3X2YA

Crystal structure of metallo-beta-lactamase h8a from thermotoga maritima
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
227
structure length
227
Chain Sequence
GMKVTFLGAAVVLIEGKKNIIIDPFISGNPVCPVKLEGLPKIDYILVTHGHGDHLGDAVEIAKKNDATVISNYEICHYLGKKGVKTHAMHIGGSYLFDFGRVKMTPAVHGSGILDGDSMIYGGNPSGFLITIEGKKIYHAGDTGLTREMELLAEENVDVAFLPIGGNFVMDVEDAVRAAVMIKPKKVVPMHYGTWELIFADVELFKKKVEEKGVECVILEPGESLEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of metallo-beta-lactamase H8A from Thermotoga maritima
rcsb
source organism Thermotoga maritima msb8
molecule tags Hydrolase
molecule keywords UPF0173 metal-dependent hydrolase TM_1162
total genus 61
structure length 227
sequence length 227
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3x2yA00
2BFLA 3R2UA 3ZR9A 4BZ3A 1QH5A 4ZEJA 5DPXA 4YSLA 5ACSA 5ACUA 3RKJA 4RM5A 5ACPA 2FK6A 2R2DA 5IQKA 4DIKA 2Q42A 4U4LA 4NQ6A 3DHBA 4FSBA 2QINA 1A7TA 4GYQA 1WW1A 3H3EA 4D1VA 1DDKA 5A87A 3ZQ4A 4D1WA 2Y8AA 3I11A 2DOOA 5K0WA 4PVTA 5ACXA 1ZKPA 4B87A 2BG6A 5EVDA 4RL2A 5B3RA 3AF5A 5HIOA 4Z5ZA 2A7MA 2XR1A 2OHHA 4UWRB 2WYLA 2E7YA 4ZNBA 3KL7A 3SRXA 4F6ZA 2VW8A 4Z7RA 5FQAA 1MQOA 2I7XA 2BFZB 4V0HA 2ZWRA 4C09A 2I7TA 3I14A 5B1UA 3SFPA 5LM6A 3BK1A 5AYAA 2YNTA 3S0ZA 3I13A 2YCBA 2NZFA 2GFKA 4J5HA 5A5ZA 1YCGA 2QEDA 3ESHA 2WRSA 5LLDA 3BC2A 3DHCA 4C1CA 3IOGA 4RL0A 3AJ3A 1X8HA 2H6AA 3SW3A 1ZNBA 1X8GA 2UYXA 2BIBA 5LCHA 5A0TA 4UWOB 2AIOA 4ZO3A 4EY2A 3X2ZA 2ZNBA 5ACQA 4UWPB 3SPUA 2BTNA 3T3OA 1A8TA 2YNUA 4WD6A 4F6HA 5EV6A 1Y44A 5HISA 2YNWA 4XWWA 2BR6A 5A0VA 2P97A 4NQ5A 3FAIA 2BG8A 2BGAA 4KEQA 4EYBA 4XWTA 2CBNA 1YCHA 2BFZA 4HL2A 4TZEA 3ADRA 4JO0A 1E5DA 1WUPA 4RAWA 4UBQA 2YNTB 3DH8A 3F9OA 3PG4A 3WXCA 3PY5A 5AXOA 4UAMA 4H0DA 4GCWA 5KILA 4C1DA 2FHXA 5LMCA 3MD7A 4CHLA 1YCFA 3ZWFA 4YSKA 2YZ3A 5EW0A 4J5FA 5ACRA 1KR3A 4NQ2A 3X30A 4D1UA 1L9YA 4KEPA 4EYFA 4EXYA 4XUKA 3AF6A 5KIKA 2M5CA 3L6NA 4TYFA 5LE1A 3IOFA 4GYUA 1SMLA 4AWZA 4FEKA 1XTOA 2Q9UA 3G1PA 2QDSA 4O98A 4TYTA 5HH6A 1VGNA 4D1TA 3IEKA 2NXAA 3A4YA 4YSBA 5EV8A 3IE1A 3IEMA 3X2XA 5K4KA 4RAMA 4ZO2A 3SBLA 3IDZA 2FHXB 2XF4A 2AZ4A 5ACVA 3IE2A 1K07A 2FU6A 2I7VA 1HLKA 4TZ9A 4EYLA 4LE6A 1P9EA 2Q0IA 2FU7A 1KO3A 2Y87A 5AEBA 4BP0A 2QJSA 3TP9A 5LS3A 4TZBA 1M2XA 2WHGA 1X8IA 4EFZA 1DXKA 3BK2A 4AX1B 5ACWA 1VMEA 2FM6A 3Q6VA 2P4ZA 2WYMC 2GFJA 1DD6A 2BFKA 3RKKA 5HH4A 3BV6A 1BVTA 5ACTA 5LCFA 4C1GA 4AWYB 2HB9A 2NYPA 2Q0JA 2WYMA 4C1EA 1BMCA 3T3NA 5K4MA 4Z60A 1XM8A 5K4NA 3RPCA 2P18A 2NZEA 5EH9A 5AXRA 5EHTA 4AX0B 4UWSB 4TZFA 3VQZA 1ZTCA 3KNSA 2BG7A 3ZNBA 5EVKA 3IE0A 3SD9A 4RBSA 2BG2A 4Z67A 2BMIA 2FU9A 4PVOA 2GCUA 2M5DA 3QH8A 3I15A 2OHIA 5AHRA 4Z6XA 1WUOA 2GKLA 2DKFA 5FQBA 2ZZIA 5LSCA 4P62A 2YNVB 2ZO4A 4HL1A 5FQCA 5B15A 4Z5YA 1VJNA 4NQ4A 4C1HA 4AD9A 2OHJA 2YNVA 3JXPA 4UA4A 3FCZA 1QH3A 3P2UA 3VPEA 1BC2A 2QDTA 1KO2A 3PY6A 5HIQA 2BG8B 4D02A 5LCAA 2BC2A 2P1EA 3I0VA 3KNRA 5AHOA 3X2YA 5EWAA 1JJEA 5HH5A 1JT1A 3T9MA 2GMNA 3DHAA 1WRAA 4DILA 2Y8BA 4HKYA 2FU8A 3IELA 4EXSA 5EVBA 1JJTA 4FR7A 3LVZA 5HIPA 4C1FA
chains in the Genus database with same CATH superfamily
2BFLA 3R2UA 3ZR9A 4BZ3A 1QH5A 4ZEJA 5DPXA 4YSLA 5ACSA 5ACUA 3RKJA 4RM5A 5AJLA 5ACPA 2FK6A 2R2DA 5IQKA 4DIKA 2Q42A 4U4LA 4NQ6A 3DHBA 4FSBA 2QINA 1A7TA 4GYQA 1WW1A 3H3EA 4D1VA 1DDKA 5A87A 3ZQ4A 4D1WA 2CG2A 2Y8AA 3I11A 2DOOA 5K0WA 4PVTA 5ACXA 1ZKPA 4B87A 2BG6A 5EVDA 4RL2A 5B3RA 3AF5A 5HIOA 5AIJA 4Z5ZA 2A7MA 2XR1A 2OHHA 4UWRB 2WYLA 2E7YA 4ZNBA 3KL7A 3SRXA 4F6ZA 2VW8A 4Z7RA 5FQAA 4AXHA 1MQOA 2I7XA 2BFZB 4V0HA 2ZWRA 4C09A 2I7TA 3I14A 5B1UA 3SFPA 5LM6A 3BK1A 5AYAA 2YNTA 3S0ZA 3I13A 2YCBA 2NZFA 2GFKA 4J5HA 5A5ZA 1YCGA 2QEDA 3ESHA 2WRSA 5LLDA 3BC2A 3DHCA 4C1CA 3IOGA 4RL0A 3AJ3A 1X8HA 2H6AA 3SW3A 1ZNBA 1X8GA 2UYXA 2BIBA 5LCHA 5A0TA 4UWOB 2AIOA 4ZO3A 4EY2A 3X2ZA 2ZNBA 5ACQA 4UWPB 3SPUA 2BTNA 3T3OA 1A8TA 2YHEA 2YNUA 4WD6A 4F6HA 5EV6A 1Y44A 5HISA 2YNWA 4XWWA 2BR6A 5A0VA 2P97A 4NQ5A 3FAIA 2BG8A 2BGAA 4KEQA 4EYBA 4XWTA 2CBNA 1YCHA 2BFZA 4HL2A 4TZEA 3ADRA 4JO0A 1E5DA 1WUPA 4RAWA 4UBQA 2YNTB 3DH8A 3F9OA 3PG4A 3WXCA 3PY5A 5AXOA 4UAMA 4H0DA 4GCWA 2CG3A 5KILA 4C1DA 2FHXA 5LMCA 3MD7A 4CHLA 1YCFA 3ZWFA 4YSKA 2YZ3A 5EW0A 4J5FA 5ACRA 1KR3A 4NQ2A 4PDXA 3X30A 4D1UA 1L9YA 4NURA 4KEPA 4EYFA 4AV7A 4EXYA 4XUKA 3AF6A 5KIKA 2M5CA 3L6NA 4TYFA 5LE1A 3IOFA 4GYUA 1SMLA 4AWZA 4FEKA 1XTOA 2Q9UA 3G1PA 2QDSA 4O98A 4TYTA 5HH6A 1VGNA 4D1TA 3IEKA 2NXAA 3A4YA 4YSBA 5EV8A 3IE1A 3IEMA 3X2XA 5K4KA 4RAMA 4ZO2A 3SBLA 3IDZA 2FHXB 2XF4A 2AZ4A 5ACVA 3IE2A 1K07A 2FU6A 2I7VA 1HLKA 4TZ9A 4EYLA 4LE6A 1P9EA 2Q0IA 2FU7A 1KO3A 2Y87A 5AEBA 4BP0A 2QJSA 3TP9A 5LS3A 4TZBA 1M2XA 2WHGA 1X8IA 4EFZA 1DXKA 3BK2A 4AX1B 5ACWA 1VMEA 2FM6A 3Q6VA 2P4ZA 2WYMC 2GFJA 1DD6A 3RKKA 2BFKA 5HH4A 3BV6A 1BVTA 5ACTA 5LCFA 4C1GA 4AWYB 2HB9A 2NYPA 2Q0JA 2WYMA 4C1EA 1BMCA 3T3NA 5K4MA 4Z60A 1XM8A 5K4NA 3RPCA 2P18A 2NZEA 5EH9A 5AXRA 5EHTA 4AX0B 4UWSB 4TZFA 3VQZA 1ZTCA 3KNSA 2BG7A 3ZNBA 5EVKA 3IE0A 3SD9A 4RBSA 2BG2A 4Z67A 2BMIA 2FU9A 4PVOA 2GCUA 5A23A 2CFZA 2M5DA 3QH8A 3I15A 2OHIA 5AHRA 4Z6XA 1WUOA 2GKLA 2DKFA 5FQBA 2ZZIA 5LSCA 4P62A 2YNVB 2ZO4A 4HL1A 5FQCA 5B15A 4Z5YA 1VJNA 4NQ4A 4C1HA 4AD9A 2OHJA 2YNVA 3JXPA 4UA4A 3FCZA 1QH3A 3P2UA 3VPEA 1BC2A 2QDTA 1KO2A 3PY6A 5HIQA 2BG8B 2CFUA 4D02A 5LCAA 2BC2A 2P1EA 3I0VA 3KNRA 5AHOA 3X2YA 5EWAA 1JJEA 5HH5A 1JT1A 3T9MA 2GMNA 3DHAA 1WRAA 4DILA 2Y8BA 4HKYA 2FU8A 3IELA 4EXSA 5EVBA 1JJTA 4FR7A 3LVZA 5HIPA 4C1FA
chains in the Genus database with same CATH topology
2BFLA 3R2UA 3ZR9A 4BZ3A 1QH5A 4ZEJA 5DPXA 4YSLA 5ACSA 5ACUA 3RKJA 4RM5A 5ACPA 2FK6A 2R2DA 5IQKA 4DIKA 2Q42A 4U4LA 4NQ6A 3DHBA 4FSBA 2QINA 1A7TA 4GYQA 1WW1A 3H3EA 4D1VA 1DDKA 5A87A 3ZQ4A 4D1WA 2Y8AA 3I11A 2DOOA 5K0WA 4PVTA 5ACXA 1ZKPA 4B87A 2BG6A 5EVDA 4RL2A 5B3RA 3AF5A 5HIOA 4Z5ZA 2A7MA 2XR1A 2OHHA 4UWRB 2WYLA 2E7YA 4ZNBA 3KL7A 3SRXA 4F6ZA 2VW8A 4Z7RA 5FQAA 1MQOA 2I7XA 2BFZB 4V0HA 2ZWRA 4C09A 2I7TA 3I14A 5B1UA 3SFPA 5LM6A 3BK1A 5AYAA 2YNTA 3S0ZA 3I13A 2YCBA 2NZFA 2GFKA 4J5HA 5A5ZA 1YCGA 2QEDA 3ESHA 2WRSA 5LLDA 3BC2A 3DHCA 4C1CA 3IOGA 4RL0A 3AJ3A 1X8HA 2H6AA 3SW3A 1ZNBA 1X8GA 2UYXA 2BIBA 5LCHA 5A0TA 4UWOB 2AIOA 4ZO3A 4EY2A 3X2ZA 2ZNBA 5ACQA 4UWPB 3SPUA 2BTNA 3T3OA 1A8TA 2YNUA 4WD6A 4F6HA 5EV6A 1Y44A 5HISA 2YNWA 4XWWA 2BR6A 5A0VA 2P97A 4NQ5A 3FAIA 2BG8A 2BGAA 4KEQA 4EYBA 4XWTA 2CBNA 1YCHA 2BFZA 4HL2A 4TZEA 3ADRA 4JO0A 1E5DA 1WUPA 4RAWA 4UBQA 2YNTB 3DH8A 3F9OA 3PG4A 3WXCA 3PY5A 5AXOA 4UAMA 4H0DA 4GCWA 5KILA 4C1DA 2FHXA 5LMCA 3MD7A 4CHLA 1YCFA 3ZWFA 4YSKA 2YZ3A 5EW0A 4J5FA 5ACRA 1KR3A 4NQ2A 3X30A 4D1UA 1L9YA 4KEPA 4EYFA 4EXYA 4XUKA 3AF6A 5KIKA 2M5CA 3L6NA 4TYFA 5LE1A 3IOFA 4GYUA 1SMLA 4AWZA 4FEKA 1XTOA 2Q9UA 3G1PA 2QDSA 4O98A 4TYTA 5HH6A 1VGNA 4D1TA 3IEKA 2NXAA 3A4YA 4YSBA 5EV8A 3IE1A 3IEMA 3X2XA 5K4KA 4RAMA 4ZO2A 3SBLA 3IDZA 2FHXB 2XF4A 2AZ4A 5ACVA 3IE2A 1K07A 2FU6A 2I7VA 1HLKA 4TZ9A 4EYLA 4LE6A 1P9EA 2Q0IA 2FU7A 1KO3A 2Y87A 5AEBA 4BP0A 2QJSA 3TP9A 5LS3A 4TZBA 1M2XA 2WHGA 1X8IA 4EFZA 1DXKA 3BK2A 4AX1B 5ACWA 1VMEA 2FM6A 3Q6VA 2P4ZA 2WYMC 2GFJA 1DD6A 2BFKA 3RKKA 5HH4A 3BV6A 1BVTA 5ACTA 5LCFA 4C1GA 4AWYB 2HB9A 2NYPA 2Q0JA 2WYMA 4C1EA 1BMCA 3T3NA 5K4MA 4Z60A 1XM8A 5K4NA 3RPCA 2P18A 2NZEA 5EH9A 5AXRA 5EHTA 4AX0B 4UWSB 4TZFA 3VQZA 1ZTCA 3KNSA 2BG7A 3ZNBA 5EVKA 3IE0A 3SD9A 4RBSA 2BG2A 4Z67A 2BMIA 2FU9A 4PVOA 2GCUA 2M5DA 3QH8A 3I15A 2OHIA 5AHRA 4Z6XA 1WUOA 2GKLA 2DKFA 5FQBA 2ZZIA 5LSCA 4P62A 2YNVB 2ZO4A 4HL1A 5FQCA 5B15A 4Z5YA 1VJNA 4NQ4A 4C1HA 4AD9A 2OHJA 2YNVA 3JXPA 4UA4A 3FCZA 1QH3A 3P2UA 3VPEA 1BC2A 2QDTA 1KO2A 3PY6A 5HIQA 2BG8B 4D02A 5LCAA 2BC2A 2P1EA 3I0VA 3KNRA 5AHOA 3X2YA 5EWAA 1JJEA 5HH5A 1JT1A 3T9MA 2GMNA 3DHAA 1WRAA 4DILA 2Y8BA 4HKYA 2FU8A 3IELA 4EXSA 5EVBA 1JJTA 4FR7A 3LVZA 5HIPA 4C1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BFL A;  3R2U A;  3ZR9 A;  4BZ3 A;  1QH5 A;  4ZEJ A;  5DPX A;  4YSL A;  5ACS A;  5ACU A;  3RKJ A;  4RM5 A;  5ACP A;  2FK6 A;  2R2D A;  5IQK A;  4DIK A;  2Q42 A;  4U4L A;  4NQ6 A;  3DHB A;  4FSB A;  2QIN A;  1A7T A;  4GYQ A;  1WW1 A;  3H3E A;  4D1V A;  1DDK A;  5A87 A;  3ZQ4 A;  4D1W A;  2Y8A A;  3I11 A;  2DOO A;  5K0W A;  4PVT A;  5ACX A;  1ZKP A;  4B87 A;  2BG6 A;  5EVD A;  4RL2 A;  5B3R A;  3AF5 A;  5HIO A;  4Z5Z A;  2A7M A;  2XR1 A;  2OHH A;  4UWR B;  2WYL A;  2E7Y A;  4ZNB A;  3KL7 A;  3SRX A;  4F6Z A;  2VW8 A;  4Z7R A;  5FQA A;  1MQO A;  2I7X A;  2BFZ B;  4V0H A;  2ZWR A;  4C09 A;  2I7T A;  3I14 A;  5B1U A;  3SFP A;  5LM6 A;  3BK1 A;  5AYA A;  2YNT A;  3S0Z A;  3I13 A;  2YCB A;  2NZF A;  2GFK A;  4J5H A;  5A5Z A;  1YCG A;  2QED A;  3ESH A;  2WRS A;  5LLD A;  3BC2 A;  3DHC A;  4C1C A;  3IOG A;  4RL0 A;  3AJ3 A;  1X8H A;  2H6A A;  3SW3 A;  1ZNB A;  1X8G A;  2UYX A;  2BIB A;  5LCH A;  5A0T A;  4UWO B;  2AIO A;  4ZO3 A;  4EY2 A;  3X2Z A;  2ZNB A;  5ACQ A;  4UWP B;  3SPU A;  2BTN A;  3T3O A;  1A8T A;  2YNU A;  4WD6 A;  4F6H A;  5EV6 A;  1Y44 A;  5HIS A;  2YNW A;  4XWW A;  2BR6 A;  5A0V A;  2P97 A;  4NQ5 A;  3FAI A;  2BG8 A;  2BGA A;  4KEQ A;  4EYB A;  4XWT A;  2CBN A;  1YCH A;  2BFZ A;  4HL2 A;  4TZE A;  3ADR A;  4JO0 A;  1E5D A;  1WUP A;  4RAW A;  4UBQ A;  2YNT B;  3DH8 A;  3F9O A;  3PG4 A;  3WXC A;  3PY5 A;  5AXO A;  4UAM A;  4H0D A;  4GCW A;  5KIL A;  4C1D A;  2FHX A;  5LMC A;  3MD7 A;  4CHL A;  1YCF A;  3ZWF A;  4YSK A;  2YZ3 A;  5EW0 A;  4J5F A;  5ACR A;  1KR3 A;  4NQ2 A;  3X30 A;  4D1U A;  1L9Y A;  4KEP A;  4EYF A;  4EXY A;  4XUK A;  3AF6 A;  5KIK A;  2M5C A;  3L6N A;  4TYF A;  5LE1 A;  3IOF A;  4GYU A;  1SML A;  4AWZ A;  4FEK A;  1XTO A;  2Q9U A;  3G1P A;  2QDS A;  4O98 A;  4TYT A;  5HH6 A;  1VGN A;  4D1T A;  3IEK A;  2NXA A;  3A4Y A;  4YSB A;  5EV8 A;  3IE1 A;  3IEM A;  3X2X A;  5K4K A;  4RAM A;  4ZO2 A;  3SBL A;  3IDZ A;  2FHX B;  2XF4 A;  2AZ4 A;  5ACV A;  3IE2 A;  1K07 A;  2FU6 A;  2I7V A;  1HLK A;  4TZ9 A;  4EYL A;  4LE6 A;  1P9E A;  2Q0I A;  2FU7 A;  1KO3 A;  2Y87 A;  5AEB A;  4BP0 A;  2QJS A;  3TP9 A;  5LS3 A;  4TZB A;  1M2X A;  2WHG A;  1X8I A;  4EFZ A;  1DXK A;  3BK2 A;  4AX1 B;  5ACW A;  1VME A;  2FM6 A;  3Q6V A;  2P4Z A;  2WYM C;  2GFJ A;  1DD6 A;  2BFK A;  3RKK A;  5HH4 A;  3BV6 A;  1BVT A;  5ACT A;  5LCF A;  4C1G A;  4AWY B;  2HB9 A;  2NYP A;  2Q0J A;  2WYM A;  4C1E A;  1BMC A;  3T3N A;  5K4M A;  4Z60 A;  1XM8 A;  5K4N A;  3RPC A;  2P18 A;  2NZE A;  5EH9 A;  5AXR A;  5EHT A;  4AX0 B;  4UWS B;  4TZF A;  3VQZ A;  1ZTC A;  3KNS A;  2BG7 A;  3ZNB A;  5EVK A;  3IE0 A;  3SD9 A;  4RBS A;  2BG2 A;  4Z67 A;  2BMI A;  2FU9 A;  4PVO A;  2GCU A;  2M5D A;  3QH8 A;  3I15 A;  2OHI A;  5AHR A;  4Z6X A;  1WUO A;  2GKL A;  2DKF A;  5FQB A;  2ZZI A;  5LSC A;  4P62 A;  2YNV B;  2ZO4 A;  4HL1 A;  5FQC A;  5B15 A;  4Z5Y A;  1VJN A;  4NQ4 A;  4C1H A;  4AD9 A;  2OHJ A;  2YNV A;  3JXP A;  4UA4 A;  3FCZ A;  1QH3 A;  3P2U A;  3VPE A;  1BC2 A;  2QDT A;  1KO2 A;  3PY6 A;  5HIQ A;  2BG8 B;  4D02 A;  5LCA A;  2BC2 A;  2P1E A;  3I0V A;  3KNR A;  5AHO A;  3X2Y A;  5EWA A;  1JJE A;  5HH5 A;  1JT1 A;  3T9M A;  2GMN A;  3DHA A;  1WRA A;  4DIL A;  2Y8B A;  4HKY A;  2FU8 A;  3IEL A;  4EXS A;  5EVB A;  1JJT A;  4FR7 A;  3LVZ A;  5HIP A;  4C1F A; 
#chains in the Genus database with same CATH topology
 2BFL A;  3R2U A;  3ZR9 A;  4BZ3 A;  1QH5 A;  4ZEJ A;  5DPX A;  4YSL A;  5ACS A;  5ACU A;  3RKJ A;  4RM5 A;  5AJL A;  5ACP A;  2FK6 A;  2R2D A;  5IQK A;  4DIK A;  2Q42 A;  4U4L A;  4NQ6 A;  3DHB A;  4FSB A;  2QIN A;  1A7T A;  4GYQ A;  1WW1 A;  3H3E A;  4D1V A;  1DDK A;  5A87 A;  3ZQ4 A;  4D1W A;  2CG2 A;  2Y8A A;  3I11 A;  2DOO A;  5K0W A;  4PVT A;  5ACX A;  1ZKP A;  4B87 A;  2BG6 A;  5EVD A;  4RL2 A;  5B3R A;  3AF5 A;  5HIO A;  5AIJ A;  4Z5Z A;  2A7M A;  2XR1 A;  2OHH A;  4UWR B;  2WYL A;  2E7Y A;  4ZNB A;  3KL7 A;  3SRX A;  4F6Z A;  2VW8 A;  4Z7R A;  5FQA A;  4AXH A;  1MQO A;  2I7X A;  2BFZ B;  4V0H A;  2ZWR A;  4C09 A;  2I7T A;  3I14 A;  5B1U A;  3SFP A;  5LM6 A;  3BK1 A;  5AYA A;  2YNT A;  3S0Z A;  3I13 A;  2YCB A;  2NZF A;  2GFK A;  4J5H A;  5A5Z A;  1YCG A;  2QED A;  3ESH A;  2WRS A;  5LLD A;  3BC2 A;  3DHC A;  4C1C A;  3IOG A;  4RL0 A;  3AJ3 A;  1X8H A;  2H6A A;  3SW3 A;  1ZNB A;  1X8G A;  2UYX A;  2BIB A;  5LCH A;  5A0T A;  4UWO B;  2AIO A;  4ZO3 A;  4EY2 A;  3X2Z A;  2ZNB A;  5ACQ A;  4UWP B;  3SPU A;  2BTN A;  3T3O A;  1A8T A;  2YHE A;  2YNU A;  4WD6 A;  4F6H A;  5EV6 A;  1Y44 A;  5HIS A;  2YNW A;  4XWW A;  2BR6 A;  5A0V A;  2P97 A;  4NQ5 A;  3FAI A;  2BG8 A;  2BGA A;  4KEQ A;  4EYB A;  4XWT A;  2CBN A;  1YCH A;  2BFZ A;  4HL2 A;  4TZE A;  3ADR A;  4JO0 A;  1E5D A;  1WUP A;  4RAW A;  4UBQ A;  2YNT B;  3DH8 A;  3F9O A;  3PG4 A;  3WXC A;  3PY5 A;  5AXO A;  4UAM A;  4H0D A;  4GCW A;  2CG3 A;  5KIL A;  4C1D A;  2FHX A;  5LMC A;  3MD7 A;  4CHL A;  1YCF A;  3ZWF A;  4YSK A;  2YZ3 A;  5EW0 A;  4J5F A;  5ACR A;  1KR3 A;  4NQ2 A;  4PDX A;  3X30 A;  4D1U A;  1L9Y A;  4NUR A;  4KEP A;  4EYF A;  4AV7 A;  4EXY A;  4XUK A;  3AF6 A;  5KIK A;  2M5C A;  3L6N A;  4TYF A;  5LE1 A;  3IOF A;  4GYU A;  1SML A;  4AWZ A;  4FEK A;  1XTO A;  2Q9U A;  3G1P A;  2QDS A;  4O98 A;  4TYT A;  5HH6 A;  1VGN A;  4D1T A;  3IEK A;  2NXA A;  3A4Y A;  4YSB A;  5EV8 A;  3IE1 A;  3IEM A;  3X2X A;  5K4K A;  4RAM A;  4ZO2 A;  3SBL A;  3IDZ A;  2FHX B;  2XF4 A;  2AZ4 A;  5ACV A;  3IE2 A;  1K07 A;  2FU6 A;  2I7V A;  1HLK A;  4TZ9 A;  4EYL A;  4LE6 A;  1P9E A;  2Q0I A;  2FU7 A;  1KO3 A;  2Y87 A;  5AEB A;  4BP0 A;  2QJS A;  3TP9 A;  5LS3 A;  4TZB A;  1M2X A;  2WHG A;  1X8I A;  4EFZ A;  1DXK A;  3BK2 A;  4AX1 B;  5ACW A;  1VME A;  2FM6 A;  3Q6V A;  2P4Z A;  2WYM C;  2GFJ A;  1DD6 A;  3RKK A;  2BFK A;  5HH4 A;  3BV6 A;  1BVT A;  5ACT A;  5LCF A;  4C1G A;  4AWY B;  2HB9 A;  2NYP A;  2Q0J A;  2WYM A;  4C1E A;  1BMC A;  3T3N A;  5K4M A;  4Z60 A;  1XM8 A;  5K4N A;  3RPC A;  2P18 A;  2NZE A;  5EH9 A;  5AXR A;  5EHT A;  4AX0 B;  4UWS B;  4TZF A;  3VQZ A;  1ZTC A;  3KNS A;  2BG7 A;  3ZNB A;  5EVK A;  3IE0 A;  3SD9 A;  4RBS A;  2BG2 A;  4Z67 A;  2BMI A;  2FU9 A;  4PVO A;  2GCU A;  5A23 A;  2CFZ A;  2M5D A;  3QH8 A;  3I15 A;  2OHI A;  5AHR A;  4Z6X A;  1WUO A;  2GKL A;  2DKF A;  5FQB A;  2ZZI A;  5LSC A;  4P62 A;  2YNV B;  2ZO4 A;  4HL1 A;  5FQC A;  5B15 A;  4Z5Y A;  1VJN A;  4NQ4 A;  4C1H A;  4AD9 A;  2OHJ A;  2YNV A;  3JXP A;  4UA4 A;  3FCZ A;  1QH3 A;  3P2U A;  3VPE A;  1BC2 A;  2QDT A;  1KO2 A;  3PY6 A;  5HIQ A;  2BG8 B;  2CFU A;  4D02 A;  5LCA A;  2BC2 A;  2P1E A;  3I0V A;  3KNR A;  5AHO A;  3X2Y A;  5EWA A;  1JJE A;  5HH5 A;  1JT1 A;  3T9M A;  2GMN A;  3DHA A;  1WRA A;  4DIL A;  2Y8B A;  4HKY A;  2FU8 A;  3IEL A;  4EXS A;  5EVB A;  1JJT A;  4FR7 A;  3LVZ A;  5HIP A;  4C1F A; 
#chains in the Genus database with same CATH homology
 2BFL A;  3R2U A;  3ZR9 A;  4BZ3 A;  1QH5 A;  4ZEJ A;  5DPX A;  4YSL A;  5ACS A;  5ACU A;  3RKJ A;  4RM5 A;  5ACP A;  2FK6 A;  2R2D A;  5IQK A;  4DIK A;  2Q42 A;  4U4L A;  4NQ6 A;  3DHB A;  4FSB A;  2QIN A;  1A7T A;  4GYQ A;  1WW1 A;  3H3E A;  4D1V A;  1DDK A;  5A87 A;  3ZQ4 A;  4D1W A;  2Y8A A;  3I11 A;  2DOO A;  5K0W A;  4PVT A;  5ACX A;  1ZKP A;  4B87 A;  2BG6 A;  5EVD A;  4RL2 A;  5B3R A;  3AF5 A;  5HIO A;  4Z5Z A;  2A7M A;  2XR1 A;  2OHH A;  4UWR B;  2WYL A;  2E7Y A;  4ZNB A;  3KL7 A;  3SRX A;  4F6Z A;  2VW8 A;  4Z7R A;  5FQA A;  1MQO A;  2I7X A;  2BFZ B;  4V0H A;  2ZWR A;  4C09 A;  2I7T A;  3I14 A;  5B1U A;  3SFP A;  5LM6 A;  3BK1 A;  5AYA A;  2YNT A;  3S0Z A;  3I13 A;  2YCB A;  2NZF A;  2GFK A;  4J5H A;  5A5Z A;  1YCG A;  2QED A;  3ESH A;  2WRS A;  5LLD A;  3BC2 A;  3DHC A;  4C1C A;  3IOG A;  4RL0 A;  3AJ3 A;  1X8H A;  2H6A A;  3SW3 A;  1ZNB A;  1X8G A;  2UYX A;  2BIB A;  5LCH A;  5A0T A;  4UWO B;  2AIO A;  4ZO3 A;  4EY2 A;  3X2Z A;  2ZNB A;  5ACQ A;  4UWP B;  3SPU A;  2BTN A;  3T3O A;  1A8T A;  2YNU A;  4WD6 A;  4F6H A;  5EV6 A;  1Y44 A;  5HIS A;  2YNW A;  4XWW A;  2BR6 A;  5A0V A;  2P97 A;  4NQ5 A;  3FAI A;  2BG8 A;  2BGA A;  4KEQ A;  4EYB A;  4XWT A;  2CBN A;  1YCH A;  2BFZ A;  4HL2 A;  4TZE A;  3ADR A;  4JO0 A;  1E5D A;  1WUP A;  4RAW A;  4UBQ A;  2YNT B;  3DH8 A;  3F9O A;  3PG4 A;  3WXC A;  3PY5 A;  5AXO A;  4UAM A;  4H0D A;  4GCW A;  5KIL A;  4C1D A;  2FHX A;  5LMC A;  3MD7 A;  4CHL A;  1YCF A;  3ZWF A;  4YSK A;  2YZ3 A;  5EW0 A;  4J5F A;  5ACR A;  1KR3 A;  4NQ2 A;  3X30 A;  4D1U A;  1L9Y A;  4KEP A;  4EYF A;  4EXY A;  4XUK A;  3AF6 A;  5KIK A;  2M5C A;  3L6N A;  4TYF A;  5LE1 A;  3IOF A;  4GYU A;  1SML A;  4AWZ A;  4FEK A;  1XTO A;  2Q9U A;  3G1P A;  2QDS A;  4O98 A;  4TYT A;  5HH6 A;  1VGN A;  4D1T A;  3IEK A;  2NXA A;  3A4Y A;  4YSB A;  5EV8 A;  3IE1 A;  3IEM A;  3X2X A;  5K4K A;  4RAM A;  4ZO2 A;  3SBL A;  3IDZ A;  2FHX B;  2XF4 A;  2AZ4 A;  5ACV A;  3IE2 A;  1K07 A;  2FU6 A;  2I7V A;  1HLK A;  4TZ9 A;  4EYL A;  4LE6 A;  1P9E A;  2Q0I A;  2FU7 A;  1KO3 A;  2Y87 A;  5AEB A;  4BP0 A;  2QJS A;  3TP9 A;  5LS3 A;  4TZB A;  1M2X A;  2WHG A;  1X8I A;  4EFZ A;  1DXK A;  3BK2 A;  4AX1 B;  5ACW A;  1VME A;  2FM6 A;  3Q6V A;  2P4Z A;  2WYM C;  2GFJ A;  1DD6 A;  2BFK A;  3RKK A;  5HH4 A;  3BV6 A;  1BVT A;  5ACT A;  5LCF A;  4C1G A;  4AWY B;  2HB9 A;  2NYP A;  2Q0J A;  2WYM A;  4C1E A;  1BMC A;  3T3N A;  5K4M A;  4Z60 A;  1XM8 A;  5K4N A;  3RPC A;  2P18 A;  2NZE A;  5EH9 A;  5AXR A;  5EHT A;  4AX0 B;  4UWS B;  4TZF A;  3VQZ A;  1ZTC A;  3KNS A;  2BG7 A;  3ZNB A;  5EVK A;  3IE0 A;  3SD9 A;  4RBS A;  2BG2 A;  4Z67 A;  2BMI A;  2FU9 A;  4PVO A;  2GCU A;  2M5D A;  3QH8 A;  3I15 A;  2OHI A;  5AHR A;  4Z6X A;  1WUO A;  2GKL A;  2DKF A;  5FQB A;  2ZZI A;  5LSC A;  4P62 A;  2YNV B;  2ZO4 A;  4HL1 A;  5FQC A;  5B15 A;  4Z5Y A;  1VJN A;  4NQ4 A;  4C1H A;  4AD9 A;  2OHJ A;  2YNV A;  3JXP A;  4UA4 A;  3FCZ A;  1QH3 A;  3P2U A;  3VPE A;  1BC2 A;  2QDT A;  1KO2 A;  3PY6 A;  5HIQ A;  2BG8 B;  4D02 A;  5LCA A;  2BC2 A;  2P1E A;  3I0V A;  3KNR A;  5AHO A;  3X2Y A;  5EWA A;  1JJE A;  5HH5 A;  1JT1 A;  3T9M A;  2GMN A;  3DHA A;  1WRA A;  4DIL A;  2Y8B A;  4HKY A;  2FU8 A;  3IEL A;  4EXS A;  5EVB A;  1JJT A;  4FR7 A;  3LVZ A;  5HIP A;  4C1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...