KO3A 1BC2A 4TYTA 1E5DA 4GYQA 2GMNA 2FHXB 2GCUA 2A7MA 5ACXA 2FU8A 5ACVA 3X2ZA 3RPCA 2ZO4A 3IE0A 4U4LA 3L6NA 4GYUA 2YNUA 3F9OA 3X2XA 2Q0JA 3IDZA 4HL1A 4LE6A 3FCZA 4C09A 5LCHA 5LCAA 2I7XA 3I13A 4UA4A 3TP9A 1X8HA 4AX1B 5EW0A 4XUKA 4PVTA 2AZ4A 5EV6A 3G1PA 5K4NA 2FK6A 5HISA 4PDXA 2M5CA 1WRAA 4UAMA 2R2DA 5HH4A 2P1EA 2DKFA 5LSCA 3SW3A 4HKYA 4EXSA 3R2UA 1QH3A 2QJSA 3Q6VA 5B15A 2CG2A 1JT1A 2I7VA 2M5DA 3BK1A 4Z5ZA 4ZEJA 2NXAA 1XM8A 4C1FA 4YSBA 1WUPA 3IOFA 4BZ3A 4AXHA 5AYAA 2VW8A 5B3RA 5A23A 2YCBA 4D1WA 2BFKA 3AJ3A 1K07A 5EHTA 2WRSA 4CHLA 4JO0A 2BMIA 5LS3A 4UWRB 2BFLA 4P62A 4GCWA 2CFUA 3BV6A 4FR7A 4C1EA 5HIQA 2ZNBA 1BVTA 1DD6A 5ACRA 2I7TA 2QDSA 4NQ2A 5AEBA 5ACPA 2YNWA 2XR1A 2CG3A 4ZNBA 4D1TA 2CFZA 5FQBA 4D1UA 4C1CA 2BG8B 4AD9A 3KL7A 2YZ3A 2FHXA 2XF4A 3VQZA 1VMEA 1X8GA 2BG2A
chains in the Genus database with same CATH topology
5AXRA 3T9MA 4EXYA 1HLKA 3SRXA 5KILA 3FAIA 4RBSA 1WUOA 3DHBA 1L9YA 4TZ9A 5EV8A 4UWOB 4RM5A 3I0VA 4TZBA 3X2YA 4WD6A 2ZWRA 3X30A 2WYMC 3IELA 1YCHA 2Y87A 5ACTA 3AF5A 1VGNA 3SBLA 2Q0IA 4C1HA 4C1GA 4ZO2A 3I11A 5ACWA 4NQ6A 4UWPB 2BC2A 2BIBA 2E7YA 5DPXA 3RKJA 3KNRA 5LMCA 5ACQA 4EY2A 5AHRA 5EWAA 3KNSA 4F6ZA 3IEKA 4KEQA 1ZTCA 5AHOA 2FM6A 4HL2A 5A5ZA 3ADRA 2P97A 5K4MA 1ZKPA 3SPUA 2H6AA 2QDTA 1A8TA 1MQOA 3IEMA 1WW1A 2WYLA 3WXCA 4UBQA 3ZWFA 4AWYB 4FEKA 3ZR9A 2P4ZA 3PY5A 3AF6A 4RL0A 2BG8A 4RAMA 4DILA 2BG7A 2QINA 1BMCA 2AIOA 3ESHA 4V0HA 5AXOA 3MD7A 5EVBA 3BC2A 3IOGA 5LM6A 2DOOA 5KIKA 3VPEA 3DHCA 2FU7A 4Z5YA 3ZQ4A 3P2UA 3QH8A 4AX0B 2QEDA 1M2XA 2YNTA 5K0WA 4ZO3A 5HIOA 4EYLA 4TYFA 3ZNBA 3I15A 5A0VA 1QH5A 4AWZA 2YNVB 2YNTB 4EYBA 4EYFA 2BG6A 2NZEA 5HIPA 1XTOA 4EFZA 3S0ZA 4NQ5A 2FU6A 3LVZA 3A4YA 4XWTA 4Z7RA 5IQKA 5EH9A 1ZNBA 1YCFA 1VJNA 2OHHA 4RL2A 1A7TA 3PY6A 2ZZIA 5ACUA 4Z6XA 4TZFA 2BFZA 3T3OA 1DDKA 1P9EA 2WYMA 5A87A 2WHGA 5FQCA 2BFZB 3DHAA 2Y8AA 4DIKA 1X8IA 4TZEA 3I14A 1JJEA 1JJTA 5LCFA 2OHIA 1SMLA 4KEPA 5HH5A 3H3EA 3SFPA 3BK2A 4J5FA 2CBNA 1Y44A 4C1DA 3SD9A 5K4KA 4F6HA 3T3NA 4O98A 4Z60A 1KO2A 2GFJA 5A0TA 2UYXA 4H0DA 2Q42A 2BR6A 4YSLA 5EVDA 2BTNA 5HH6A 2NYPA 2OHJA 4YSKA 4Z67A 1YCGA 2Y8BA 3PG4A 4NQ4A 4RAWA 4BP0A 4D02A 3IE2A 4FSBA 5FQAA 5EVKA 5LE1A 3RKKA 5ACSA 2NZFA 1DXKA 3JXPA 4J5HA 4B87A 3IE1A 5LLDA 2Q9UA 4UWSB 4XWWA 4D1VA 2BGAA 5B1UA 2P18A 2GFKA 2HB9A 3DH8A 2GKLA 1KR3A 4PVOA 2YNVA 2FU9A 1KO3A 1BC2A 4TYTA 1E5DA 4GYQA 2GMNA 2FHXB 2GCUA 2A7MA 5ACXA 2FU8A 5ACVA 3X2ZA 3RPCA 2ZO4A 3IE0A 4U4LA 3L6NA 4GYUA 2YNUA 3F9OA 3X2XA 2Q0JA 3IDZA 4HL1A 4LE6A 3FCZA 4C09A 5LCHA 5LCAA 2I7XA 3I13A 4UA4A 3TP9A 1X8HA 4AX1B 5EW0A 4XUKA 4PVTA 2AZ4A 5EV6A 3G1PA 5K4NA 2FK6A 5HISA 2M5CA 1WRAA 4UAMA 2R2DA 5HH4A 2P1EA 2DKFA 5LSCA 3SW3A 4HKYA 4EXSA 3R2UA 1QH3A 2QJSA 3Q6VA 5B15A 1JT1A 2I7VA 2M5DA 3BK1A 4Z5ZA 4ZEJA 2NXAA 1XM8A 4C1FA 4YSBA 1WUPA 3IOFA 4BZ3A 5AYAA 2VW8A 5B3RA 2YCBA 4D1WA 2BFKA 3AJ3A 1K07A 5EHTA 2WRSA 4CHLA 4JO0A 2BMIA 5LS3A 4UWRB 2BFLA 4P62A 4GCWA 3BV6A 4FR7A 4C1EA 5HIQA 2ZNBA 1BVTA 1DD6A 5ACRA 2I7TA 2QDSA 4NQ2A 5AEBA 5ACPA 2YNWA 2XR1A 4ZNBA 4D1TA 5FQBA 4D1UA 4C1CA 2BG8B 4AD9A 3KL7A 2YZ3A 2FHXA 2XF4A 3VQZA 1VMEA 1X8GA 2BG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AXR A;  3T9M A;  4EXY A;  1HLK A;  3SRX A;  5KIL A;  3FAI A;  4RBS A;  1WUO A;  3DHB A;  1L9Y A;  4TZ9 A;  5EV8 A;  4UWO B;  4RM5 A;  3I0V A;  4TZB A;  3X2Y A;  4WD6 A;  2ZWR A;  3X30 A;  2WYM C;  3IEL A;  1YCH A;  2Y87 A;  5ACT A;  3AF5 A;  1VGN A;  3SBL A;  2Q0I A;  4C1H A;  4C1G A;  4ZO2 A;  3I11 A;  5ACW A;  4NQ6 A;  4UWP B;  2BC2 A;  2BIB A;  2E7Y A;  5DPX A;  3RKJ A;  3KNR A;  5LMC A;  5ACQ A;  4EY2 A;  5AHR A;  5EWA A;  3KNS A;  4F6Z A;  3IEK A;  4KEQ A;  1ZTC A;  5AHO A;  2FM6 A;  4HL2 A;  5A5Z A;  3ADR A;  2P97 A;  5K4M A;  1ZKP A;  3SPU A;  2H6A A;  2QDT A;  1A8T A;  1MQO A;  3IEM A;  1WW1 A;  2WYL A;  3WXC A;  4UBQ A;  3ZWF A;  4AWY B;  4FEK A;  3ZR9 A;  2P4Z A;  3PY5 A;  3AF6 A;  4RL0 A;  2BG8 A;  4RAM A;  4DIL A;  2BG7 A;  2QIN A;  1BMC A;  2AIO A;  3ESH A;  4V0H A;  5AXO A;  3MD7 A;  5EVB A;  3BC2 A;  3IOG A;  5LM6 A;  2DOO A;  5KIK A;  3VPE A;  3DHC A;  2FU7 A;  4Z5Y A;  3ZQ4 A;  3P2U A;  3QH8 A;  4AX0 B;  2QED A;  1M2X A;  2YNT A;  5K0W A;  4ZO3 A;  5HIO A;  4EYL A;  4TYF A;  3ZNB A;  3I15 A;  5A0V A;  1QH5 A;  4AWZ A;  2YNV B;  2YNT B;  4EYB A;  4EYF A;  2BG6 A;  2NZE A;  5HIP A;  1XTO A;  4EFZ A;  3S0Z A;  4NQ5 A;  2FU6 A;  3LVZ A;  3A4Y A;  4XWT A;  4Z7R A;  5IQK A;  5EH9 A;  1ZNB A;  1YCF A;  1VJN A;  2OHH A;  4RL2 A;  1A7T A;  3PY6 A;  2ZZI A;  5ACU A;  4Z6X A;  4TZF A;  2BFZ A;  3T3O A;  1DDK A;  1P9E A;  2WYM A;  5A87 A;  2WHG A;  5FQC A;  2BFZ B;  3DHA A;  2Y8A A;  4DIK A;  1X8I A;  4TZE A;  3I14 A;  1JJE A;  1JJT A;  5LCF A;  2OHI A;  1SML A;  4KEP A;  5HH5 A;  3H3E A;  3SFP A;  3BK2 A;  4J5F A;  2CBN A;  1Y44 A;  4C1D A;  3SD9 A;  5K4K A;  4F6H A;  3T3N A;  4O98 A;  4Z60 A;  1KO2 A;  2GFJ A;  5A0T A;  2UYX A;  4H0D A;  2Q42 A;  2BR6 A;  4YSL A;  5EVD A;  2BTN A;  5HH6 A;  2NYP A;  2OHJ A;  4YSK A;  4Z67 A;  1YCG A;  2Y8B A;  3PG4 A;  4NQ4 A;  4RAW A;  4BP0 A;  4D02 A;  3IE2 A;  4FSB A;  5FQA A;  5EVK A;  5LE1 A;  3RKK A;  5ACS A;  2NZF A;  1DXK A;  3JXP A;  4J5H A;  4B87 A;  3IE1 A;  5LLD A;  2Q9U A;  4UWS B;  4XWW A;  4D1V A;  2BGA A;  5B1U A;  2P18 A;  2GFK A;  2HB9 A;  3DH8 A;  2GKL A;  1KR3 A;  4PVO A;  2YNV A;  2FU9 A;  1KO3 A;  1BC2 A;  4TYT A;  1E5D A;  4GYQ A;  2GMN A;  2FHX B;  2GCU A;  2A7M A;  5ACX A;  2FU8 A;  5ACV A;  3X2Z A;  3RPC A;  2ZO4 A;  3IE0 A;  4U4L A;  3L6N A;  4GYU A;  2YNU A;  3F9O A;  3X2X A;  2Q0J A;  3IDZ A;  4HL1 A;  4LE6 A;  3FCZ A;  4C09 A;  5LCH A;  5LCA A;  2I7X A;  3I13 A;  4UA4 A;  3TP9 A;  1X8H A;  4AX1 B;  5EW0 A;  4XUK A;  4PVT A;  2AZ4 A;  5EV6 A;  3G1P A;  5K4N A;  2FK6 A;  5HIS A;  2M5C A;  1WRA A;  4UAM A;  2R2D A;  5HH4 A;  2P1E A;  2DKF A;  5LSC A;  3SW3 A;  4HKY A;  4EXS A;  3R2U A;  1QH3 A;  2QJS A;  3Q6V A;  5B15 A;  1JT1 A;  2I7V A;  2M5D A;  3BK1 A;  4Z5Z A;  4ZEJ A;  2NXA A;  1XM8 A;  4C1F A;  4YSB A;  1WUP A;  3IOF A;  4BZ3 A;  5AYA A;  2VW8 A;  5B3R A;  2YCB A;  4D1W A;  2BFK A;  3AJ3 A;  1K07 A;  5EHT A;  2WRS A;  4CHL A;  4JO0 A;  2BMI A;  5LS3 A;  4UWR B;  2BFL A;  4P62 A;  4GCW A;  3BV6 A;  4FR7 A;  4C1E A;  5HIQ A;  2ZNB A;  1BVT A;  1DD6 A;  5ACR A;  2I7T A;  2QDS A;  4NQ2 A;  5AEB A;  5ACP A;  2YNW A;  2XR1 A;  4ZNB A;  4D1T A;  5FQB A;  4D1U A;  4C1C A;  2BG8 B;  4AD9 A;  3KL7 A;  2YZ3 A;  2FHX A;  2XF4 A;  3VQZ A;  1VME A;  1X8G A;  2BG2 A; 
#chains in the Genus database with same CATH topology
 5AXR A;  3T9M A;  4EXY A;  1HLK A;  3SRX A;  5KIL A;  3FAI A;  4RBS A;  1WUO A;  3DHB A;  1L9Y A;  4TZ9 A;  5EV8 A;  4UWO B;  4RM5 A;  3I0V A;  4TZB A;  3X2Y A;  4WD6 A;  2ZWR A;  3X30 A;  2WYM C;  3IEL A;  1YCH A;  2Y87 A;  5ACT A;  3AF5 A;  1VGN A;  3SBL A;  2Q0I A;  4C1H A;  4C1G A;  4ZO2 A;  3I11 A;  5ACW A;  4NQ6 A;  4UWP B;  2BC2 A;  5AJL A;  2BIB A;  2E7Y A;  5DPX A;  3RKJ A;  3KNR A;  5LMC A;  5ACQ A;  4EY2 A;  5AHR A;  5EWA A;  3KNS A;  4F6Z A;  3IEK A;  4KEQ A;  1ZTC A;  5AHO A;  2FM6 A;  4HL2 A;  5A5Z A;  3ADR A;  2P97 A;  5K4M A;  2YHE A;  1ZKP A;  3SPU A;  2H6A A;  2QDT A;  1A8T A;  1MQO A;  3IEM A;  1WW1 A;  2WYL A;  3WXC A;  4UBQ A;  3ZWF A;  4AWY B;  4FEK A;  3ZR9 A;  2P4Z A;  3PY5 A;  3AF6 A;  4RL0 A;  2BG8 A;  4RAM A;  4DIL A;  5AIJ A;  2BG7 A;  2QIN A;  1BMC A;  2AIO A;  3ESH A;  4V0H A;  5AXO A;  3MD7 A;  5EVB A;  3BC2 A;  3IOG A;  5LM6 A;  2DOO A;  5KIK A;  3VPE A;  3DHC A;  2FU7 A;  4Z5Y A;  3ZQ4 A;  3P2U A;  4AV7 A;  3QH8 A;  4AX0 B;  2QED A;  1M2X A;  2YNT A;  5K0W A;  4ZO3 A;  5HIO A;  4EYL A;  4TYF A;  3ZNB A;  3I15 A;  5A0V A;  1QH5 A;  4NUR A;  4AWZ A;  2YNV B;  2YNT B;  4EYB A;  4EYF A;  2BG6 A;  2NZE A;  5HIP A;  1XTO A;  4EFZ A;  3S0Z A;  4NQ5 A;  2FU6 A;  3LVZ A;  3A4Y A;  4XWT A;  4Z7R A;  5IQK A;  5EH9 A;  1ZNB A;  1YCF A;  1VJN A;  2OHH A;  4RL2 A;  1A7T A;  3PY6 A;  2ZZI A;  5ACU A;  4Z6X A;  4TZF A;  2BFZ A;  3T3O A;  1DDK A;  1P9E A;  2WYM A;  5A87 A;  2WHG A;  5FQC A;  2BFZ B;  3DHA A;  2Y8A A;  4DIK A;  1X8I A;  4TZE A;  3I14 A;  1JJE A;  1JJT A;  5LCF A;  2OHI A;  1SML A;  4KEP A;  5HH5 A;  3H3E A;  3SFP A;  3BK2 A;  4J5F A;  2CBN A;  1Y44 A;  4C1D A;  3SD9 A;  5K4K A;  4F6H A;  3T3N A;  4O98 A;  4Z60 A;  1KO2 A;  2GFJ A;  5A0T A;  2UYX A;  4H0D A;  2Q42 A;  2BR6 A;  4YSL A;  5EVD A;  2BTN A;  5HH6 A;  2NYP A;  2OHJ A;  4YSK A;  4Z67 A;  1YCG A;  2Y8B A;  3PG4 A;  4NQ4 A;  4RAW A;  4BP0 A;  4D02 A;  3IE2 A;  4FSB A;  5FQA A;  5EVK A;  5LE1 A;  3RKK A;  5ACS A;  2NZF A;  1DXK A;  3JXP A;  4J5H A;  4B87 A;  3IE1 A;  5LLD A;  2Q9U A;  4UWS B;  4XWW A;  4D1V A;  2BGA A;  5B1U A;  2P18 A;  2GFK A;  2HB9 A;  3DH8 A;  2GKL A;  1KR3 A;  4PVO A;  2YNV A;  2FU9 A;  1KO3 A;  1BC2 A;  4TYT A;  1E5D A;  4GYQ A;  2GMN A;  2FHX B;  2GCU A;  2A7M A;  5ACX A;  2FU8 A;  5ACV A;  3X2Z A;  3RPC A;  2ZO4 A;  3IE0 A;  4U4L A;  3L6N A;  4GYU A;  2YNU A;  3F9O A;  3X2X A;  2Q0J A;  3IDZ A;  4HL1 A;  4LE6 A;  3FCZ A;  4C09 A;  5LCH A;  5LCA A;  2I7X A;  3I13 A;  4UA4 A;  3TP9 A;  1X8H A;  4AX1 B;  5EW0 A;  4XUK A;  4PVT A;  2AZ4 A;  5EV6 A;  3G1P A;  5K4N A;  2FK6 A;  5HIS A;  4PDX A;  2M5C A;  1WRA A;  4UAM A;  2R2D A;  5HH4 A;  2P1E A;  2DKF A;  5LSC A;  3SW3 A;  4HKY A;  4EXS A;  3R2U A;  1QH3 A;  2QJS A;  3Q6V A;  5B15 A;  2CG2 A;  1JT1 A;  2I7V A;  2M5D A;  3BK1 A;  4Z5Z A;  4ZEJ A;  2NXA A;  1XM8 A;  4C1F A;  4YSB A;  1WUP A;  3IOF A;  4BZ3 A;  4AXH A;  5AYA A;  2VW8 A;  5B3R A;  5A23 A;  2YCB A;  4D1W A;  2BFK A;  3AJ3 A;  1K07 A;  5EHT A;  2WRS A;  4CHL A;  4JO0 A;  2BMI A;  5LS3 A;  4UWR B;  2BFL A;  4P62 A;  4GCW A;  2CFU A;  3BV6 A;  4FR7 A;  4C1E A;  5HIQ A;  2ZNB A;  1BVT A;  1DD6 A;  5ACR A;  2I7T A;  2QDS A;  4NQ2 A;  5AEB A;  5ACP A;  2YNW A;  2XR1 A;  2CG3 A;  4ZNB A;  4D1T A;  2CFZ A;  5FQB A;  4D1U A;  4C1C A;  2BG8 B;  4AD9 A;  3KL7 A;  2YZ3 A;  2FHX A;  2XF4 A;  3VQZ A;  1VME A;  1X8G A;  2BG2 A; 
#chains in the Genus database with same CATH homology
 5AXR A;  3T9M A;  4EXY A;  1HLK A;  3SRX A;  5KIL A;  3FAI A;  4RBS A;  1WUO A;  3DHB A;  1L9Y A;  4TZ9 A;  5EV8 A;  4UWO B;  4RM5 A;  3I0V A;  4TZB A;  3X2Y A;  4WD6 A;  2ZWR A;  3X30 A;  2WYM C;  3IEL A;  1YCH A;  2Y87 A;  5ACT A;  3AF5 A;  1VGN A;  3SBL A;  2Q0I A;  4C1H A;  4C1G A;  4ZO2 A;  3I11 A;  5ACW A;  4NQ6 A;  4UWP B;  2BC2 A;  2BIB A;  2E7Y A;  5DPX A;  3RKJ A;  3KNR A;  5LMC A;  5ACQ A;  4EY2 A;  5AHR A;  5EWA A;  3KNS A;  4F6Z A;  3IEK A;  4KEQ A;  1ZTC A;  5AHO A;  2FM6 A;  4HL2 A;  5A5Z A;  3ADR A;  2P97 A;  5K4M A;  1ZKP A;  3SPU A;  2H6A A;  2QDT A;  1A8T A;  1MQO A;  3IEM A;  1WW1 A;  2WYL A;  3WXC A;  4UBQ A;  3ZWF A;  4AWY B;  4FEK A;  3ZR9 A;  2P4Z A;  3PY5 A;  3AF6 A;  4RL0 A;  2BG8 A;  4RAM A;  4DIL A;  2BG7 A;  2QIN A;  1BMC A;  2AIO A;  3ESH A;  4V0H A;  5AXO A;  3MD7 A;  5EVB A;  3BC2 A;  3IOG A;  5LM6 A;  2DOO A;  5KIK A;  3VPE A;  3DHC A;  2FU7 A;  4Z5Y A;  3ZQ4 A;  3P2U A;  3QH8 A;  4AX0 B;  2QED A;  1M2X A;  2YNT A;  5K0W A;  4ZO3 A;  5HIO A;  4EYL A;  4TYF A;  3ZNB A;  3I15 A;  5A0V A;  1QH5 A;  4AWZ A;  2YNV B;  2YNT B;  4EYB A;  4EYF A;  2BG6 A;  2NZE A;  5HIP A;  1XTO A;  4EFZ A;  3S0Z A;  4NQ5 A;  2FU6 A;  3LVZ A;  3A4Y A;  4XWT A;  4Z7R A;  5IQK A;  5EH9 A;  1ZNB A;  1YCF A;  1VJN A;  2OHH A;  4RL2 A;  1A7T A;  3PY6 A;  2ZZI A;  5ACU A;  4Z6X A;  4TZF A;  2BFZ A;  3T3O A;  1DDK A;  1P9E A;  2WYM A;  5A87 A;  2WHG A;  5FQC A;  2BFZ B;  3DHA A;  2Y8A A;  4DIK A;  1X8I A;  4TZE A;  3I14 A;  1JJE A;  1JJT A;  5LCF A;  2OHI A;  1SML A;  4KEP A;  5HH5 A;  3H3E A;  3SFP A;  3BK2 A;  4J5F A;  2CBN A;  1Y44 A;  4C1D A;  3SD9 A;  5K4K A;  4F6H A;  3T3N A;  4O98 A;  4Z60 A;  1KO2 A;  2GFJ A;  5A0T A;  2UYX A;  4H0D A;  2Q42 A;  2BR6 A;  4YSL A;  5EVD A;  2BTN A;  5HH6 A;  2NYP A;  2OHJ A;  4YSK A;  4Z67 A;  1YCG A;  2Y8B A;  3PG4 A;  4NQ4 A;  4RAW A;  4BP0 A;  4D02 A;  3IE2 A;  4FSB A;  5FQA A;  5EVK A;  5LE1 A;  3RKK A;  5ACS A;  2NZF A;  1DXK A;  3JXP A;  4J5H A;  4B87 A;  3IE1 A;  5LLD A;  2Q9U A;  4UWS B;  4XWW A;  4D1V A;  2BGA A;  5B1U A;  2P18 A;  2GFK A;  2HB9 A;  3DH8 A;  2GKL A;  1KR3 A;  4PVO A;  2YNV A;  2FU9 A;  1KO3 A;  1BC2 A;  4TYT A;  1E5D A;  4GYQ A;  2GMN A;  2FHX B;  2GCU A;  2A7M A;  5ACX A;  2FU8 A;  5ACV A;  3X2Z A;  3RPC A;  2ZO4 A;  3IE0 A;  4U4L A;  3L6N A;  4GYU A;  2YNU A;  3F9O A;  3X2X A;  2Q0J A;  3IDZ A;  4HL1 A;  4LE6 A;  3FCZ A;  4C09 A;  5LCH A;  5LCA A;  2I7X A;  3I13 A;  4UA4 A;  3TP9 A;  1X8H A;  4AX1 B;  5EW0 A;  4XUK A;  4PVT A;  2AZ4 A;  5EV6 A;  3G1P A;  5K4N A;  2FK6 A;  5HIS A;  2M5C A;  1WRA A;  4UAM A;  2R2D A;  5HH4 A;  2P1E A;  2DKF A;  5LSC A;  3SW3 A;  4HKY A;  4EXS A;  3R2U A;  1QH3 A;  2QJS A;  3Q6V A;  5B15 A;  1JT1 A;  2I7V A;  2M5D A;  3BK1 A;  4Z5Z A;  4ZEJ A;  2NXA A;  1XM8 A;  4C1F A;  4YSB A;  1WUP A;  3IOF A;  4BZ3 A;  5AYA A;  2VW8 A;  5B3R A;  2YCB A;  4D1W A;  2BFK A;  3AJ3 A;  1K07 A;  5EHT A;  2WRS A;  4CHL A;  4JO0 A;  2BMI A;  5LS3 A;  4UWR B;  2BFL A;  4P62 A;  4GCW A;  3BV6 A;  4FR7 A;  4C1E A;  5HIQ A;  2ZNB A;  1BVT A;  1DD6 A;  5ACR A;  2I7T A;  2QDS A;  4NQ2 A;  5AEB A;  5ACP A;  2YNW A;  2XR1 A;  4ZNB A;  4D1T A;  5FQB A;  4D1U A;  4C1C A;  2BG8 B;  4AD9 A;  3KL7 A;  2YZ3 A;  2FHX A;  2XF4 A;  3VQZ A;  1VME A;  1X8G A;  2BG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...