3X2YA

Crystal structure of metallo-beta-lactamase h8a from thermotoga maritima
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
227
structure length
227
Chain Sequence
GMKVTFLGAAVVLIEGKKNIIIDPFISGNPVCPVKLEGLPKIDYILVTHGHGDHLGDAVEIAKKNDATVISNYEICHYLGKKGVKTHAMHIGGSYLFDFGRVKMTPAVHGSGILDGDSMIYGGNPSGFLITIEGKKIYHAGDTGLTREMELLAEENVDVAFLPIGGNFVMDVEDAVRAAVMIKPKKVVPMHYGTWELIFADVELFKKKVEEKGVECVILEPGESLEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0173 metal-dependent hydrolase TM_1162
publication title Crystal structure of metallo-beta-lactamase H8A from Thermotoga maritima
rcsb
source organism Thermotoga maritima msb8
molecule tags Hydrolase
total genus 61
structure length 227
sequence length 227
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3x2yA00
4PVTA 1VJNA 1ZKPA 3IOGA 3AF6A 1WUOA 3H3EA 1DXKA 1YCFA 3ZQ4A 5FQBA 4FR7A 2GFJA 4TZ9A 1QH3A 4F6HA 2BIBA 1MQOA 5B3RA 5FQAA 2P97A 5ACPA 2FU6A 5KIKA 1JJEA 1VMEA 4Z5ZA 3PY6A 1P9EA 5DPXA 2BG2A 4C1HA 4BZ3A 4AD9A 3JXPA 3IE2A 3P2UA 4ZO3A 3A4YA 3FAIA 3X2ZA 2WRSA 4F6ZA 3ZR9A 1WUPA 3X30A 2Q0IA 4UWRB 5EH9A 4HL1A 1YCHA 2FK6A 2YNTA 2QDTA 5LCHA 2VW8A 5LCAA 4TZFA 4EYLA 3I14A 2A7MA 2Y8AA 5EV8A 5ACTA 5EW0A 2FHXA 4HKYA 4NQ2A 4B87A 4RL0A 3DHCA 2M5CA 4NQ4A 5K0WA 5LSCA 3PY5A 4RBSA 1BVTA 3RPCA 4D02A 4UWSB 5IQKA 2BFLA 5ACRA 2BFKA 2YCBA 3IEKA 2NZEA 5ACWA 2GKLA 5HIPA 2ZNBA 2GMNA 5KILA 2BGAA 5AXOA 4EXYA 2WYLA 3IDZA 3IELA 3BK2A 2I7TA 4C1GA 5A0VA 2BFZA 2DOOA 3ZWFA 4V0HA 2ZWRA 3SPUA 2BG8B 3LVZA 4ZNBA 5B1UA 2YNUA 4GYQA 1XM8A 2BR6A 3IEMA 4UBQA 4CHLA 3AJ3A 3T9MA 4LE6A 3VQZA 4ZEJA 2OHIA 2P4ZA 2Q42A 3VPEA 4P62A 1ZNBA 2BG8A 2YNVB 3T3NA 4RL2A 4TZBA 2M5DA 2I7XA 4J5HA 3KNRA 3MD7A 5HIQA 3WXCA 4UA4A 3R2UA 1X8HA 3F9OA 1BMCA 2ZO4A 4TYTA 3SW3A 5A0TA 1QH5A 3BC2A 2QINA 5ACXA 5HH4A 2YNVA 4AX0B 2XF4A 1K07A 2FU8A 3KNSA 4H0DA 4XUKA 1ZTCA 2OHHA 2BC2A 2OHJA 3ADRA 1XTOA 4EYFA 5EV6A 3IE1A 1WRAA 4U4LA 4EY2A 3I13A 5AXRA 4RAWA 4C1FA 2BTNA 1M2XA 4O98A 2QDSA 2P18A 5EVKA 3X2XA 4C1CA 2NZFA 4TZEA 5AHOA 5A87A 2QJSA 1WW1A 4YSBA 3DHBA 4TYFA 4JO0A 5ACVA 2H6AA 5ACSA 2Y8BA 3AF5A 5ACQA 5LS3A 1A7TA 5EVDA 3DH8A 5AEBA 2WYMC 3I11A 4EYBA 4D1VA 4DILA 1SMLA 4AWZA 2FU9A 4Z67A 5FQCA 4D1TA 3T3OA 2UYXA 4J5FA 5HISA 2WYMA 3QH8A 1VGNA 2FU7A 2AZ4A 2E7YA 1HLKA 2FM6A 4HL2A 4AWYB 2BMIA 3I0VA 3PG4A 3FCZA 3IE0A 4D1WA 4NQ6A 2WHGA 4EXSA 2ZZIA 4UWPB 3DHAA 2NYPA 5LM6A 5HIOA 1L9YA 4C1DA 5AHRA 3SD9A 2YZ3A 4C1EA 4PVOA 1DDKA 5EVBA 1JJTA 3TP9A 3ZNBA 2I7VA 4GYUA 2XR1A 3RKKA 4UWOB 2AIOA 1DD6A 4Z5YA 1KO3A 3I15A 5LMCA 2YNWA 5K4NA 3SFPA 3S0ZA 3IOFA 2R2DA 5ACUA 2YNTB 1KO2A 4D1UA 4DIKA 2Y87A 4ZO2A 2Q9UA 2P1EA 1JT1A 3BK1A 3BV6A 2DKFA 1Y44A 4XWTA 4Z7RA 4KEPA 2NXAA 2FHXB 3Q6VA 5EWAA 1KR3A 4BP0A 4FEKA 5HH6A 1X8IA 5HH5A 4KEQA 5AYAA 3G1PA 2BG6A 4NQ5A 4EFZA 3L6NA 2BG7A 1X8GA 3SBLA 1A8TA 5EHTA 4FSBA 4Z6XA 2HB9A 4XWWA 5A5ZA 2CBNA 2GCUA 5B15A 2Q0JA 5LLDA 1E5DA 4YSKA 4RAMA 3RKJA 2BFZB 4GCWA 2QEDA 4AX1B 1YCGA 4UAMA 3X2YA 3SRXA 5K4MA 4YSLA 3KL7A 4WD6A 5LCFA 1BC2A 5K4KA 2GFKA 4RM5A 4C09A 3ESHA 5LE1A 4Z60A
chains in the Genus database with same CATH superfamily
4PVTA 1VJNA 1ZKPA 3IOGA 3AF6A 1WUOA 3H3EA 1DXKA 1YCFA 3ZQ4A 5FQBA 4FR7A 2GFJA 4TZ9A 1QH3A 4F6HA 2BIBA 1MQOA 5B3RA 5FQAA 2P97A 5ACPA 2FU6A 5KIKA 1JJEA 1VMEA 4Z5ZA 3PY6A 1P9EA 5DPXA 2BG2A 4C1HA 4BZ3A 4AD9A 3JXPA 3IE2A 3P2UA 4ZO3A 3A4YA 3FAIA 3X2ZA 2WRSA 4F6ZA 5A23A 3ZR9A 1WUPA 3X30A 4AV7A 2Q0IA 4UWRB 5EH9A 4HL1A 1YCHA 2FK6A 2YNTA 2QDTA 5LCHA 2VW8A 5LCAA 4TZFA 4EYLA 3I14A 2A7MA 2Y8AA 5EV8A 5ACTA 5EW0A 2FHXA 4HKYA 5AJLA 4NQ2A 4B87A 4RL0A 3DHCA 2M5CA 4NQ4A 5K0WA 5LSCA 3PY5A 4RBSA 1BVTA 3RPCA 4D02A 4UWSB 5IQKA 2BFLA 5ACRA 2BFKA 2YCBA 3IEKA 2NZEA 5ACWA 2GKLA 5HIPA 2ZNBA 2GMNA 5KILA 2BGAA 5AXOA 4EXYA 2WYLA 3IDZA 3IELA 3BK2A 2I7TA 4C1GA 5A0VA 2BFZA 2DOOA 3ZWFA 4V0HA 2ZWRA 2CG2A 3SPUA 2BG8B 3LVZA 4ZNBA 5B1UA 2CFZA 2YNUA 4GYQA 1XM8A 2BR6A 3IEMA 4UBQA 4CHLA 3AJ3A 3T9MA 4LE6A 3VQZA 4ZEJA 2OHIA 2P4ZA 2Q42A 3VPEA 4P62A 1ZNBA 2BG8A 2YNVB 3T3NA 4RL2A 4TZBA 2M5DA 2I7XA 4J5HA 3KNRA 3MD7A 3WXCA 5HIQA 4UA4A 3R2UA 1X8HA 3F9OA 1BMCA 2ZO4A 4TYTA 3SW3A 5A0TA 1QH5A 3BC2A 2QINA 5ACXA 5HH4A 2YNVA 4AX0B 2XF4A 1K07A 2FU8A 3KNSA 4H0DA 4XUKA 1ZTCA 2OHHA 2BC2A 2OHJA 3ADRA 1XTOA 4EYFA 5EV6A 3IE1A 1WRAA 4U4LA 4EY2A 3I13A 5AXRA 4RAWA 4C1FA 2BTNA 1M2XA 4O98A 2QDSA 2P18A 5EVKA 3X2XA 4C1CA 2NZFA 4TZEA 5AHOA 5A87A 2QJSA 1WW1A 4YSBA 3DHBA 4NURA 4TYFA 4JO0A 5ACVA 2H6AA 5ACSA 2Y8BA 3AF5A 5ACQA 5LS3A 1A7TA 2CFUA 5EVDA 3DH8A 5AEBA 2WYMC 3I11A 4EYBA 4D1VA 4DILA 4AXHA 1SMLA 4AWZA 2FU9A 4Z67A 2CG3A 5FQCA 4D1TA 3T3OA 2UYXA 4J5FA 5HISA 2WYMA 3QH8A 1VGNA 2FU7A 2AZ4A 2E7YA 1HLKA 2FM6A 4HL2A 4AWYB 2BMIA 3I0VA 3PG4A 3FCZA 3IE0A 4D1WA 4NQ6A 2WHGA 4EXSA 2ZZIA 4UWPB 3DHAA 2NYPA 5LM6A 4PDXA 5HIOA 1L9YA 4C1DA 5AHRA 3SD9A 2YZ3A 4C1EA 4PVOA 1DDKA 5EVBA 1JJTA 3TP9A 3ZNBA 2I7VA 2YHEA 4GYUA 2XR1A 3RKKA 4UWOB 2AIOA 1DD6A 4Z5YA 1KO3A 3I15A 5LMCA 2YNWA 5K4NA 3SFPA 3S0ZA 3IOFA 2R2DA 5ACUA 5AIJA 2YNTB 1KO2A 4D1UA 4DIKA 2Y87A 4ZO2A 2Q9UA 2P1EA 1JT1A 3BK1A 3BV6A 2DKFA 1Y44A 4XWTA 4Z7RA 4KEPA 2NXAA 2FHXB 3Q6VA 5EWAA 1KR3A 4BP0A 4FEKA 5HH6A 1X8IA 5HH5A 4KEQA 5AYAA 3G1PA 2BG6A 4NQ5A 4EFZA 3L6NA 2BG7A 1X8GA 3SBLA 1A8TA 5EHTA 4FSBA 4Z6XA 2HB9A 4XWWA 5A5ZA 2CBNA 2GCUA 5B15A 2Q0JA 5LLDA 1E5DA 4YSKA 4RAMA 3RKJA 2BFZB 4GCWA 2QEDA 4AX1B 1YCGA 4UAMA 3X2YA 3SRXA 5K4MA 4YSLA 3KL7A 4WD6A 5LCFA 1BC2A 5K4KA 2GFKA 4RM5A 4C09A 3ESHA 5LE1A 4Z60A
chains in the Genus database with same CATH topology
4PVTA 1VJNA 1ZKPA 3IOGA 3AF6A 1WUOA 3H3EA 1DXKA 1YCFA 3ZQ4A 5FQBA 4FR7A 2GFJA 4TZ9A 1QH3A 4F6HA 2BIBA 1MQOA 5B3RA 5FQAA 2P97A 5ACPA 2FU6A 5KIKA 1JJEA 1VMEA 4Z5ZA 3PY6A 1P9EA 5DPXA 2BG2A 4C1HA 4BZ3A 4AD9A 3JXPA 3IE2A 3P2UA 4ZO3A 3A4YA 3FAIA 3X2ZA 2WRSA 4F6ZA 3ZR9A 1WUPA 3X30A 2Q0IA 4UWRB 5EH9A 4HL1A 1YCHA 2FK6A 2YNTA 2QDTA 5LCHA 2VW8A 5LCAA 4TZFA 4EYLA 3I14A 2A7MA 2Y8AA 5EV8A 5ACTA 5EW0A 2FHXA 4HKYA 4NQ2A 4B87A 4RL0A 3DHCA 2M5CA 4NQ4A 5K0WA 5LSCA 3PY5A 4RBSA 1BVTA 3RPCA 4D02A 4UWSB 5IQKA 2BFLA 5ACRA 2BFKA 2YCBA 3IEKA 2NZEA 5ACWA 2GKLA 5HIPA 2ZNBA 2GMNA 5KILA 2BGAA 5AXOA 4EXYA 2WYLA 3IDZA 3IELA 3BK2A 2I7TA 4C1GA 5A0VA 2BFZA 2DOOA 3ZWFA 4V0HA 2ZWRA 3SPUA 2BG8B 3LVZA 4ZNBA 5B1UA 2YNUA 4GYQA 1XM8A 2BR6A 3IEMA 4UBQA 4CHLA 3AJ3A 3T9MA 4LE6A 3VQZA 4ZEJA 2OHIA 2P4ZA 2Q42A 3VPEA 4P62A 1ZNBA 2BG8A 2YNVB 3T3NA 4RL2A 4TZBA 2M5DA 2I7XA 4J5HA 3KNRA 3MD7A 5HIQA 3WXCA 4UA4A 3R2UA 1X8HA 3F9OA 1BMCA 2ZO4A 4TYTA 3SW3A 5A0TA 1QH5A 3BC2A 2QINA 5ACXA 5HH4A 2YNVA 4AX0B 2XF4A 1K07A 2FU8A 3KNSA 4H0DA 4XUKA 1ZTCA 2OHHA 2BC2A 2OHJA 3ADRA 1XTOA 4EYFA 5EV6A 3IE1A 1WRAA 4U4LA 4EY2A 3I13A 5AXRA 4RAWA 4C1FA 2BTNA 1M2XA 4O98A 2QDSA 2P18A 5EVKA 3X2XA 4C1CA 2NZFA 4TZEA 5AHOA 5A87A 2QJSA 1WW1A 4YSBA 3DHBA 4TYFA 4JO0A 5ACVA 2H6AA 5ACSA 2Y8BA 3AF5A 5ACQA 5LS3A 1A7TA 5EVDA 3DH8A 5AEBA 2WYMC 3I11A 4EYBA 4D1VA 4DILA 1SMLA 4AWZA 2FU9A 4Z67A 5FQCA 4D1TA 3T3OA 2UYXA 4J5FA 5HISA 2WYMA 3QH8A 1VGNA 2FU7A 2AZ4A 2E7YA 1HLKA 2FM6A 4HL2A 4AWYB 2BMIA 3I0VA 3PG4A 3FCZA 3IE0A 4D1WA 4NQ6A 2WHGA 4EXSA 2ZZIA 4UWPB 3DHAA 2NYPA 5LM6A 5HIOA 1L9YA 4C1DA 5AHRA 3SD9A 2YZ3A 4C1EA 4PVOA 1DDKA 5EVBA 1JJTA 3TP9A 3ZNBA 2I7VA 4GYUA 2XR1A 3RKKA 4UWOB 2AIOA 1DD6A 4Z5YA 1KO3A 3I15A 5LMCA 2YNWA 5K4NA 3SFPA 3S0ZA 3IOFA 2R2DA 5ACUA 2YNTB 1KO2A 4D1UA 4DIKA 2Y87A 4ZO2A 2Q9UA 2P1EA 1JT1A 3BK1A 3BV6A 2DKFA 1Y44A 4XWTA 4Z7RA 4KEPA 2NXAA 2FHXB 3Q6VA 5EWAA 1KR3A 4BP0A 4FEKA 5HH6A 1X8IA 5HH5A 4KEQA 5AYAA 3G1PA 2BG6A 4NQ5A 4EFZA 3L6NA 2BG7A 1X8GA 3SBLA 1A8TA 5EHTA 4FSBA 4Z6XA 2HB9A 4XWWA 5A5ZA 2CBNA 2GCUA 5B15A 2Q0JA 5LLDA 1E5DA 4YSKA 4RAMA 3RKJA 2BFZB 4GCWA 2QEDA 4AX1B 1YCGA 4UAMA 3X2YA 3SRXA 5K4MA 4YSLA 3KL7A 4WD6A 5LCFA 1BC2A 5K4KA 2GFKA 4RM5A 4C09A 3ESHA 5LE1A 4Z60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PVT A;  1VJN A;  1ZKP A;  3IOG A;  3AF6 A;  1WUO A;  3H3E A;  1DXK A;  1YCF A;  3ZQ4 A;  5FQB A;  4FR7 A;  2GFJ A;  4TZ9 A;  1QH3 A;  4F6H A;  2BIB A;  1MQO A;  5B3R A;  5FQA A;  2P97 A;  5ACP A;  2FU6 A;  5KIK A;  1JJE A;  1VME A;  4Z5Z A;  3PY6 A;  1P9E A;  5DPX A;  2BG2 A;  4C1H A;  4BZ3 A;  4AD9 A;  3JXP A;  3IE2 A;  3P2U A;  4ZO3 A;  3A4Y A;  3FAI A;  3X2Z A;  2WRS A;  4F6Z A;  3ZR9 A;  1WUP A;  3X30 A;  2Q0I A;  4UWR B;  5EH9 A;  4HL1 A;  1YCH A;  2FK6 A;  2YNT A;  2QDT A;  5LCH A;  2VW8 A;  5LCA A;  4TZF A;  4EYL A;  3I14 A;  2A7M A;  2Y8A A;  5EV8 A;  5ACT A;  5EW0 A;  2FHX A;  4HKY A;  4NQ2 A;  4B87 A;  4RL0 A;  3DHC A;  2M5C A;  4NQ4 A;  5K0W A;  5LSC A;  3PY5 A;  4RBS A;  1BVT A;  3RPC A;  4D02 A;  4UWS B;  5IQK A;  2BFL A;  5ACR A;  2BFK A;  2YCB A;  3IEK A;  2NZE A;  5ACW A;  2GKL A;  5HIP A;  2ZNB A;  2GMN A;  5KIL A;  2BGA A;  5AXO A;  4EXY A;  2WYL A;  3IDZ A;  3IEL A;  3BK2 A;  2I7T A;  4C1G A;  5A0V A;  2BFZ A;  2DOO A;  3ZWF A;  4V0H A;  2ZWR A;  3SPU A;  2BG8 B;  3LVZ A;  4ZNB A;  5B1U A;  2YNU A;  4GYQ A;  1XM8 A;  2BR6 A;  3IEM A;  4UBQ A;  4CHL A;  3AJ3 A;  3T9M A;  4LE6 A;  3VQZ A;  4ZEJ A;  2OHI A;  2P4Z A;  2Q42 A;  3VPE A;  4P62 A;  1ZNB A;  2BG8 A;  2YNV B;  3T3N A;  4RL2 A;  4TZB A;  2M5D A;  2I7X A;  4J5H A;  3KNR A;  3MD7 A;  5HIQ A;  3WXC A;  4UA4 A;  3R2U A;  1X8H A;  3F9O A;  1BMC A;  2ZO4 A;  4TYT A;  3SW3 A;  5A0T A;  1QH5 A;  3BC2 A;  2QIN A;  5ACX A;  5HH4 A;  2YNV A;  4AX0 B;  2XF4 A;  1K07 A;  2FU8 A;  3KNS A;  4H0D A;  4XUK A;  1ZTC A;  2OHH A;  2BC2 A;  2OHJ A;  3ADR A;  1XTO A;  4EYF A;  5EV6 A;  3IE1 A;  1WRA A;  4U4L A;  4EY2 A;  3I13 A;  5AXR A;  4RAW A;  4C1F A;  2BTN A;  1M2X A;  4O98 A;  2QDS A;  2P18 A;  5EVK A;  3X2X A;  4C1C A;  2NZF A;  4TZE A;  5AHO A;  5A87 A;  2QJS A;  1WW1 A;  4YSB A;  3DHB A;  4TYF A;  4JO0 A;  5ACV A;  2H6A A;  5ACS A;  2Y8B A;  3AF5 A;  5ACQ A;  5LS3 A;  1A7T A;  5EVD A;  3DH8 A;  5AEB A;  2WYM C;  3I11 A;  4EYB A;  4D1V A;  4DIL A;  1SML A;  4AWZ A;  2FU9 A;  4Z67 A;  5FQC A;  4D1T A;  3T3O A;  2UYX A;  4J5F A;  5HIS A;  2WYM A;  3QH8 A;  1VGN A;  2FU7 A;  2AZ4 A;  2E7Y A;  1HLK A;  2FM6 A;  4HL2 A;  4AWY B;  2BMI A;  3I0V A;  3PG4 A;  3FCZ A;  3IE0 A;  4D1W A;  4NQ6 A;  2WHG A;  4EXS A;  2ZZI A;  4UWP B;  3DHA A;  2NYP A;  5LM6 A;  5HIO A;  1L9Y A;  4C1D A;  5AHR A;  3SD9 A;  2YZ3 A;  4C1E A;  4PVO A;  1DDK A;  5EVB A;  1JJT A;  3TP9 A;  3ZNB A;  2I7V A;  4GYU A;  2XR1 A;  3RKK A;  4UWO B;  2AIO A;  1DD6 A;  4Z5Y A;  1KO3 A;  3I15 A;  5LMC A;  2YNW A;  5K4N A;  3SFP A;  3S0Z A;  3IOF A;  2R2D A;  5ACU A;  2YNT B;  1KO2 A;  4D1U A;  4DIK A;  2Y87 A;  4ZO2 A;  2Q9U A;  2P1E A;  1JT1 A;  3BK1 A;  3BV6 A;  2DKF A;  1Y44 A;  4XWT A;  4Z7R A;  4KEP A;  2NXA A;  2FHX B;  3Q6V A;  5EWA A;  1KR3 A;  4BP0 A;  4FEK A;  5HH6 A;  1X8I A;  5HH5 A;  4KEQ A;  5AYA A;  3G1P A;  2BG6 A;  4NQ5 A;  4EFZ A;  3L6N A;  2BG7 A;  1X8G A;  3SBL A;  1A8T A;  5EHT A;  4FSB A;  4Z6X A;  2HB9 A;  4XWW A;  5A5Z A;  2CBN A;  2GCU A;  5B15 A;  2Q0J A;  5LLD A;  1E5D A;  4YSK A;  4RAM A;  3RKJ A;  2BFZ B;  4GCW A;  2QED A;  4AX1 B;  1YCG A;  4UAM A;  3X2Y A;  3SRX A;  5K4M A;  4YSL A;  3KL7 A;  4WD6 A;  5LCF A;  1BC2 A;  5K4K A;  2GFK A;  4RM5 A;  4C09 A;  3ESH A;  5LE1 A;  4Z60 A; 
#chains in the Genus database with same CATH topology
 4PVT A;  1VJN A;  1ZKP A;  3IOG A;  3AF6 A;  1WUO A;  3H3E A;  1DXK A;  1YCF A;  3ZQ4 A;  5FQB A;  4FR7 A;  2GFJ A;  4TZ9 A;  1QH3 A;  4F6H A;  2BIB A;  1MQO A;  5B3R A;  5FQA A;  2P97 A;  5ACP A;  2FU6 A;  5KIK A;  1JJE A;  1VME A;  4Z5Z A;  3PY6 A;  1P9E A;  5DPX A;  2BG2 A;  4C1H A;  4BZ3 A;  4AD9 A;  3JXP A;  3IE2 A;  3P2U A;  4ZO3 A;  3A4Y A;  3FAI A;  3X2Z A;  2WRS A;  4F6Z A;  5A23 A;  3ZR9 A;  1WUP A;  3X30 A;  4AV7 A;  2Q0I A;  4UWR B;  5EH9 A;  4HL1 A;  1YCH A;  2FK6 A;  2YNT A;  2QDT A;  5LCH A;  2VW8 A;  5LCA A;  4TZF A;  4EYL A;  3I14 A;  2A7M A;  2Y8A A;  5EV8 A;  5ACT A;  5EW0 A;  2FHX A;  4HKY A;  5AJL A;  4NQ2 A;  4B87 A;  4RL0 A;  3DHC A;  2M5C A;  4NQ4 A;  5K0W A;  5LSC A;  3PY5 A;  4RBS A;  1BVT A;  3RPC A;  4D02 A;  4UWS B;  5IQK A;  2BFL A;  5ACR A;  2BFK A;  2YCB A;  3IEK A;  2NZE A;  5ACW A;  2GKL A;  5HIP A;  2ZNB A;  2GMN A;  5KIL A;  2BGA A;  5AXO A;  4EXY A;  2WYL A;  3IDZ A;  3IEL A;  3BK2 A;  2I7T A;  4C1G A;  5A0V A;  2BFZ A;  2DOO A;  3ZWF A;  4V0H A;  2ZWR A;  2CG2 A;  3SPU A;  2BG8 B;  3LVZ A;  4ZNB A;  5B1U A;  2CFZ A;  2YNU A;  4GYQ A;  1XM8 A;  2BR6 A;  3IEM A;  4UBQ A;  4CHL A;  3AJ3 A;  3T9M A;  4LE6 A;  3VQZ A;  4ZEJ A;  2OHI A;  2P4Z A;  2Q42 A;  3VPE A;  4P62 A;  1ZNB A;  2BG8 A;  2YNV B;  3T3N A;  4RL2 A;  4TZB A;  2M5D A;  2I7X A;  4J5H A;  3KNR A;  3MD7 A;  3WXC A;  5HIQ A;  4UA4 A;  3R2U A;  1X8H A;  3F9O A;  1BMC A;  2ZO4 A;  4TYT A;  3SW3 A;  5A0T A;  1QH5 A;  3BC2 A;  2QIN A;  5ACX A;  5HH4 A;  2YNV A;  4AX0 B;  2XF4 A;  1K07 A;  2FU8 A;  3KNS A;  4H0D A;  4XUK A;  1ZTC A;  2OHH A;  2BC2 A;  2OHJ A;  3ADR A;  1XTO A;  4EYF A;  5EV6 A;  3IE1 A;  1WRA A;  4U4L A;  4EY2 A;  3I13 A;  5AXR A;  4RAW A;  4C1F A;  2BTN A;  1M2X A;  4O98 A;  2QDS A;  2P18 A;  5EVK A;  3X2X A;  4C1C A;  2NZF A;  4TZE A;  5AHO A;  5A87 A;  2QJS A;  1WW1 A;  4YSB A;  3DHB A;  4NUR A;  4TYF A;  4JO0 A;  5ACV A;  2H6A A;  5ACS A;  2Y8B A;  3AF5 A;  5ACQ A;  5LS3 A;  1A7T A;  2CFU A;  5EVD A;  3DH8 A;  5AEB A;  2WYM C;  3I11 A;  4EYB A;  4D1V A;  4DIL A;  4AXH A;  1SML A;  4AWZ A;  2FU9 A;  4Z67 A;  2CG3 A;  5FQC A;  4D1T A;  3T3O A;  2UYX A;  4J5F A;  5HIS A;  2WYM A;  3QH8 A;  1VGN A;  2FU7 A;  2AZ4 A;  2E7Y A;  1HLK A;  2FM6 A;  4HL2 A;  4AWY B;  2BMI A;  3I0V A;  3PG4 A;  3FCZ A;  3IE0 A;  4D1W A;  4NQ6 A;  2WHG A;  4EXS A;  2ZZI A;  4UWP B;  3DHA A;  2NYP A;  5LM6 A;  4PDX A;  5HIO A;  1L9Y A;  4C1D A;  5AHR A;  3SD9 A;  2YZ3 A;  4C1E A;  4PVO A;  1DDK A;  5EVB A;  1JJT A;  3TP9 A;  3ZNB A;  2I7V A;  2YHE A;  4GYU A;  2XR1 A;  3RKK A;  4UWO B;  2AIO A;  1DD6 A;  4Z5Y A;  1KO3 A;  3I15 A;  5LMC A;  2YNW A;  5K4N A;  3SFP A;  3S0Z A;  3IOF A;  2R2D A;  5ACU A;  5AIJ A;  2YNT B;  1KO2 A;  4D1U A;  4DIK A;  2Y87 A;  4ZO2 A;  2Q9U A;  2P1E A;  1JT1 A;  3BK1 A;  3BV6 A;  2DKF A;  1Y44 A;  4XWT A;  4Z7R A;  4KEP A;  2NXA A;  2FHX B;  3Q6V A;  5EWA A;  1KR3 A;  4BP0 A;  4FEK A;  5HH6 A;  1X8I A;  5HH5 A;  4KEQ A;  5AYA A;  3G1P A;  2BG6 A;  4NQ5 A;  4EFZ A;  3L6N A;  2BG7 A;  1X8G A;  3SBL A;  1A8T A;  5EHT A;  4FSB A;  4Z6X A;  2HB9 A;  4XWW A;  5A5Z A;  2CBN A;  2GCU A;  5B15 A;  2Q0J A;  5LLD A;  1E5D A;  4YSK A;  4RAM A;  3RKJ A;  2BFZ B;  4GCW A;  2QED A;  4AX1 B;  1YCG A;  4UAM A;  3X2Y A;  3SRX A;  5K4M A;  4YSL A;  3KL7 A;  4WD6 A;  5LCF A;  1BC2 A;  5K4K A;  2GFK A;  4RM5 A;  4C09 A;  3ESH A;  5LE1 A;  4Z60 A; 
#chains in the Genus database with same CATH homology
 4PVT A;  1VJN A;  1ZKP A;  3IOG A;  3AF6 A;  1WUO A;  3H3E A;  1DXK A;  1YCF A;  3ZQ4 A;  5FQB A;  4FR7 A;  2GFJ A;  4TZ9 A;  1QH3 A;  4F6H A;  2BIB A;  1MQO A;  5B3R A;  5FQA A;  2P97 A;  5ACP A;  2FU6 A;  5KIK A;  1JJE A;  1VME A;  4Z5Z A;  3PY6 A;  1P9E A;  5DPX A;  2BG2 A;  4C1H A;  4BZ3 A;  4AD9 A;  3JXP A;  3IE2 A;  3P2U A;  4ZO3 A;  3A4Y A;  3FAI A;  3X2Z A;  2WRS A;  4F6Z A;  3ZR9 A;  1WUP A;  3X30 A;  2Q0I A;  4UWR B;  5EH9 A;  4HL1 A;  1YCH A;  2FK6 A;  2YNT A;  2QDT A;  5LCH A;  2VW8 A;  5LCA A;  4TZF A;  4EYL A;  3I14 A;  2A7M A;  2Y8A A;  5EV8 A;  5ACT A;  5EW0 A;  2FHX A;  4HKY A;  4NQ2 A;  4B87 A;  4RL0 A;  3DHC A;  2M5C A;  4NQ4 A;  5K0W A;  5LSC A;  3PY5 A;  4RBS A;  1BVT A;  3RPC A;  4D02 A;  4UWS B;  5IQK A;  2BFL A;  5ACR A;  2BFK A;  2YCB A;  3IEK A;  2NZE A;  5ACW A;  2GKL A;  5HIP A;  2ZNB A;  2GMN A;  5KIL A;  2BGA A;  5AXO A;  4EXY A;  2WYL A;  3IDZ A;  3IEL A;  3BK2 A;  2I7T A;  4C1G A;  5A0V A;  2BFZ A;  2DOO A;  3ZWF A;  4V0H A;  2ZWR A;  3SPU A;  2BG8 B;  3LVZ A;  4ZNB A;  5B1U A;  2YNU A;  4GYQ A;  1XM8 A;  2BR6 A;  3IEM A;  4UBQ A;  4CHL A;  3AJ3 A;  3T9M A;  4LE6 A;  3VQZ A;  4ZEJ A;  2OHI A;  2P4Z A;  2Q42 A;  3VPE A;  4P62 A;  1ZNB A;  2BG8 A;  2YNV B;  3T3N A;  4RL2 A;  4TZB A;  2M5D A;  2I7X A;  4J5H A;  3KNR A;  3MD7 A;  5HIQ A;  3WXC A;  4UA4 A;  3R2U A;  1X8H A;  3F9O A;  1BMC A;  2ZO4 A;  4TYT A;  3SW3 A;  5A0T A;  1QH5 A;  3BC2 A;  2QIN A;  5ACX A;  5HH4 A;  2YNV A;  4AX0 B;  2XF4 A;  1K07 A;  2FU8 A;  3KNS A;  4H0D A;  4XUK A;  1ZTC A;  2OHH A;  2BC2 A;  2OHJ A;  3ADR A;  1XTO A;  4EYF A;  5EV6 A;  3IE1 A;  1WRA A;  4U4L A;  4EY2 A;  3I13 A;  5AXR A;  4RAW A;  4C1F A;  2BTN A;  1M2X A;  4O98 A;  2QDS A;  2P18 A;  5EVK A;  3X2X A;  4C1C A;  2NZF A;  4TZE A;  5AHO A;  5A87 A;  2QJS A;  1WW1 A;  4YSB A;  3DHB A;  4TYF A;  4JO0 A;  5ACV A;  2H6A A;  5ACS A;  2Y8B A;  3AF5 A;  5ACQ A;  5LS3 A;  1A7T A;  5EVD A;  3DH8 A;  5AEB A;  2WYM C;  3I11 A;  4EYB A;  4D1V A;  4DIL A;  1SML A;  4AWZ A;  2FU9 A;  4Z67 A;  5FQC A;  4D1T A;  3T3O A;  2UYX A;  4J5F A;  5HIS A;  2WYM A;  3QH8 A;  1VGN A;  2FU7 A;  2AZ4 A;  2E7Y A;  1HLK A;  2FM6 A;  4HL2 A;  4AWY B;  2BMI A;  3I0V A;  3PG4 A;  3FCZ A;  3IE0 A;  4D1W A;  4NQ6 A;  2WHG A;  4EXS A;  2ZZI A;  4UWP B;  3DHA A;  2NYP A;  5LM6 A;  5HIO A;  1L9Y A;  4C1D A;  5AHR A;  3SD9 A;  2YZ3 A;  4C1E A;  4PVO A;  1DDK A;  5EVB A;  1JJT A;  3TP9 A;  3ZNB A;  2I7V A;  4GYU A;  2XR1 A;  3RKK A;  4UWO B;  2AIO A;  1DD6 A;  4Z5Y A;  1KO3 A;  3I15 A;  5LMC A;  2YNW A;  5K4N A;  3SFP A;  3S0Z A;  3IOF A;  2R2D A;  5ACU A;  2YNT B;  1KO2 A;  4D1U A;  4DIK A;  2Y87 A;  4ZO2 A;  2Q9U A;  2P1E A;  1JT1 A;  3BK1 A;  3BV6 A;  2DKF A;  1Y44 A;  4XWT A;  4Z7R A;  4KEP A;  2NXA A;  2FHX B;  3Q6V A;  5EWA A;  1KR3 A;  4BP0 A;  4FEK A;  5HH6 A;  1X8I A;  5HH5 A;  4KEQ A;  5AYA A;  3G1P A;  2BG6 A;  4NQ5 A;  4EFZ A;  3L6N A;  2BG7 A;  1X8G A;  3SBL A;  1A8T A;  5EHT A;  4FSB A;  4Z6X A;  2HB9 A;  4XWW A;  5A5Z A;  2CBN A;  2GCU A;  5B15 A;  2Q0J A;  5LLD A;  1E5D A;  4YSK A;  4RAM A;  3RKJ A;  2BFZ B;  4GCW A;  2QED A;  4AX1 B;  1YCG A;  4UAM A;  3X2Y A;  3SRX A;  5K4M A;  4YSL A;  3KL7 A;  4WD6 A;  5LCF A;  1BC2 A;  5K4K A;  2GFK A;  4RM5 A;  4C09 A;  3ESH A;  5LE1 A;  4Z60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...