3X2YA

Crystal structure of metallo-beta-lactamase h8a from thermotoga maritima
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
227
structure length
227
Chain Sequence
GMKVTFLGAAVVLIEGKKNIIIDPFISGNPVCPVKLEGLPKIDYILVTHGHGDHLGDAVEIAKKNDATVISNYEICHYLGKKGVKTHAMHIGGSYLFDFGRVKMTPAVHGSGILDGDSMIYGGNPSGFLITIEGKKIYHAGDTGLTREMELLAEENVDVAFLPIGGNFVMDVEDAVRAAVMIKPKKVVPMHYGTWELIFADVELFKKKVEEKGVECVILEPGESLEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords UPF0173 metal-dependent hydrolase TM_1162
publication title Crystal structure of metallo-beta-lactamase H8A from Thermotoga maritima
rcsb
source organism Thermotoga maritima msb8
total genus 61
structure length 227
sequence length 227
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3x2yA00
3X2XA 2QJSA 5ACQA 1X8HA 4D1UA 4EYFA 1KO3A 4Z5YA 2A7MA 2WRSA 4RL0A 2FK6A 1WUOA 4XWTA 5FQBA 2OHHA 2BFZA 3I11A 4NQ2A 4BZ3A 4RL2A 5DPXA 3KL7A 5AEBA 5AXRA 3SPUA 4GYUA 1VJNA 3L6NA 2YNVA 5ACXA 5ACRA 2WYMC 3F9OA 3SFPA 2GFJA 5ACUA 3SW3A 3AF5A 4UWOB 4AWYB 2QDSA 5HIQA 5AXOA 2GCUA 3IOGA 4C1CA 2BIBA 4HL2A 2I7XA 4C1EA 4V0HA 2NXAA 4AX0B 2FHXB 4D02A 4Z6XA 3IE0A 2BC2A 3ZQ4A 5LCHA 4UWRB 4Z60A 4EFZA 2AZ4A 4KEPA 3A4YA 1VGNA 2Y87A 3RKJA 5ACPA 2I7VA 2R2DA 5LS3A 1BVTA 3DHAA 1DD6A 3TP9A 4RAWA 5FQAA 2Q9UA 2BG6A 5EVBA 4JO0A 3T9MA 3DH8A 4UAMA 1BMCA 4C1GA 2BMIA 4PVOA 5EWAA 4Z67A 1MQOA 3MD7A 2YNTB 1QH5A 4ZO2A 2WYMA 3H3EA 3I14A 1X8IA 3IOFA 3SRXA 3Q6VA 5HH6A 2YNUA 4EXSA 2Y8BA 2ZNBA 3DHCA 1YCGA 1BC2A 5HH5A 1KR3A 4EYLA 5ACVA 1Y44A 4B87A 4F6ZA 5EV6A 2UYXA 5ACTA 2WYLA 2BG7A 2XF4A 3JXPA 5HISA 2H6AA 4TZBA 2P97A 5FQCA 3RKKA 3G1PA 2BGAA 5HIOA 4RBSA 3IEKA 1JT1A 2BTNA 2Y8AA 3X2ZA 3S0ZA 4WD6A 2NZEA 2Q0JA 5AHRA 2I7TA 4F6HA 1A8TA 5LSCA 3ZR9A 4C09A 3I0VA 5HIPA 3P2UA 4FSBA 4HKYA 5AHOA 1X8GA 1SMLA 3T3OA 1DXKA 5K4NA 5AYAA 5LLDA 4TZEA 4UWSB 5LE1A 4XWWA 3ZNBA 2GMNA 4AD9A 4O98A 3FAIA 5ACSA 2FU7A 2YCBA 4EYBA 2OHJA 2P1EA 4ZO3A 2P18A 2NYPA 3DHBA 1K07A 2BG8A 3SD9A 5HH4A 2BFZB 4LE6A 2E7YA 4KEQA 1P9EA 4UWPB 4C1FA 5A87A 2NZFA 4RAMA 1L9YA 5ACWA 4ZNBA 3BK2A 4D1TA 4GYQA 4C1HA 5K0WA 2YNVB 5A0VA 2FM6A 5LCFA 2Q0IA 2OHIA 4YSKA 5LMCA 4Z7RA 1WRAA 2ZZIA 1A7TA 1VMEA 4C1DA 4ZEJA 3IDZA 2DOOA 3X2YA 4AWZA 5B15A 3BK1A 5KILA 2GFKA 4EY2A 1XTOA 1WUPA 2ZWRA 2BFLA 1WW1A 3I15A 2CBNA 1M2XA 1ZKPA 5EW0A 4U4LA 2DKFA 3AJ3A 3VQZA 4P62A 5A0TA 5EVDA 3ADRA 3IE1A 2WHGA 3RPCA 3PY6A 2QINA 2Q42A 2FU9A 2BR6A 4HL1A 2BG8B 4PVTA 2QEDA 3ZWFA 2FU8A 4TYTA 4UBQA 4J5HA 1ZTCA 5B3RA 4DIKA 2QDTA 3KNRA 4Z5ZA 4EXYA 2YNTA 2M5CA 4FR7A 4RM5A 1JJTA 1E5DA 2YZ3A 4CHLA 5B1UA 4D1WA 4YSBA 3WXCA 2BG2A 5A5ZA 1YCHA 5K4MA 4DILA 3BC2A 4TZFA 2AIOA 3IELA 5LM6A 2YNWA 5EV8A 4NQ6A 2FU6A 2HB9A 4XUKA 3IE2A 3BV6A 3IEMA 2P4ZA 3X30A 4UA4A 3PG4A 3FCZA 2XR1A 4TYFA 3ESHA 2M5DA 3KNSA 4YSLA 4TZ9A 5EHTA 4J5FA 2VW8A 3T3NA 3LVZA 1YCFA 5EH9A 4H0DA 3PY5A 2BFKA 5IQKA 4AX1B 5K4KA 5KIKA 1DDKA 1QH3A 4FEKA 3SBLA 4GCWA 4NQ5A 3AF6A 1HLKA 1XM8A 5EVKA 1JJEA 2GKLA 3R2UA 1KO2A 2FHXA 4NQ4A 4BP0A 5LCAA 4D1VA 1ZNBA 2ZO4A 3VPEA 3QH8A 3I13A
chains in the Genus database with same CATH superfamily
3X2XA 2QJSA 5ACQA 1X8HA 4D1UA 4EYFA 1KO3A 4Z5YA 2A7MA 2WRSA 4RL0A 2FK6A 1WUOA 4XWTA 5FQBA 2OHHA 2BFZA 3I11A 4NQ2A 4BZ3A 4RL2A 5DPXA 3KL7A 5AEBA 5AXRA 3SPUA 4GYUA 1VJNA 3L6NA 2YNVA 5ACXA 5ACRA 2WYMC 3F9OA 3SFPA 2YHEA 2GFJA 5ACUA 3SW3A 4PDXA 3AF5A 4UWOB 4AWYB 2QDSA 5HIQA 5AXOA 2GCUA 3IOGA 4C1CA 2BIBA 4HL2A 2I7XA 4C1EA 4V0HA 2NXAA 4AX0B 2FHXB 4D02A 4Z6XA 3IE0A 2BC2A 3ZQ4A 5LCHA 4UWRB 4Z60A 4EFZA 2AZ4A 4KEPA 3A4YA 1VGNA 2Y87A 3RKJA 5ACPA 2I7VA 2R2DA 5LS3A 1BVTA 3DHAA 1DD6A 3TP9A 5FQAA 4NURA 4RAWA 2Q9UA 2BG6A 5EVBA 4JO0A 3T9MA 3DH8A 4UAMA 1BMCA 4C1GA 2BMIA 4PVOA 5EWAA 4Z67A 1MQOA 3MD7A 2YNTB 1QH5A 4AV7A 4ZO2A 2WYMA 3H3EA 3I14A 1X8IA 3IOFA 3SRXA 3Q6VA 5HH6A 2YNUA 4EXSA 2Y8BA 2ZNBA 3DHCA 1YCGA 1BC2A 5HH5A 1KR3A 4EYLA 5ACVA 1Y44A 4B87A 4F6ZA 5EV6A 2UYXA 5ACTA 2WYLA 2BG7A 2XF4A 3JXPA 5HISA 2H6AA 4TZBA 2P97A 5FQCA 3RKKA 3G1PA 2BGAA 5HIOA 4RBSA 3IEKA 1JT1A 2BTNA 2Y8AA 3X2ZA 3S0ZA 4WD6A 2NZEA 2Q0JA 5AHRA 2I7TA 4F6HA 1A8TA 5LSCA 3ZR9A 4C09A 3I0VA 5HIPA 3P2UA 4FSBA 4HKYA 5AHOA 1X8GA 1SMLA 3T3OA 1DXKA 5K4NA 5AYAA 5LLDA 4TZEA 4UWSB 5LE1A 4XWWA 3ZNBA 2GMNA 4AD9A 4O98A 3FAIA 5ACSA 2FU7A 2YCBA 4EYBA 2OHJA 2P1EA 4ZO3A 2P18A 2NYPA 3DHBA 1K07A 2BG8A 3SD9A 5HH4A 2BFZB 4LE6A 2E7YA 4KEQA 1P9EA 4UWPB 4C1FA 5A87A 2NZFA 4RAMA 1L9YA 5ACWA 4ZNBA 3BK2A 4D1TA 4GYQA 4C1HA 5K0WA 2YNVB 5A0VA 2FM6A 5LCFA 2CG2A 2Q0IA 2OHIA 4YSKA 5LMCA 4Z7RA 1WRAA 2ZZIA 1A7TA 1VMEA 4C1DA 4ZEJA 3IDZA 2DOOA 3X2YA 4AWZA 5B15A 3BK1A 5KILA 2GFKA 4EY2A 1XTOA 1WUPA 2ZWRA 2BFLA 1WW1A 3I15A 2CBNA 1M2XA 1ZKPA 5EW0A 4U4LA 2CG3A 2DKFA 3AJ3A 3VQZA 4P62A 5A0TA 5EVDA 3ADRA 3IE1A 2WHGA 3RPCA 3PY6A 2QINA 2Q42A 5A23A 2FU9A 2BR6A 4HL1A 2BG8B 4PVTA 2QEDA 3ZWFA 2FU8A 4TYTA 4UBQA 4J5HA 1ZTCA 5B3RA 4DIKA 2QDTA 3KNRA 4Z5ZA 4EXYA 2YNTA 2M5CA 4FR7A 4RM5A 5AIJA 1JJTA 1E5DA 2YZ3A 4CHLA 5B1UA 4D1WA 4YSBA 3WXCA 2BG2A 5A5ZA 1YCHA 5K4MA 4DILA 2CFZA 3BC2A 4TZFA 2AIOA 3IELA 5LM6A 2YNWA 5EV8A 4NQ6A 2FU6A 2HB9A 4XUKA 3IE2A 3BV6A 3IEMA 2P4ZA 3X30A 5AJLA 4UA4A 3PG4A 3FCZA 4AXHA 2XR1A 4TYFA 3ESHA 2M5DA 3KNSA 4YSLA 4TZ9A 5EHTA 4J5FA 2VW8A 3T3NA 3LVZA 1YCFA 5EH9A 4H0DA 3PY5A 2BFKA 5IQKA 4AX1B 5K4KA 5KIKA 1DDKA 1QH3A 4FEKA 3SBLA 2CFUA 4GCWA 4NQ5A 3AF6A 1HLKA 1XM8A 5EVKA 1JJEA 2GKLA 3R2UA 1KO2A 2FHXA 4NQ4A 4BP0A 5LCAA 4D1VA 1ZNBA 2ZO4A 3VPEA 3QH8A 3I13A
chains in the Genus database with same CATH topology
3X2XA 2QJSA 5ACQA 1X8HA 4D1UA 4EYFA 1KO3A 4Z5YA 2A7MA 2WRSA 4RL0A 2FK6A 1WUOA 4XWTA 5FQBA 2OHHA 2BFZA 3I11A 4NQ2A 4BZ3A 4RL2A 5DPXA 3KL7A 5AEBA 5AXRA 3SPUA 4GYUA 1VJNA 3L6NA 2YNVA 5ACXA 5ACRA 2WYMC 3F9OA 3SFPA 2GFJA 5ACUA 3SW3A 3AF5A 4UWOB 4AWYB 2QDSA 5HIQA 5AXOA 2GCUA 3IOGA 4C1CA 2BIBA 4HL2A 2I7XA 4C1EA 4V0HA 2NXAA 4AX0B 2FHXB 4D02A 4Z6XA 3IE0A 2BC2A 3ZQ4A 5LCHA 4UWRB 4Z60A 4EFZA 2AZ4A 4KEPA 3A4YA 1VGNA 2Y87A 3RKJA 5ACPA 2I7VA 2R2DA 5LS3A 1BVTA 3DHAA 1DD6A 3TP9A 4RAWA 5FQAA 2Q9UA 2BG6A 5EVBA 4JO0A 3T9MA 3DH8A 4UAMA 1BMCA 4C1GA 2BMIA 4PVOA 5EWAA 4Z67A 1MQOA 3MD7A 2YNTB 1QH5A 4ZO2A 2WYMA 3H3EA 3I14A 1X8IA 3IOFA 3SRXA 3Q6VA 5HH6A 2YNUA 4EXSA 2Y8BA 2ZNBA 3DHCA 1YCGA 1BC2A 5HH5A 1KR3A 4EYLA 5ACVA 1Y44A 4B87A 4F6ZA 5EV6A 2UYXA 5ACTA 2WYLA 2BG7A 2XF4A 3JXPA 5HISA 2H6AA 4TZBA 2P97A 5FQCA 3RKKA 3G1PA 2BGAA 5HIOA 4RBSA 3IEKA 1JT1A 2BTNA 2Y8AA 3X2ZA 3S0ZA 4WD6A 2NZEA 2Q0JA 5AHRA 2I7TA 4F6HA 1A8TA 5LSCA 3ZR9A 4C09A 3I0VA 5HIPA 3P2UA 4FSBA 4HKYA 5AHOA 1X8GA 1SMLA 3T3OA 1DXKA 5K4NA 5AYAA 5LLDA 4TZEA 4UWSB 5LE1A 4XWWA 3ZNBA 2GMNA 4AD9A 4O98A 3FAIA 5ACSA 2FU7A 2YCBA 4EYBA 2OHJA 2P1EA 4ZO3A 2P18A 2NYPA 3DHBA 1K07A 2BG8A 3SD9A 5HH4A 2BFZB 4LE6A 2E7YA 4KEQA 1P9EA 4UWPB 4C1FA 5A87A 2NZFA 4RAMA 1L9YA 5ACWA 4ZNBA 3BK2A 4D1TA 4GYQA 4C1HA 5K0WA 2YNVB 5A0VA 2FM6A 5LCFA 2Q0IA 2OHIA 4YSKA 5LMCA 4Z7RA 1WRAA 2ZZIA 1A7TA 1VMEA 4C1DA 4ZEJA 3IDZA 2DOOA 3X2YA 4AWZA 5B15A 3BK1A 5KILA 2GFKA 4EY2A 1XTOA 1WUPA 2ZWRA 2BFLA 1WW1A 3I15A 2CBNA 1M2XA 1ZKPA 5EW0A 4U4LA 2DKFA 3AJ3A 3VQZA 4P62A 5A0TA 5EVDA 3ADRA 3IE1A 2WHGA 3RPCA 3PY6A 2QINA 2Q42A 2FU9A 2BR6A 4HL1A 2BG8B 4PVTA 2QEDA 3ZWFA 2FU8A 4TYTA 4UBQA 4J5HA 1ZTCA 5B3RA 4DIKA 2QDTA 3KNRA 4Z5ZA 4EXYA 2YNTA 2M5CA 4FR7A 4RM5A 1JJTA 1E5DA 2YZ3A 4CHLA 5B1UA 4D1WA 4YSBA 3WXCA 2BG2A 5A5ZA 1YCHA 5K4MA 4DILA 3BC2A 4TZFA 2AIOA 3IELA 5LM6A 2YNWA 5EV8A 4NQ6A 2FU6A 2HB9A 4XUKA 3IE2A 3BV6A 3IEMA 2P4ZA 3X30A 4UA4A 3PG4A 3FCZA 2XR1A 4TYFA 3ESHA 2M5DA 3KNSA 4YSLA 4TZ9A 5EHTA 4J5FA 2VW8A 3T3NA 3LVZA 1YCFA 5EH9A 4H0DA 3PY5A 2BFKA 5IQKA 4AX1B 5K4KA 5KIKA 1DDKA 1QH3A 4FEKA 3SBLA 4GCWA 4NQ5A 3AF6A 1HLKA 1XM8A 5EVKA 1JJEA 2GKLA 3R2UA 1KO2A 2FHXA 4NQ4A 4BP0A 5LCAA 4D1VA 1ZNBA 2ZO4A 3VPEA 3QH8A 3I13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X2X A;  2QJS A;  5ACQ A;  1X8H A;  4D1U A;  4EYF A;  1KO3 A;  4Z5Y A;  2A7M A;  2WRS A;  4RL0 A;  2FK6 A;  1WUO A;  4XWT A;  5FQB A;  2OHH A;  2BFZ A;  3I11 A;  4NQ2 A;  4BZ3 A;  4RL2 A;  5DPX A;  3KL7 A;  5AEB A;  5AXR A;  3SPU A;  4GYU A;  1VJN A;  3L6N A;  2YNV A;  5ACX A;  5ACR A;  2WYM C;  3F9O A;  3SFP A;  2GFJ A;  5ACU A;  3SW3 A;  3AF5 A;  4UWO B;  4AWY B;  2QDS A;  5HIQ A;  5AXO A;  2GCU A;  3IOG A;  4C1C A;  2BIB A;  4HL2 A;  2I7X A;  4C1E A;  4V0H A;  2NXA A;  4AX0 B;  2FHX B;  4D02 A;  4Z6X A;  3IE0 A;  2BC2 A;  3ZQ4 A;  5LCH A;  4UWR B;  4Z60 A;  4EFZ A;  2AZ4 A;  4KEP A;  3A4Y A;  1VGN A;  2Y87 A;  3RKJ A;  5ACP A;  2I7V A;  2R2D A;  5LS3 A;  1BVT A;  3DHA A;  1DD6 A;  3TP9 A;  4RAW A;  5FQA A;  2Q9U A;  2BG6 A;  5EVB A;  4JO0 A;  3T9M A;  3DH8 A;  4UAM A;  1BMC A;  4C1G A;  2BMI A;  4PVO A;  5EWA A;  4Z67 A;  1MQO A;  3MD7 A;  2YNT B;  1QH5 A;  4ZO2 A;  2WYM A;  3H3E A;  3I14 A;  1X8I A;  3IOF A;  3SRX A;  3Q6V A;  5HH6 A;  2YNU A;  4EXS A;  2Y8B A;  2ZNB A;  3DHC A;  1YCG A;  1BC2 A;  5HH5 A;  1KR3 A;  4EYL A;  5ACV A;  1Y44 A;  4B87 A;  4F6Z A;  5EV6 A;  2UYX A;  5ACT A;  2WYL A;  2BG7 A;  2XF4 A;  3JXP A;  5HIS A;  2H6A A;  4TZB A;  2P97 A;  5FQC A;  3RKK A;  3G1P A;  2BGA A;  5HIO A;  4RBS A;  3IEK A;  1JT1 A;  2BTN A;  2Y8A A;  3X2Z A;  3S0Z A;  4WD6 A;  2NZE A;  2Q0J A;  5AHR A;  2I7T A;  4F6H A;  1A8T A;  5LSC A;  3ZR9 A;  4C09 A;  3I0V A;  5HIP A;  3P2U A;  4FSB A;  4HKY A;  5AHO A;  1X8G A;  1SML A;  3T3O A;  1DXK A;  5K4N A;  5AYA A;  5LLD A;  4TZE A;  4UWS B;  5LE1 A;  4XWW A;  3ZNB A;  2GMN A;  4AD9 A;  4O98 A;  3FAI A;  5ACS A;  2FU7 A;  2YCB A;  4EYB A;  2OHJ A;  2P1E A;  4ZO3 A;  2P18 A;  2NYP A;  3DHB A;  1K07 A;  2BG8 A;  3SD9 A;  5HH4 A;  2BFZ B;  4LE6 A;  2E7Y A;  4KEQ A;  1P9E A;  4UWP B;  4C1F A;  5A87 A;  2NZF A;  4RAM A;  1L9Y A;  5ACW A;  4ZNB A;  3BK2 A;  4D1T A;  4GYQ A;  4C1H A;  5K0W A;  2YNV B;  5A0V A;  2FM6 A;  5LCF A;  2Q0I A;  2OHI A;  4YSK A;  5LMC A;  4Z7R A;  1WRA A;  2ZZI A;  1A7T A;  1VME A;  4C1D A;  4ZEJ A;  3IDZ A;  2DOO A;  3X2Y A;  4AWZ A;  5B15 A;  3BK1 A;  5KIL A;  2GFK A;  4EY2 A;  1XTO A;  1WUP A;  2ZWR A;  2BFL A;  1WW1 A;  3I15 A;  2CBN A;  1M2X A;  1ZKP A;  5EW0 A;  4U4L A;  2DKF A;  3AJ3 A;  3VQZ A;  4P62 A;  5A0T A;  5EVD A;  3ADR A;  3IE1 A;  2WHG A;  3RPC A;  3PY6 A;  2QIN A;  2Q42 A;  2FU9 A;  2BR6 A;  4HL1 A;  2BG8 B;  4PVT A;  2QED A;  3ZWF A;  2FU8 A;  4TYT A;  4UBQ A;  4J5H A;  1ZTC A;  5B3R A;  4DIK A;  2QDT A;  3KNR A;  4Z5Z A;  4EXY A;  2YNT A;  2M5C A;  4FR7 A;  4RM5 A;  1JJT A;  1E5D A;  2YZ3 A;  4CHL A;  5B1U A;  4D1W A;  4YSB A;  3WXC A;  2BG2 A;  5A5Z A;  1YCH A;  5K4M A;  4DIL A;  3BC2 A;  4TZF A;  2AIO A;  3IEL A;  5LM6 A;  2YNW A;  5EV8 A;  4NQ6 A;  2FU6 A;  2HB9 A;  4XUK A;  3IE2 A;  3BV6 A;  3IEM A;  2P4Z A;  3X30 A;  4UA4 A;  3PG4 A;  3FCZ A;  2XR1 A;  4TYF A;  3ESH A;  2M5D A;  3KNS A;  4YSL A;  4TZ9 A;  5EHT A;  4J5F A;  2VW8 A;  3T3N A;  3LVZ A;  1YCF A;  5EH9 A;  4H0D A;  3PY5 A;  2BFK A;  5IQK A;  4AX1 B;  5K4K A;  5KIK A;  1DDK A;  1QH3 A;  4FEK A;  3SBL A;  4GCW A;  4NQ5 A;  3AF6 A;  1HLK A;  1XM8 A;  5EVK A;  1JJE A;  2GKL A;  3R2U A;  1KO2 A;  2FHX A;  4NQ4 A;  4BP0 A;  5LCA A;  4D1V A;  1ZNB A;  2ZO4 A;  3VPE A;  3QH8 A;  3I13 A; 
#chains in the Genus database with same CATH topology
 3X2X A;  2QJS A;  5ACQ A;  1X8H A;  4D1U A;  4EYF A;  1KO3 A;  4Z5Y A;  2A7M A;  2WRS A;  4RL0 A;  2FK6 A;  1WUO A;  4XWT A;  5FQB A;  2OHH A;  2BFZ A;  3I11 A;  4NQ2 A;  4BZ3 A;  4RL2 A;  5DPX A;  3KL7 A;  5AEB A;  5AXR A;  3SPU A;  4GYU A;  1VJN A;  3L6N A;  2YNV A;  5ACX A;  5ACR A;  2WYM C;  3F9O A;  3SFP A;  2YHE A;  2GFJ A;  5ACU A;  3SW3 A;  4PDX A;  3AF5 A;  4UWO B;  4AWY B;  2QDS A;  5HIQ A;  5AXO A;  2GCU A;  3IOG A;  4C1C A;  2BIB A;  4HL2 A;  2I7X A;  4C1E A;  4V0H A;  2NXA A;  4AX0 B;  2FHX B;  4D02 A;  4Z6X A;  3IE0 A;  2BC2 A;  3ZQ4 A;  5LCH A;  4UWR B;  4Z60 A;  4EFZ A;  2AZ4 A;  4KEP A;  3A4Y A;  1VGN A;  2Y87 A;  3RKJ A;  5ACP A;  2I7V A;  2R2D A;  5LS3 A;  1BVT A;  3DHA A;  1DD6 A;  3TP9 A;  5FQA A;  4NUR A;  4RAW A;  2Q9U A;  2BG6 A;  5EVB A;  4JO0 A;  3T9M A;  3DH8 A;  4UAM A;  1BMC A;  4C1G A;  2BMI A;  4PVO A;  5EWA A;  4Z67 A;  1MQO A;  3MD7 A;  2YNT B;  1QH5 A;  4AV7 A;  4ZO2 A;  2WYM A;  3H3E A;  3I14 A;  1X8I A;  3IOF A;  3SRX A;  3Q6V A;  5HH6 A;  2YNU A;  4EXS A;  2Y8B A;  2ZNB A;  3DHC A;  1YCG A;  1BC2 A;  5HH5 A;  1KR3 A;  4EYL A;  5ACV A;  1Y44 A;  4B87 A;  4F6Z A;  5EV6 A;  2UYX A;  5ACT A;  2WYL A;  2BG7 A;  2XF4 A;  3JXP A;  5HIS A;  2H6A A;  4TZB A;  2P97 A;  5FQC A;  3RKK A;  3G1P A;  2BGA A;  5HIO A;  4RBS A;  3IEK A;  1JT1 A;  2BTN A;  2Y8A A;  3X2Z A;  3S0Z A;  4WD6 A;  2NZE A;  2Q0J A;  5AHR A;  2I7T A;  4F6H A;  1A8T A;  5LSC A;  3ZR9 A;  4C09 A;  3I0V A;  5HIP A;  3P2U A;  4FSB A;  4HKY A;  5AHO A;  1X8G A;  1SML A;  3T3O A;  1DXK A;  5K4N A;  5AYA A;  5LLD A;  4TZE A;  4UWS B;  5LE1 A;  4XWW A;  3ZNB A;  2GMN A;  4AD9 A;  4O98 A;  3FAI A;  5ACS A;  2FU7 A;  2YCB A;  4EYB A;  2OHJ A;  2P1E A;  4ZO3 A;  2P18 A;  2NYP A;  3DHB A;  1K07 A;  2BG8 A;  3SD9 A;  5HH4 A;  2BFZ B;  4LE6 A;  2E7Y A;  4KEQ A;  1P9E A;  4UWP B;  4C1F A;  5A87 A;  2NZF A;  4RAM A;  1L9Y A;  5ACW A;  4ZNB A;  3BK2 A;  4D1T A;  4GYQ A;  4C1H A;  5K0W A;  2YNV B;  5A0V A;  2FM6 A;  5LCF A;  2CG2 A;  2Q0I A;  2OHI A;  4YSK A;  5LMC A;  4Z7R A;  1WRA A;  2ZZI A;  1A7T A;  1VME A;  4C1D A;  4ZEJ A;  3IDZ A;  2DOO A;  3X2Y A;  4AWZ A;  5B15 A;  3BK1 A;  5KIL A;  2GFK A;  4EY2 A;  1XTO A;  1WUP A;  2ZWR A;  2BFL A;  1WW1 A;  3I15 A;  2CBN A;  1M2X A;  1ZKP A;  5EW0 A;  4U4L A;  2CG3 A;  2DKF A;  3AJ3 A;  3VQZ A;  4P62 A;  5A0T A;  5EVD A;  3ADR A;  3IE1 A;  2WHG A;  3RPC A;  3PY6 A;  2QIN A;  2Q42 A;  5A23 A;  2FU9 A;  2BR6 A;  4HL1 A;  2BG8 B;  4PVT A;  2QED A;  3ZWF A;  2FU8 A;  4TYT A;  4UBQ A;  4J5H A;  1ZTC A;  5B3R A;  4DIK A;  2QDT A;  3KNR A;  4Z5Z A;  4EXY A;  2YNT A;  2M5C A;  4FR7 A;  4RM5 A;  5AIJ A;  1JJT A;  1E5D A;  2YZ3 A;  4CHL A;  5B1U A;  4D1W A;  4YSB A;  3WXC A;  2BG2 A;  5A5Z A;  1YCH A;  5K4M A;  4DIL A;  2CFZ A;  3BC2 A;  4TZF A;  2AIO A;  3IEL A;  5LM6 A;  2YNW A;  5EV8 A;  4NQ6 A;  2FU6 A;  2HB9 A;  4XUK A;  3IE2 A;  3BV6 A;  3IEM A;  2P4Z A;  3X30 A;  5AJL A;  4UA4 A;  3PG4 A;  3FCZ A;  4AXH A;  2XR1 A;  4TYF A;  3ESH A;  2M5D A;  3KNS A;  4YSL A;  4TZ9 A;  5EHT A;  4J5F A;  2VW8 A;  3T3N A;  3LVZ A;  1YCF A;  5EH9 A;  4H0D A;  3PY5 A;  2BFK A;  5IQK A;  4AX1 B;  5K4K A;  5KIK A;  1DDK A;  1QH3 A;  4FEK A;  3SBL A;  2CFU A;  4GCW A;  4NQ5 A;  3AF6 A;  1HLK A;  1XM8 A;  5EVK A;  1JJE A;  2GKL A;  3R2U A;  1KO2 A;  2FHX A;  4NQ4 A;  4BP0 A;  5LCA A;  4D1V A;  1ZNB A;  2ZO4 A;  3VPE A;  3QH8 A;  3I13 A; 
#chains in the Genus database with same CATH homology
 3X2X A;  2QJS A;  5ACQ A;  1X8H A;  4D1U A;  4EYF A;  1KO3 A;  4Z5Y A;  2A7M A;  2WRS A;  4RL0 A;  2FK6 A;  1WUO A;  4XWT A;  5FQB A;  2OHH A;  2BFZ A;  3I11 A;  4NQ2 A;  4BZ3 A;  4RL2 A;  5DPX A;  3KL7 A;  5AEB A;  5AXR A;  3SPU A;  4GYU A;  1VJN A;  3L6N A;  2YNV A;  5ACX A;  5ACR A;  2WYM C;  3F9O A;  3SFP A;  2GFJ A;  5ACU A;  3SW3 A;  3AF5 A;  4UWO B;  4AWY B;  2QDS A;  5HIQ A;  5AXO A;  2GCU A;  3IOG A;  4C1C A;  2BIB A;  4HL2 A;  2I7X A;  4C1E A;  4V0H A;  2NXA A;  4AX0 B;  2FHX B;  4D02 A;  4Z6X A;  3IE0 A;  2BC2 A;  3ZQ4 A;  5LCH A;  4UWR B;  4Z60 A;  4EFZ A;  2AZ4 A;  4KEP A;  3A4Y A;  1VGN A;  2Y87 A;  3RKJ A;  5ACP A;  2I7V A;  2R2D A;  5LS3 A;  1BVT A;  3DHA A;  1DD6 A;  3TP9 A;  4RAW A;  5FQA A;  2Q9U A;  2BG6 A;  5EVB A;  4JO0 A;  3T9M A;  3DH8 A;  4UAM A;  1BMC A;  4C1G A;  2BMI A;  4PVO A;  5EWA A;  4Z67 A;  1MQO A;  3MD7 A;  2YNT B;  1QH5 A;  4ZO2 A;  2WYM A;  3H3E A;  3I14 A;  1X8I A;  3IOF A;  3SRX A;  3Q6V A;  5HH6 A;  2YNU A;  4EXS A;  2Y8B A;  2ZNB A;  3DHC A;  1YCG A;  1BC2 A;  5HH5 A;  1KR3 A;  4EYL A;  5ACV A;  1Y44 A;  4B87 A;  4F6Z A;  5EV6 A;  2UYX A;  5ACT A;  2WYL A;  2BG7 A;  2XF4 A;  3JXP A;  5HIS A;  2H6A A;  4TZB A;  2P97 A;  5FQC A;  3RKK A;  3G1P A;  2BGA A;  5HIO A;  4RBS A;  3IEK A;  1JT1 A;  2BTN A;  2Y8A A;  3X2Z A;  3S0Z A;  4WD6 A;  2NZE A;  2Q0J A;  5AHR A;  2I7T A;  4F6H A;  1A8T A;  5LSC A;  3ZR9 A;  4C09 A;  3I0V A;  5HIP A;  3P2U A;  4FSB A;  4HKY A;  5AHO A;  1X8G A;  1SML A;  3T3O A;  1DXK A;  5K4N A;  5AYA A;  5LLD A;  4TZE A;  4UWS B;  5LE1 A;  4XWW A;  3ZNB A;  2GMN A;  4AD9 A;  4O98 A;  3FAI A;  5ACS A;  2FU7 A;  2YCB A;  4EYB A;  2OHJ A;  2P1E A;  4ZO3 A;  2P18 A;  2NYP A;  3DHB A;  1K07 A;  2BG8 A;  3SD9 A;  5HH4 A;  2BFZ B;  4LE6 A;  2E7Y A;  4KEQ A;  1P9E A;  4UWP B;  4C1F A;  5A87 A;  2NZF A;  4RAM A;  1L9Y A;  5ACW A;  4ZNB A;  3BK2 A;  4D1T A;  4GYQ A;  4C1H A;  5K0W A;  2YNV B;  5A0V A;  2FM6 A;  5LCF A;  2Q0I A;  2OHI A;  4YSK A;  5LMC A;  4Z7R A;  1WRA A;  2ZZI A;  1A7T A;  1VME A;  4C1D A;  4ZEJ A;  3IDZ A;  2DOO A;  3X2Y A;  4AWZ A;  5B15 A;  3BK1 A;  5KIL A;  2GFK A;  4EY2 A;  1XTO A;  1WUP A;  2ZWR A;  2BFL A;  1WW1 A;  3I15 A;  2CBN A;  1M2X A;  1ZKP A;  5EW0 A;  4U4L A;  2DKF A;  3AJ3 A;  3VQZ A;  4P62 A;  5A0T A;  5EVD A;  3ADR A;  3IE1 A;  2WHG A;  3RPC A;  3PY6 A;  2QIN A;  2Q42 A;  2FU9 A;  2BR6 A;  4HL1 A;  2BG8 B;  4PVT A;  2QED A;  3ZWF A;  2FU8 A;  4TYT A;  4UBQ A;  4J5H A;  1ZTC A;  5B3R A;  4DIK A;  2QDT A;  3KNR A;  4Z5Z A;  4EXY A;  2YNT A;  2M5C A;  4FR7 A;  4RM5 A;  1JJT A;  1E5D A;  2YZ3 A;  4CHL A;  5B1U A;  4D1W A;  4YSB A;  3WXC A;  2BG2 A;  5A5Z A;  1YCH A;  5K4M A;  4DIL A;  3BC2 A;  4TZF A;  2AIO A;  3IEL A;  5LM6 A;  2YNW A;  5EV8 A;  4NQ6 A;  2FU6 A;  2HB9 A;  4XUK A;  3IE2 A;  3BV6 A;  3IEM A;  2P4Z A;  3X30 A;  4UA4 A;  3PG4 A;  3FCZ A;  2XR1 A;  4TYF A;  3ESH A;  2M5D A;  3KNS A;  4YSL A;  4TZ9 A;  5EHT A;  4J5F A;  2VW8 A;  3T3N A;  3LVZ A;  1YCF A;  5EH9 A;  4H0D A;  3PY5 A;  2BFK A;  5IQK A;  4AX1 B;  5K4K A;  5KIK A;  1DDK A;  1QH3 A;  4FEK A;  3SBL A;  4GCW A;  4NQ5 A;  3AF6 A;  1HLK A;  1XM8 A;  5EVK A;  1JJE A;  2GKL A;  3R2U A;  1KO2 A;  2FHX A;  4NQ4 A;  4BP0 A;  5LCA A;  4D1V A;  1ZNB A;  2ZO4 A;  3VPE A;  3QH8 A;  3I13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...