3X2YA

Crystal structure of metallo-beta-lactamase h8a from thermotoga maritima
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
227
structure length
227
Chain Sequence
b'GMKVTFLGAAVVLIEGKKNIIIDPFISGNPVCPVKLEGLPKIDYILVTHGHGDHLGDAVEIAKKNDATVISNYEICHYLGKKGVKTHAMHIGGSYLFDFGRVKMTPAVHGSGILDGDSMIYGGNPSGFLITIEGKKIYHAGDTGLTREMELLAEENVDVAFLPIGGNFVMDVEDAVRAAVMIKPKKVVPMHYGTWELIFADVELFKKKVEEKGVECVILEPGESLEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0173 metal-dependent hydrolase TM_1162
publication title Crystal structure of metallo-beta-lactamase H8A from Thermotoga maritima
rcsb
source organism Thermotoga maritima msb8
molecule tags Hydrolase
total genus 61
structure length 227
sequence length 227
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3x2yA00
3T3OA 4D1VA 1WRAA 1ZKPA 2OHIA 2NXAA 1ZTCA 3H3EA 2VW8A 4GYQA 3QH8A 4YSKA 1KO3A 2BFZA 4CHLA 2GCUA 2BTNA 3VPEA 5EV8A 4C1EA 5K4KA 1X8GA 3FAIA 4AX1B 5EVDA 2I7VA 2FK6A 3KL7A 3PY5A 2XR1A 3KNSA 5ACWA 3DHCA 2DOOA 2QDSA 2GFJA 5FQBA 2I7TA 3S0ZA 4GCWA 2Y8AA 1JT1A 5ACRA 4Z60A 5ACTA 2P97A 2WYMA 3I11A 1ZNBA 5KIKA 4KEQA 2AZ4A 3IDZA 3R2UA 1VMEA 3I14A 5FQAA 5EVBA 2FHXB 5K4NA 3RKKA 4RBSA 3KNRA 5HIQA 3I13A 2YNTA 4D02A 4Z5ZA 2I7XA 2BFLA 1WW1A 1XTOA 4F6HA 4PVTA 5EWAA 5ACSA 4EY2A 2FM6A 2DKFA 1JJEA 4KEPA 3BK1A 4YSBA 4P62A 5AHOA 1E5DA 1K07A 3BV6A 2BG7A 3T9MA 4D1TA 5ACXA 3A4YA 2WRSA 4FR7A 2H6AA 1WUPA 2BG8A 1DD6A 1YCHA 1BC2A 5ACVA 3IEKA 4TZEA 3SBLA 5LM6A 5AXRA 5HIOA 4C1FA 4FEKA 2M5CA 5IQKA 2OHHA 4RL0A 1QH3A 4D1WA 1SMLA 4TZBA 4ZO3A 5HIPA 1WUOA 3X2XA 2WYLA 2BMIA 3ADRA 4NQ5A 4UWOB 5B3RA 3IEMA 2YNVA 4RM5A 4LE6A 3FCZA 2GFKA 5LMCA 5EVKA 2WYMC 3RKJA 3Q6VA 5HH6A 5K4MA 2UYXA 4DIKA 3IE2A 3TP9A 3ZQ4A 2BFKA 1YCGA 2Q0IA 3BC2A 5AEBA 4AD9A 5FQCA 3SFPA 4AWZA 3IE0A 5KILA 4C1HA 2R2DA 4J5HA 2P4ZA 4UWRB 4ZEJA 2Q42A 4EYFA 4Z67A 5LE1A 3SD9A 3X2YA 2BR6A 1X8IA 3ESHA 3ZNBA 5AYAA 3BK2A 4NQ6A 4Z5YA 2BFZB 2GKLA 4TZFA 5B1UA 4B87A 5LSCA 4FSBA 5A0TA 4Z6XA 5EH9A 2GMNA 5LCHA 3I15A 3F9OA 5ACUA 4EXSA 2BC2A 3AF5A 2FU7A 4XUKA 1JJTA 4YSLA 4ZO2A 3WXCA 5LLDA 1BMCA 4XWWA 3P2UA 3G1PA 3LVZA 4RL2A 1M2XA 4F6ZA 4GYUA 4C1DA 5AHRA 5LS3A 2E7YA 4O98A 5EHTA 1P9EA 4DILA 2HB9A 2FU9A 2ZO4A 3DHBA 2YNUA 1MQOA 4C1GA 2Q9UA 2YZ3A 5B15A 2QINA 2YNTB 5EW0A 2FU8A 2QEDA 5LCFA 1QH5A 3ZR9A 3PY6A 4Z7RA 2FHXA 2XF4A 4HKYA 4ZNBA 2Q0JA 4J5FA 1HLKA 3IE1A 4UWSB 5LCAA 2ZWRA 5K0WA 1X8HA 5A5ZA 2NZFA 2ZZIA 1DDKA 3T3NA 5A87A 3SW3A 2YCBA 2NZEA 2BG8B 3X30A 4AX0B 1VGNA 4C1CA 3AF6A 2M5DA 2QJSA 2OHJA 2CBNA 4EFZA 3RPCA 3IOGA 3AJ3A 4NQ4A 2QDTA 4UA4A 2BGAA 2ZNBA 4EXYA 2P18A 1Y44A 5HH4A 5A0VA 2AIOA 2NYPA 4TZ9A 4UBQA 5HISA 1YCFA 2YNVB 1BVTA 4NQ2A 3DHAA 2BIBA 2A7MA 1A7TA 5AXOA 3MD7A 4TYTA 5HH5A 3I0VA 4C09A 5ACQA 5ACPA 2Y8BA 3VQZA 4BP0A 4HL2A 1DXKA 4D1UA 4XWTA 1KR3A 4PVOA 4H0DA 4UWPB 3IOFA 2WHGA 2Y87A 3SRXA 4EYLA 1XM8A 3PG4A 3L6NA 3JXPA 2FU6A 3SPUA 4AWYB 4U4LA 3IELA 4BZ3A 5EV6A 3ZWFA 4EYBA 1A8TA 2BG6A 4JO0A 1L9YA 2BG2A 3X2ZA 2YNWA 2P1EA 4V0HA 1KO2A 4WD6A 4UAMA 4HL1A 5DPXA 1VJNA 4RAWA 3DH8A 4TYFA 4RAMA
chains in the Genus database with same CATH superfamily
3T3OA 4D1VA 1WRAA 1ZKPA 2OHIA 2NXAA 1ZTCA 3H3EA 2VW8A 4GYQA 3QH8A 4YSKA 1KO3A 2BFZA 4CHLA 2GCUA 2BTNA 3VPEA 5EV8A 4C1EA 5K4KA 1X8GA 3FAIA 4AX1B 5EVDA 2I7VA 2FK6A 3KL7A 3PY5A 2XR1A 3KNSA 5ACWA 3DHCA 2DOOA 2QDSA 2GFJA 5FQBA 2I7TA 3S0ZA 4GCWA 2Y8AA 1JT1A 5ACRA 4Z60A 5ACTA 2CFUA 2P97A 2WYMA 3I11A 1ZNBA 5KIKA 4KEQA 2AZ4A 3IDZA 3R2UA 1VMEA 3I14A 5FQAA 5EVBA 2FHXB 5K4NA 3RKKA 4RBSA 3KNRA 5HIQA 3I13A 2YNTA 4D02A 4Z5ZA 2I7XA 2BFLA 1WW1A 1XTOA 4F6HA 4PVTA 5EWAA 5ACSA 4EY2A 2FM6A 2DKFA 1JJEA 2CG2A 4KEPA 3BK1A 4YSBA 4P62A 5AHOA 1E5DA 1K07A 3BV6A 2BG7A 3T9MA 4D1TA 5ACXA 3A4YA 2WRSA 4FR7A 2H6AA 1WUPA 2BG8A 1DD6A 1YCHA 1BC2A 5ACVA 3IEKA 4TZEA 3SBLA 5LM6A 5AXRA 5HIOA 4C1FA 4FEKA 2M5CA 5IQKA 2OHHA 4RL0A 1QH3A 4D1WA 1SMLA 4TZBA 4ZO3A 5HIPA 1WUOA 3X2XA 2WYLA 2BMIA 3ADRA 4NQ5A 4UWOB 5B3RA 4AXHA 3IEMA 2YNVA 4RM5A 4LE6A 3FCZA 2GFKA 5LMCA 5EVKA 2WYMC 3RKJA 3Q6VA 5HH6A 5K4MA 2UYXA 4DIKA 3IE2A 3TP9A 3ZQ4A 2BFKA 1YCGA 2Q0IA 3BC2A 5AEBA 4AD9A 5FQCA 3SFPA 4AWZA 3IE0A 5KILA 4C1HA 2R2DA 4J5HA 4AV7A 2P4ZA 4UWRB 4ZEJA 2Q42A 4EYFA 4Z67A 5LE1A 3SD9A 3X2YA 2BR6A 1X8IA 3ESHA 3ZNBA 5AYAA 3BK2A 4NQ6A 4Z5YA 2BFZB 2GKLA 4TZFA 5B1UA 4B87A 5LSCA 4FSBA 5A0TA 4Z6XA 5EH9A 2GMNA 5LCHA 3I15A 3F9OA 5ACUA 4EXSA 2BC2A 3AF5A 2FU7A 4XUKA 1JJTA 4YSLA 4ZO2A 3WXCA 5LLDA 1BMCA 4XWWA 3P2UA 3G1PA 3LVZA 4RL2A 1M2XA 4F6ZA 4GYUA 4C1DA 5AHRA 5LS3A 2E7YA 4O98A 5EHTA 1P9EA 4DILA 2HB9A 2FU9A 2ZO4A 3DHBA 2YNUA 1MQOA 4C1GA 2Q9UA 2YZ3A 5B15A 2QINA 2YNTB 5EW0A 2FU8A 2QEDA 5LCFA 1QH5A 3ZR9A 3PY6A 4Z7RA 2FHXA 2XF4A 4HKYA 4ZNBA 2Q0JA 4J5FA 1HLKA 2YHEA 3IE1A 4UWSB 5LCAA 2ZWRA 5K0WA 1X8HA 5A5ZA 2NZFA 2ZZIA 1DDKA 3T3NA 5A87A 3SW3A 2YCBA 2NZEA 2BG8B 3X30A 4AX0B 1VGNA 4C1CA 4NURA 3AF6A 2M5DA 2QJSA 4PDXA 2OHJA 2CBNA 5AJLA 4EFZA 3RPCA 3IOGA 2CG3A 3AJ3A 4NQ4A 2QDTA 4UA4A 2BGAA 2ZNBA 4EXYA 2P18A 1Y44A 5HH4A 5A0VA 2AIOA 2NYPA 4TZ9A 2CFZA 4UBQA 5HISA 1YCFA 2YNVB 1BVTA 4NQ2A 3DHAA 2BIBA 2A7MA 1A7TA 5AXOA 3MD7A 4TYTA 5HH5A 3I0VA 4C09A 5ACQA 5ACPA 2Y8BA 3VQZA 4BP0A 4HL2A 1DXKA 4D1UA 4XWTA 1KR3A 4PVOA 4H0DA 4UWPB 3IOFA 2WHGA 2Y87A 3SRXA 4EYLA 1XM8A 3PG4A 3L6NA 3JXPA 2FU6A 5A23A 3SPUA 4AWYB 4U4LA 3IELA 4BZ3A 5EV6A 3ZWFA 4EYBA 1A8TA 2BG6A 4JO0A 1L9YA 2BG2A 3X2ZA 2YNWA 2P1EA 4V0HA 1KO2A 4WD6A 4UAMA 5AIJA 4HL1A 5DPXA 1VJNA 4RAWA 3DH8A 4TYFA 4RAMA
chains in the Genus database with same CATH topology
3T3OA 4D1VA 1WRAA 1ZKPA 2OHIA 2NXAA 1ZTCA 3H3EA 2VW8A 4GYQA 3QH8A 4YSKA 1KO3A 2BFZA 4CHLA 2GCUA 2BTNA 3VPEA 5EV8A 4C1EA 5K4KA 1X8GA 3FAIA 4AX1B 5EVDA 2I7VA 2FK6A 3KL7A 3PY5A 2XR1A 3KNSA 5ACWA 3DHCA 2DOOA 2QDSA 2GFJA 5FQBA 2I7TA 3S0ZA 4GCWA 2Y8AA 1JT1A 5ACRA 4Z60A 5ACTA 2P97A 2WYMA 3I11A 1ZNBA 5KIKA 4KEQA 2AZ4A 3IDZA 3R2UA 1VMEA 3I14A 5FQAA 5EVBA 2FHXB 5K4NA 3RKKA 4RBSA 3KNRA 5HIQA 3I13A 2YNTA 4D02A 4Z5ZA 2I7XA 2BFLA 1WW1A 1XTOA 4F6HA 4PVTA 5EWAA 5ACSA 4EY2A 2FM6A 2DKFA 1JJEA 4KEPA 3BK1A 4YSBA 4P62A 5AHOA 1E5DA 1K07A 3BV6A 2BG7A 3T9MA 4D1TA 5ACXA 3A4YA 2WRSA 4FR7A 2H6AA 1WUPA 2BG8A 1DD6A 1YCHA 1BC2A 5ACVA 3IEKA 4TZEA 3SBLA 5LM6A 5AXRA 5HIOA 4C1FA 4FEKA 2M5CA 5IQKA 2OHHA 4RL0A 1QH3A 4D1WA 1SMLA 4TZBA 4ZO3A 5HIPA 1WUOA 3X2XA 2WYLA 2BMIA 3ADRA 4NQ5A 4UWOB 5B3RA 3IEMA 2YNVA 4RM5A 4LE6A 3FCZA 2GFKA 5LMCA 5EVKA 2WYMC 3RKJA 3Q6VA 5HH6A 5K4MA 2UYXA 4DIKA 3IE2A 3TP9A 3ZQ4A 2BFKA 1YCGA 2Q0IA 3BC2A 5AEBA 4AD9A 5FQCA 3SFPA 4AWZA 3IE0A 5KILA 4C1HA 2R2DA 4J5HA 2P4ZA 4UWRB 4ZEJA 2Q42A 4EYFA 4Z67A 5LE1A 3SD9A 3X2YA 2BR6A 1X8IA 3ESHA 3ZNBA 5AYAA 3BK2A 4NQ6A 4Z5YA 2BFZB 2GKLA 4TZFA 5B1UA 4B87A 5LSCA 4FSBA 5A0TA 4Z6XA 5EH9A 2GMNA 5LCHA 3I15A 3F9OA 5ACUA 4EXSA 2BC2A 3AF5A 2FU7A 4XUKA 1JJTA 4YSLA 4ZO2A 3WXCA 5LLDA 1BMCA 4XWWA 3P2UA 3G1PA 3LVZA 4RL2A 1M2XA 4F6ZA 4GYUA 4C1DA 5AHRA 5LS3A 2E7YA 4O98A 5EHTA 1P9EA 4DILA 2HB9A 2FU9A 2ZO4A 3DHBA 2YNUA 1MQOA 4C1GA 2Q9UA 2YZ3A 5B15A 2QINA 2YNTB 5EW0A 2FU8A 2QEDA 5LCFA 1QH5A 3ZR9A 3PY6A 4Z7RA 2FHXA 2XF4A 4HKYA 4ZNBA 2Q0JA 4J5FA 1HLKA 3IE1A 4UWSB 5LCAA 2ZWRA 5K0WA 1X8HA 5A5ZA 2NZFA 2ZZIA 1DDKA 3T3NA 5A87A 3SW3A 2YCBA 2NZEA 2BG8B 3X30A 4AX0B 1VGNA 4C1CA 3AF6A 2M5DA 2QJSA 2OHJA 2CBNA 4EFZA 3RPCA 3IOGA 3AJ3A 4NQ4A 2QDTA 4UA4A 2BGAA 2ZNBA 4EXYA 2P18A 1Y44A 5HH4A 5A0VA 2AIOA 2NYPA 4TZ9A 4UBQA 5HISA 1YCFA 2YNVB 1BVTA 4NQ2A 3DHAA 2BIBA 2A7MA 1A7TA 5AXOA 3MD7A 4TYTA 5HH5A 3I0VA 4C09A 5ACQA 5ACPA 2Y8BA 3VQZA 4BP0A 4HL2A 1DXKA 4D1UA 4XWTA 1KR3A 4PVOA 4H0DA 4UWPB 3IOFA 2WHGA 2Y87A 3SRXA 4EYLA 1XM8A 3PG4A 3L6NA 3JXPA 2FU6A 3SPUA 4AWYB 4U4LA 3IELA 4BZ3A 5EV6A 3ZWFA 4EYBA 1A8TA 2BG6A 4JO0A 1L9YA 2BG2A 3X2ZA 2YNWA 2P1EA 4V0HA 1KO2A 4WD6A 4UAMA 4HL1A 5DPXA 1VJNA 4RAWA 3DH8A 4TYFA 4RAMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T3O A;  4D1V A;  1WRA A;  1ZKP A;  2OHI A;  2NXA A;  1ZTC A;  3H3E A;  2VW8 A;  4GYQ A;  3QH8 A;  4YSK A;  1KO3 A;  2BFZ A;  4CHL A;  2GCU A;  2BTN A;  3VPE A;  5EV8 A;  4C1E A;  5K4K A;  1X8G A;  3FAI A;  4AX1 B;  5EVD A;  2I7V A;  2FK6 A;  3KL7 A;  3PY5 A;  2XR1 A;  3KNS A;  5ACW A;  3DHC A;  2DOO A;  2QDS A;  2GFJ A;  5FQB A;  2I7T A;  3S0Z A;  4GCW A;  2Y8A A;  1JT1 A;  5ACR A;  4Z60 A;  5ACT A;  2P97 A;  2WYM A;  3I11 A;  1ZNB A;  5KIK A;  4KEQ A;  2AZ4 A;  3IDZ A;  3R2U A;  1VME A;  3I14 A;  5FQA A;  5EVB A;  2FHX B;  5K4N A;  3RKK A;  4RBS A;  3KNR A;  5HIQ A;  3I13 A;  2YNT A;  4D02 A;  4Z5Z A;  2I7X A;  2BFL A;  1WW1 A;  1XTO A;  4F6H A;  4PVT A;  5EWA A;  5ACS A;  4EY2 A;  2FM6 A;  2DKF A;  1JJE A;  4KEP A;  3BK1 A;  4YSB A;  4P62 A;  5AHO A;  1E5D A;  1K07 A;  3BV6 A;  2BG7 A;  3T9M A;  4D1T A;  5ACX A;  3A4Y A;  2WRS A;  4FR7 A;  2H6A A;  1WUP A;  2BG8 A;  1DD6 A;  1YCH A;  1BC2 A;  5ACV A;  3IEK A;  4TZE A;  3SBL A;  5LM6 A;  5AXR A;  5HIO A;  4C1F A;  4FEK A;  2M5C A;  5IQK A;  2OHH A;  4RL0 A;  1QH3 A;  4D1W A;  1SML A;  4TZB A;  4ZO3 A;  5HIP A;  1WUO A;  3X2X A;  2WYL A;  2BMI A;  3ADR A;  4NQ5 A;  4UWO B;  5B3R A;  3IEM A;  2YNV A;  4RM5 A;  4LE6 A;  3FCZ A;  2GFK A;  5LMC A;  5EVK A;  2WYM C;  3RKJ A;  3Q6V A;  5HH6 A;  5K4M A;  2UYX A;  4DIK A;  3IE2 A;  3TP9 A;  3ZQ4 A;  2BFK A;  1YCG A;  2Q0I A;  3BC2 A;  5AEB A;  4AD9 A;  5FQC A;  3SFP A;  4AWZ A;  3IE0 A;  5KIL A;  4C1H A;  2R2D A;  4J5H A;  2P4Z A;  4UWR B;  4ZEJ A;  2Q42 A;  4EYF A;  4Z67 A;  5LE1 A;  3SD9 A;  3X2Y A;  2BR6 A;  1X8I A;  3ESH A;  3ZNB A;  5AYA A;  3BK2 A;  4NQ6 A;  4Z5Y A;  2BFZ B;  2GKL A;  4TZF A;  5B1U A;  4B87 A;  5LSC A;  4FSB A;  5A0T A;  4Z6X A;  5EH9 A;  2GMN A;  5LCH A;  3I15 A;  3F9O A;  5ACU A;  4EXS A;  2BC2 A;  3AF5 A;  2FU7 A;  4XUK A;  1JJT A;  4YSL A;  4ZO2 A;  3WXC A;  5LLD A;  1BMC A;  4XWW A;  3P2U A;  3G1P A;  3LVZ A;  4RL2 A;  1M2X A;  4F6Z A;  4GYU A;  4C1D A;  5AHR A;  5LS3 A;  2E7Y A;  4O98 A;  5EHT A;  1P9E A;  4DIL A;  2HB9 A;  2FU9 A;  2ZO4 A;  3DHB A;  2YNU A;  1MQO A;  4C1G A;  2Q9U A;  2YZ3 A;  5B15 A;  2QIN A;  2YNT B;  5EW0 A;  2FU8 A;  2QED A;  5LCF A;  1QH5 A;  3ZR9 A;  3PY6 A;  4Z7R A;  2FHX A;  2XF4 A;  4HKY A;  4ZNB A;  2Q0J A;  4J5F A;  1HLK A;  3IE1 A;  4UWS B;  5LCA A;  2ZWR A;  5K0W A;  1X8H A;  5A5Z A;  2NZF A;  2ZZI A;  1DDK A;  3T3N A;  5A87 A;  3SW3 A;  2YCB A;  2NZE A;  2BG8 B;  3X30 A;  4AX0 B;  1VGN A;  4C1C A;  3AF6 A;  2M5D A;  2QJS A;  2OHJ A;  2CBN A;  4EFZ A;  3RPC A;  3IOG A;  3AJ3 A;  4NQ4 A;  2QDT A;  4UA4 A;  2BGA A;  2ZNB A;  4EXY A;  2P18 A;  1Y44 A;  5HH4 A;  5A0V A;  2AIO A;  2NYP A;  4TZ9 A;  4UBQ A;  5HIS A;  1YCF A;  2YNV B;  1BVT A;  4NQ2 A;  3DHA A;  2BIB A;  2A7M A;  1A7T A;  5AXO A;  3MD7 A;  4TYT A;  5HH5 A;  3I0V A;  4C09 A;  5ACQ A;  5ACP A;  2Y8B A;  3VQZ A;  4BP0 A;  4HL2 A;  1DXK A;  4D1U A;  4XWT A;  1KR3 A;  4PVO A;  4H0D A;  4UWP B;  3IOF A;  2WHG A;  2Y87 A;  3SRX A;  4EYL A;  1XM8 A;  3PG4 A;  3L6N A;  3JXP A;  2FU6 A;  3SPU A;  4AWY B;  4U4L A;  3IEL A;  4BZ3 A;  5EV6 A;  3ZWF A;  4EYB A;  1A8T A;  2BG6 A;  4JO0 A;  1L9Y A;  2BG2 A;  3X2Z A;  2YNW A;  2P1E A;  4V0H A;  1KO2 A;  4WD6 A;  4UAM A;  4HL1 A;  5DPX A;  1VJN A;  4RAW A;  3DH8 A;  4TYF A;  4RAM A; 
#chains in the Genus database with same CATH topology
 3T3O A;  4D1V A;  1WRA A;  1ZKP A;  2OHI A;  2NXA A;  1ZTC A;  3H3E A;  2VW8 A;  4GYQ A;  3QH8 A;  4YSK A;  1KO3 A;  2BFZ A;  4CHL A;  2GCU A;  2BTN A;  3VPE A;  5EV8 A;  4C1E A;  5K4K A;  1X8G A;  3FAI A;  4AX1 B;  5EVD A;  2I7V A;  2FK6 A;  3KL7 A;  3PY5 A;  2XR1 A;  3KNS A;  5ACW A;  3DHC A;  2DOO A;  2QDS A;  2GFJ A;  5FQB A;  2I7T A;  3S0Z A;  4GCW A;  2Y8A A;  1JT1 A;  5ACR A;  4Z60 A;  5ACT A;  2CFU A;  2P97 A;  2WYM A;  3I11 A;  1ZNB A;  5KIK A;  4KEQ A;  2AZ4 A;  3IDZ A;  3R2U A;  1VME A;  3I14 A;  5FQA A;  5EVB A;  2FHX B;  5K4N A;  3RKK A;  4RBS A;  3KNR A;  5HIQ A;  3I13 A;  2YNT A;  4D02 A;  4Z5Z A;  2I7X A;  2BFL A;  1WW1 A;  1XTO A;  4F6H A;  4PVT A;  5EWA A;  5ACS A;  4EY2 A;  2FM6 A;  2DKF A;  1JJE A;  2CG2 A;  4KEP A;  3BK1 A;  4YSB A;  4P62 A;  5AHO A;  1E5D A;  1K07 A;  3BV6 A;  2BG7 A;  3T9M A;  4D1T A;  5ACX A;  3A4Y A;  2WRS A;  4FR7 A;  2H6A A;  1WUP A;  2BG8 A;  1DD6 A;  1YCH A;  1BC2 A;  5ACV A;  3IEK A;  4TZE A;  3SBL A;  5LM6 A;  5AXR A;  5HIO A;  4C1F A;  4FEK A;  2M5C A;  5IQK A;  2OHH A;  4RL0 A;  1QH3 A;  4D1W A;  1SML A;  4TZB A;  4ZO3 A;  5HIP A;  1WUO A;  3X2X A;  2WYL A;  2BMI A;  3ADR A;  4NQ5 A;  4UWO B;  5B3R A;  4AXH A;  3IEM A;  2YNV A;  4RM5 A;  4LE6 A;  3FCZ A;  2GFK A;  5LMC A;  5EVK A;  2WYM C;  3RKJ A;  3Q6V A;  5HH6 A;  5K4M A;  2UYX A;  4DIK A;  3IE2 A;  3TP9 A;  3ZQ4 A;  2BFK A;  1YCG A;  2Q0I A;  3BC2 A;  5AEB A;  4AD9 A;  5FQC A;  3SFP A;  4AWZ A;  3IE0 A;  5KIL A;  4C1H A;  2R2D A;  4J5H A;  4AV7 A;  2P4Z A;  4UWR B;  4ZEJ A;  2Q42 A;  4EYF A;  4Z67 A;  5LE1 A;  3SD9 A;  3X2Y A;  2BR6 A;  1X8I A;  3ESH A;  3ZNB A;  5AYA A;  3BK2 A;  4NQ6 A;  4Z5Y A;  2BFZ B;  2GKL A;  4TZF A;  5B1U A;  4B87 A;  5LSC A;  4FSB A;  5A0T A;  4Z6X A;  5EH9 A;  2GMN A;  5LCH A;  3I15 A;  3F9O A;  5ACU A;  4EXS A;  2BC2 A;  3AF5 A;  2FU7 A;  4XUK A;  1JJT A;  4YSL A;  4ZO2 A;  3WXC A;  5LLD A;  1BMC A;  4XWW A;  3P2U A;  3G1P A;  3LVZ A;  4RL2 A;  1M2X A;  4F6Z A;  4GYU A;  4C1D A;  5AHR A;  5LS3 A;  2E7Y A;  4O98 A;  5EHT A;  1P9E A;  4DIL A;  2HB9 A;  2FU9 A;  2ZO4 A;  3DHB A;  2YNU A;  1MQO A;  4C1G A;  2Q9U A;  2YZ3 A;  5B15 A;  2QIN A;  2YNT B;  5EW0 A;  2FU8 A;  2QED A;  5LCF A;  1QH5 A;  3ZR9 A;  3PY6 A;  4Z7R A;  2FHX A;  2XF4 A;  4HKY A;  4ZNB A;  2Q0J A;  4J5F A;  1HLK A;  2YHE A;  3IE1 A;  4UWS B;  5LCA A;  2ZWR A;  5K0W A;  1X8H A;  5A5Z A;  2NZF A;  2ZZI A;  1DDK A;  3T3N A;  5A87 A;  3SW3 A;  2YCB A;  2NZE A;  2BG8 B;  3X30 A;  4AX0 B;  1VGN A;  4C1C A;  4NUR A;  3AF6 A;  2M5D A;  2QJS A;  4PDX A;  2OHJ A;  2CBN A;  5AJL A;  4EFZ A;  3RPC A;  3IOG A;  2CG3 A;  3AJ3 A;  4NQ4 A;  2QDT A;  4UA4 A;  2BGA A;  2ZNB A;  4EXY A;  2P18 A;  1Y44 A;  5HH4 A;  5A0V A;  2AIO A;  2NYP A;  4TZ9 A;  2CFZ A;  4UBQ A;  5HIS A;  1YCF A;  2YNV B;  1BVT A;  4NQ2 A;  3DHA A;  2BIB A;  2A7M A;  1A7T A;  5AXO A;  3MD7 A;  4TYT A;  5HH5 A;  3I0V A;  4C09 A;  5ACQ A;  5ACP A;  2Y8B A;  3VQZ A;  4BP0 A;  4HL2 A;  1DXK A;  4D1U A;  4XWT A;  1KR3 A;  4PVO A;  4H0D A;  4UWP B;  3IOF A;  2WHG A;  2Y87 A;  3SRX A;  4EYL A;  1XM8 A;  3PG4 A;  3L6N A;  3JXP A;  2FU6 A;  5A23 A;  3SPU A;  4AWY B;  4U4L A;  3IEL A;  4BZ3 A;  5EV6 A;  3ZWF A;  4EYB A;  1A8T A;  2BG6 A;  4JO0 A;  1L9Y A;  2BG2 A;  3X2Z A;  2YNW A;  2P1E A;  4V0H A;  1KO2 A;  4WD6 A;  4UAM A;  5AIJ A;  4HL1 A;  5DPX A;  1VJN A;  4RAW A;  3DH8 A;  4TYF A;  4RAM A; 
#chains in the Genus database with same CATH homology
 3T3O A;  4D1V A;  1WRA A;  1ZKP A;  2OHI A;  2NXA A;  1ZTC A;  3H3E A;  2VW8 A;  4GYQ A;  3QH8 A;  4YSK A;  1KO3 A;  2BFZ A;  4CHL A;  2GCU A;  2BTN A;  3VPE A;  5EV8 A;  4C1E A;  5K4K A;  1X8G A;  3FAI A;  4AX1 B;  5EVD A;  2I7V A;  2FK6 A;  3KL7 A;  3PY5 A;  2XR1 A;  3KNS A;  5ACW A;  3DHC A;  2DOO A;  2QDS A;  2GFJ A;  5FQB A;  2I7T A;  3S0Z A;  4GCW A;  2Y8A A;  1JT1 A;  5ACR A;  4Z60 A;  5ACT A;  2P97 A;  2WYM A;  3I11 A;  1ZNB A;  5KIK A;  4KEQ A;  2AZ4 A;  3IDZ A;  3R2U A;  1VME A;  3I14 A;  5FQA A;  5EVB A;  2FHX B;  5K4N A;  3RKK A;  4RBS A;  3KNR A;  5HIQ A;  3I13 A;  2YNT A;  4D02 A;  4Z5Z A;  2I7X A;  2BFL A;  1WW1 A;  1XTO A;  4F6H A;  4PVT A;  5EWA A;  5ACS A;  4EY2 A;  2FM6 A;  2DKF A;  1JJE A;  4KEP A;  3BK1 A;  4YSB A;  4P62 A;  5AHO A;  1E5D A;  1K07 A;  3BV6 A;  2BG7 A;  3T9M A;  4D1T A;  5ACX A;  3A4Y A;  2WRS A;  4FR7 A;  2H6A A;  1WUP A;  2BG8 A;  1DD6 A;  1YCH A;  1BC2 A;  5ACV A;  3IEK A;  4TZE A;  3SBL A;  5LM6 A;  5AXR A;  5HIO A;  4C1F A;  4FEK A;  2M5C A;  5IQK A;  2OHH A;  4RL0 A;  1QH3 A;  4D1W A;  1SML A;  4TZB A;  4ZO3 A;  5HIP A;  1WUO A;  3X2X A;  2WYL A;  2BMI A;  3ADR A;  4NQ5 A;  4UWO B;  5B3R A;  3IEM A;  2YNV A;  4RM5 A;  4LE6 A;  3FCZ A;  2GFK A;  5LMC A;  5EVK A;  2WYM C;  3RKJ A;  3Q6V A;  5HH6 A;  5K4M A;  2UYX A;  4DIK A;  3IE2 A;  3TP9 A;  3ZQ4 A;  2BFK A;  1YCG A;  2Q0I A;  3BC2 A;  5AEB A;  4AD9 A;  5FQC A;  3SFP A;  4AWZ A;  3IE0 A;  5KIL A;  4C1H A;  2R2D A;  4J5H A;  2P4Z A;  4UWR B;  4ZEJ A;  2Q42 A;  4EYF A;  4Z67 A;  5LE1 A;  3SD9 A;  3X2Y A;  2BR6 A;  1X8I A;  3ESH A;  3ZNB A;  5AYA A;  3BK2 A;  4NQ6 A;  4Z5Y A;  2BFZ B;  2GKL A;  4TZF A;  5B1U A;  4B87 A;  5LSC A;  4FSB A;  5A0T A;  4Z6X A;  5EH9 A;  2GMN A;  5LCH A;  3I15 A;  3F9O A;  5ACU A;  4EXS A;  2BC2 A;  3AF5 A;  2FU7 A;  4XUK A;  1JJT A;  4YSL A;  4ZO2 A;  3WXC A;  5LLD A;  1BMC A;  4XWW A;  3P2U A;  3G1P A;  3LVZ A;  4RL2 A;  1M2X A;  4F6Z A;  4GYU A;  4C1D A;  5AHR A;  5LS3 A;  2E7Y A;  4O98 A;  5EHT A;  1P9E A;  4DIL A;  2HB9 A;  2FU9 A;  2ZO4 A;  3DHB A;  2YNU A;  1MQO A;  4C1G A;  2Q9U A;  2YZ3 A;  5B15 A;  2QIN A;  2YNT B;  5EW0 A;  2FU8 A;  2QED A;  5LCF A;  1QH5 A;  3ZR9 A;  3PY6 A;  4Z7R A;  2FHX A;  2XF4 A;  4HKY A;  4ZNB A;  2Q0J A;  4J5F A;  1HLK A;  3IE1 A;  4UWS B;  5LCA A;  2ZWR A;  5K0W A;  1X8H A;  5A5Z A;  2NZF A;  2ZZI A;  1DDK A;  3T3N A;  5A87 A;  3SW3 A;  2YCB A;  2NZE A;  2BG8 B;  3X30 A;  4AX0 B;  1VGN A;  4C1C A;  3AF6 A;  2M5D A;  2QJS A;  2OHJ A;  2CBN A;  4EFZ A;  3RPC A;  3IOG A;  3AJ3 A;  4NQ4 A;  2QDT A;  4UA4 A;  2BGA A;  2ZNB A;  4EXY A;  2P18 A;  1Y44 A;  5HH4 A;  5A0V A;  2AIO A;  2NYP A;  4TZ9 A;  4UBQ A;  5HIS A;  1YCF A;  2YNV B;  1BVT A;  4NQ2 A;  3DHA A;  2BIB A;  2A7M A;  1A7T A;  5AXO A;  3MD7 A;  4TYT A;  5HH5 A;  3I0V A;  4C09 A;  5ACQ A;  5ACP A;  2Y8B A;  3VQZ A;  4BP0 A;  4HL2 A;  1DXK A;  4D1U A;  4XWT A;  1KR3 A;  4PVO A;  4H0D A;  4UWP B;  3IOF A;  2WHG A;  2Y87 A;  3SRX A;  4EYL A;  1XM8 A;  3PG4 A;  3L6N A;  3JXP A;  2FU6 A;  3SPU A;  4AWY B;  4U4L A;  3IEL A;  4BZ3 A;  5EV6 A;  3ZWF A;  4EYB A;  1A8T A;  2BG6 A;  4JO0 A;  1L9Y A;  2BG2 A;  3X2Z A;  2YNW A;  2P1E A;  4V0H A;  1KO2 A;  4WD6 A;  4UAM A;  4HL1 A;  5DPX A;  1VJN A;  4RAW A;  3DH8 A;  4TYF A;  4RAM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...