2WYMC

Structure of a metallo-b-lactamase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
336
structure length
297
Chain Sequence
b'SKVKSITRESWILSTFPEWGSWLNEEIEQEQVAPGTFAMWWLGCTGIWLKSEGGTNVCVDFWCGTGKQSHGQPNLRTTPFVLDPFAIRQIDAVLATHDHNDHIDVNVAAAVMQNCADDVPFIGPKTCVDLWIGWGVPKERCIVVKPGDVVKVKDIEIHALDAFGMDDRAVNYLFKTPGGSLYHSGDSHYSNYYAKHGNEHQIDVALGSYGENPRGITDKMTSADMLRMGEALNAKVVIPFHHDIWSNFQADPQEIRVLWEMKKDRLKYGFKPFIWQVGGKFTWPLDKDNFEYHYPRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-ASCORBATE-6-PHOSPHATE LACTONASE ULAG
molecule tags Hydrolase
source organism Escherichia coli
publication title Molecular Architecture of the Mn(2+)Dependent Lactonase Ulag Reveals an Rnase-Like Metallo-Beta-Lactamase Fold and a Novel Quaternary Structure.
pubmed doi rcsb
total genus 92
structure length 297
sequence length 336
chains with identical sequence F
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13483 Lactamase_B_3 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2wymC00
1BC2A 2OHHA 5EH9A 4C1HA 3ZWFA 4Z6XA 2XF4A 1BMCA 4RL0A 4BP0A 2YNVA 1WRAA 3IEKA 2BG7A 4ZNBA 4DILA 1X8HA 2YZ3A 2R2DA 5FQCA 3PY6A 5HH5A 1HLKA 3X30A 2BTNA 4Z7RA 4O98A 4XWTA 3DHBA 2NYPA 4P62A 3IOFA 5EVBA 2BIBA 4GYUA 3SBLA 3IEMA 4UWPB 2WRSA 4C09A 1Y44A 2VW8A 3VPEA 4F6ZA 1DDKA 3RPCA 4J5HA 4PVOA 4Z5ZA 2QINA 4PVTA 5EV6A 2FU7A 3P2UA 1A7TA 5LS3A 2FHXB 2FK6A 1WW1A 2XR1A 5LCHA 2Q0JA 2P18A 5LCFA 2DOOA 1WUPA 5ACTA 3L6NA 2AIOA 1ZKPA 2Q0IA 2FU8A 2WYMA 2I7XA 5EVKA 3Q6VA 2YCBA 4UWOB 3SPUA 5ACRA 2NZFA 1MQOA 3SD9A 2A7MA 4LE6A 3IE0A 5ACPA 2FU9A 4NQ6A 4AD9A 5A0VA 2GCUA 1A8TA 3KNRA 4D1VA 2Y8AA 3BC2A 2ZWRA 2H6AA 4EYFA 2GFKA 3H3EA 2M5DA 5KIKA 2BFZB 3SW3A 1KR3A 5ACXA 3AJ3A 3I0VA 4NQ5A 3S0ZA 2BG8B 4FSBA 4UA4A 4KEPA 5LMCA 3ADRA 2UYXA 4XUKA 1DD6A 2Q9UA 2BG8A 2NZEA 4RM5A 2ZZIA 2BFLA 5HISA 5K4MA 3T9MA 3SRXA 1QH5A 4DIKA 4NQ2A 2BMIA 3PY5A 4D1WA 3BV6A 2YNWA 3IOGA 3ZR9A 4C1FA 4UBQA 2BGAA 4NQ4A 3ZQ4A 1VJNA 3BK2A 3KL7A 4C1CA 2NXAA 3I11A 4EYBA 4HL1A 2GFJA 2WYMC 1X8IA 1VMEA 5KILA 2GMNA 3IE2A 5K0WA 2GKLA 4RAWA 5B3RA 3AF6A 5B1UA 2FU6A 1KO2A 4HKYA 2Q42A 2M5CA 5EVDA 3ESHA 2P97A 3FCZA 4YSLA 2WHGA 2QDTA 2OHIA 5ACSA 4UAMA 5ACUA 4AWYB 3ZNBA 5AEBA 4EXYA 3VQZA 3T3NA 5A0TA 4H0DA 2P1EA 4GYQA 4TZEA 2P4ZA 2BC2A 3G1PA 2WYLA 3RKJA 4RBSA 4D1TA 4C1GA 2YNUA 4FR7A 4C1EA 4EFZA 4Z60A 1P9EA 1YCFA 3T3OA 1ZTCA 2QEDA 2YNTB 4UWRB 3DH8A 4Z5YA 3DHCA 1XM8A 5FQBA 4YSKA 3TP9A 4TYFA 3PG4A 1E5DA 1DXKA 2FM6A 4GCWA 1ZNBA 5LE1A 2BFZA 4F6HA 1M2XA 2OHJA 4UWSB 2BG6A 5ACQA 4ZO3A 1JJTA 2ZNBA 3IE1A 3LVZA 4Z67A 4EY2A 2BG2A 4TZ9A 4RAMA 3QH8A 2BFKA 2CBNA 2FHXA 1BVTA 4HL2A 5K4KA 4J5FA 5AYAA 2Y87A 5FQAA 5ACVA 4WD6A 2Y8BA 3AF5A 3X2YA 4XWWA 2I7VA 3FAIA 3X2XA 3F9OA 5HIPA 4EYLA 5LLDA 5DPXA 3IDZA 2AZ4A 1YCGA 4TZFA 3I13A 3WXCA 5B15A 4C1DA 3RKKA 1JT1A 2HB9A 5LSCA 1JJEA 4D02A 2I7TA 4AX0B 5AXRA 4AWZA 4CHLA 2QJSA 5AHRA 5AXOA 1L9YA 2YNVB 2YNTA 3JXPA 3I15A 3BK1A 4ZO2A 1WUOA 1X8GA 4TZBA 5EV8A 4RL2A 1SMLA 5A87A 5HH6A 1QH3A 1KO3A 5AHOA 5EWAA 5LCAA 4YSBA 4FEKA 5EW0A 3MD7A 4TYTA 2DKFA 4B87A 1K07A 3KNSA 5ACWA 4V0HA 5IQKA 3X2ZA 3IELA 4EXSA 5A5ZA 5HH4A 4ZEJA 2BR6A 2QDSA 2E7YA 3I14A 1VGNA 1YCHA 5EHTA 3R2UA 4KEQA 4D1UA 2ZO4A 3A4YA 4JO0A 5K4NA 5HIOA 1XTOA 5LM6A 4U4LA 5HIQA 3SFPA 3DHAA 4AX1B 4BZ3A
chains in the Genus database with same CATH superfamily
1BC2A 2OHHA 5EH9A 4C1HA 3ZWFA 4Z6XA 2XF4A 1BMCA 4RL0A 4BP0A 2YNVA 1WRAA 3IEKA 2BG7A 4ZNBA 4DILA 1X8HA 2YZ3A 2R2DA 5FQCA 3PY6A 5HH5A 1HLKA 3X30A 2BTNA 2CG2A 2CG3A 4Z7RA 4O98A 4XWTA 3DHBA 2NYPA 4P62A 3IOFA 5EVBA 2BIBA 4GYUA 3SBLA 3IEMA 4UWPB 2WRSA 4C09A 1Y44A 2VW8A 3VPEA 4F6ZA 1DDKA 3RPCA 4J5HA 4PVOA 4Z5ZA 2QINA 4PVTA 5EV6A 2FU7A 3P2UA 1A7TA 5LS3A 2FHXB 2FK6A 1WW1A 2XR1A 5LCHA 2Q0JA 2P18A 5LCFA 2DOOA 1WUPA 5ACTA 3L6NA 2AIOA 1ZKPA 2Q0IA 2FU8A 2WYMA 2I7XA 5EVKA 3Q6VA 2YCBA 4UWOB 3SPUA 5ACRA 2NZFA 1MQOA 3SD9A 2A7MA 4LE6A 3IE0A 5ACPA 2FU9A 4NQ6A 4AV7A 4AD9A 5A0VA 2GCUA 1A8TA 3KNRA 4D1VA 2Y8AA 3BC2A 2ZWRA 2H6AA 4EYFA 2GFKA 3H3EA 2M5DA 5KIKA 2BFZB 3SW3A 1KR3A 5ACXA 3AJ3A 3I0VA 4NQ5A 3S0ZA 2BG8B 4FSBA 4UA4A 4KEPA 5LMCA 3ADRA 2UYXA 4XUKA 1DD6A 2Q9UA 2BG8A 2NZEA 4RM5A 2ZZIA 2BFLA 5HISA 2CFUA 5K4MA 3SRXA 1QH5A 3T9MA 4DIKA 4NQ2A 2BMIA 3PY5A 4D1WA 3BV6A 2YNWA 3IOGA 3ZR9A 4C1FA 4UBQA 2BGAA 4NQ4A 3ZQ4A 1VJNA 3BK2A 3KL7A 4C1CA 2NXAA 3I11A 4EYBA 4HL1A 2GFJA 2WYMC 1X8IA 1VMEA 5AJLA 5A23A 5KILA 2GMNA 3IE2A 2GKLA 4RAWA 5K0WA 5B3RA 3AF6A 5B1UA 2FU6A 1KO2A 4HKYA 2Q42A 2M5CA 5EVDA 4AXHA 3ESHA 2P97A 3FCZA 4YSLA 2WHGA 2QDTA 2OHIA 5ACSA 4UAMA 5ACUA 4AWYB 3ZNBA 5AEBA 4EXYA 3VQZA 3T3NA 5A0TA 4H0DA 2P1EA 4GYQA 4TZEA 2P4ZA 2BC2A 3G1PA 2WYLA 3RKJA 4RBSA 4D1TA 4C1GA 2YNUA 4FR7A 4C1EA 4EFZA 4Z60A 4NURA 1P9EA 1YCFA 3T3OA 1ZTCA 2QEDA 2YNTB 4UWRB 3DH8A 4Z5YA 3DHCA 1XM8A 5FQBA 4YSKA 3TP9A 4TYFA 3PG4A 1E5DA 1DXKA 2FM6A 4GCWA 1ZNBA 5LE1A 2BFZA 4F6HA 2CFZA 1M2XA 2OHJA 4UWSB 2BG6A 5ACQA 4ZO3A 1JJTA 2ZNBA 3IE1A 3LVZA 4Z67A 4EY2A 2BG2A 4TZ9A 4RAMA 3QH8A 2BFKA 2CBNA 2FHXA 1BVTA 4HL2A 5K4KA 4J5FA 5AYAA 2Y87A 5FQAA 5ACVA 4WD6A 2Y8BA 3AF5A 3X2YA 4XWWA 2I7VA 3FAIA 3X2XA 3F9OA 5HIPA 4EYLA 5LLDA 5DPXA 3IDZA 2AZ4A 1YCGA 4TZFA 3I13A 2YHEA 3WXCA 5B15A 4C1DA 3RKKA 1JT1A 2HB9A 5LSCA 1JJEA 4D02A 2I7TA 4AX0B 5AXRA 4AWZA 4CHLA 2QJSA 5AHRA 5AXOA 1L9YA 2YNVB 2YNTA 3JXPA 4PDXA 3I15A 3BK1A 5AIJA 4ZO2A 1WUOA 1X8GA 4TZBA 5EV8A 4RL2A 1SMLA 5A87A 5HH6A 1QH3A 1KO3A 5AHOA 5EWAA 5LCAA 4YSBA 4FEKA 5EW0A 3MD7A 4TYTA 2DKFA 4B87A 1K07A 3KNSA 5ACWA 4V0HA 5IQKA 3X2ZA 3IELA 4EXSA 5A5ZA 5HH4A 4ZEJA 2BR6A 2QDSA 2E7YA 3I14A 1VGNA 1YCHA 5EHTA 3R2UA 4KEQA 4D1UA 2ZO4A 3A4YA 4JO0A 5K4NA 5HIOA 1XTOA 5LM6A 4U4LA 5HIQA 3SFPA 3DHAA 4AX1B 4BZ3A
chains in the Genus database with same CATH topology
1BC2A 2OHHA 5EH9A 4C1HA 3ZWFA 4Z6XA 2XF4A 1BMCA 4RL0A 4BP0A 2YNVA 1WRAA 3IEKA 2BG7A 4ZNBA 4DILA 1X8HA 2YZ3A 2R2DA 5FQCA 3PY6A 5HH5A 1HLKA 3X30A 2BTNA 4Z7RA 4O98A 4XWTA 3DHBA 2NYPA 4P62A 3IOFA 5EVBA 2BIBA 4GYUA 3SBLA 3IEMA 4UWPB 2WRSA 4C09A 1Y44A 2VW8A 3VPEA 4F6ZA 1DDKA 3RPCA 4J5HA 4PVOA 4Z5ZA 2QINA 4PVTA 5EV6A 2FU7A 3P2UA 1A7TA 5LS3A 2FHXB 2FK6A 1WW1A 2XR1A 5LCHA 2Q0JA 2P18A 5LCFA 2DOOA 1WUPA 5ACTA 3L6NA 2AIOA 1ZKPA 2Q0IA 2FU8A 2WYMA 2I7XA 5EVKA 3Q6VA 2YCBA 4UWOB 3SPUA 5ACRA 2NZFA 1MQOA 3SD9A 2A7MA 4LE6A 3IE0A 5ACPA 2FU9A 4NQ6A 4AD9A 5A0VA 2GCUA 1A8TA 3KNRA 4D1VA 2Y8AA 3BC2A 2ZWRA 2H6AA 4EYFA 2GFKA 3H3EA 2M5DA 5KIKA 2BFZB 3SW3A 1KR3A 5ACXA 3AJ3A 3I0VA 4NQ5A 3S0ZA 2BG8B 4FSBA 4UA4A 4KEPA 5LMCA 3ADRA 2UYXA 4XUKA 1DD6A 2Q9UA 2BG8A 2NZEA 4RM5A 2ZZIA 2BFLA 5HISA 5K4MA 3T9MA 3SRXA 1QH5A 4DIKA 4NQ2A 2BMIA 3PY5A 4D1WA 3BV6A 2YNWA 3IOGA 3ZR9A 4C1FA 4UBQA 2BGAA 4NQ4A 3ZQ4A 1VJNA 3BK2A 3KL7A 4C1CA 2NXAA 3I11A 4EYBA 4HL1A 2GFJA 2WYMC 1X8IA 1VMEA 5KILA 2GMNA 3IE2A 5K0WA 2GKLA 4RAWA 5B3RA 3AF6A 5B1UA 2FU6A 1KO2A 4HKYA 2Q42A 2M5CA 5EVDA 3ESHA 2P97A 3FCZA 4YSLA 2WHGA 2QDTA 2OHIA 5ACSA 4UAMA 5ACUA 4AWYB 3ZNBA 5AEBA 4EXYA 3VQZA 3T3NA 5A0TA 4H0DA 2P1EA 4GYQA 4TZEA 2P4ZA 2BC2A 3G1PA 2WYLA 3RKJA 4RBSA 4D1TA 4C1GA 2YNUA 4FR7A 4C1EA 4EFZA 4Z60A 1P9EA 1YCFA 3T3OA 1ZTCA 2QEDA 2YNTB 4UWRB 3DH8A 4Z5YA 3DHCA 1XM8A 5FQBA 4YSKA 3TP9A 4TYFA 3PG4A 1E5DA 1DXKA 2FM6A 4GCWA 1ZNBA 5LE1A 2BFZA 4F6HA 1M2XA 2OHJA 4UWSB 2BG6A 5ACQA 4ZO3A 1JJTA 2ZNBA 3IE1A 3LVZA 4Z67A 4EY2A 2BG2A 4TZ9A 4RAMA 3QH8A 2BFKA 2CBNA 2FHXA 1BVTA 4HL2A 5K4KA 4J5FA 5AYAA 2Y87A 5FQAA 5ACVA 4WD6A 2Y8BA 3AF5A 3X2YA 4XWWA 2I7VA 3FAIA 3X2XA 3F9OA 5HIPA 4EYLA 5LLDA 5DPXA 3IDZA 2AZ4A 1YCGA 4TZFA 3I13A 3WXCA 5B15A 4C1DA 3RKKA 1JT1A 2HB9A 5LSCA 1JJEA 4D02A 2I7TA 4AX0B 5AXRA 4AWZA 4CHLA 2QJSA 5AHRA 5AXOA 1L9YA 2YNVB 2YNTA 3JXPA 3I15A 3BK1A 4ZO2A 1WUOA 1X8GA 4TZBA 5EV8A 4RL2A 1SMLA 5A87A 5HH6A 1QH3A 1KO3A 5AHOA 5EWAA 5LCAA 4YSBA 4FEKA 5EW0A 3MD7A 4TYTA 2DKFA 4B87A 1K07A 3KNSA 5ACWA 4V0HA 5IQKA 3X2ZA 3IELA 4EXSA 5A5ZA 5HH4A 4ZEJA 2BR6A 2QDSA 2E7YA 3I14A 1VGNA 1YCHA 5EHTA 3R2UA 4KEQA 4D1UA 2ZO4A 3A4YA 4JO0A 5K4NA 5HIOA 1XTOA 5LM6A 4U4LA 5HIQA 3SFPA 3DHAA 4AX1B 4BZ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BC2 A;  2OHH A;  5EH9 A;  4C1H A;  3ZWF A;  4Z6X A;  2XF4 A;  1BMC A;  4RL0 A;  4BP0 A;  2YNV A;  1WRA A;  3IEK A;  2BG7 A;  4ZNB A;  4DIL A;  1X8H A;  2YZ3 A;  2R2D A;  5FQC A;  3PY6 A;  5HH5 A;  1HLK A;  3X30 A;  2BTN A;  4Z7R A;  4O98 A;  4XWT A;  3DHB A;  2NYP A;  4P62 A;  3IOF A;  5EVB A;  2BIB A;  4GYU A;  3SBL A;  3IEM A;  4UWP B;  2WRS A;  4C09 A;  1Y44 A;  2VW8 A;  3VPE A;  4F6Z A;  1DDK A;  3RPC A;  4J5H A;  4PVO A;  4Z5Z A;  2QIN A;  4PVT A;  5EV6 A;  2FU7 A;  3P2U A;  1A7T A;  5LS3 A;  2FHX B;  2FK6 A;  1WW1 A;  2XR1 A;  5LCH A;  2Q0J A;  2P18 A;  5LCF A;  2DOO A;  1WUP A;  5ACT A;  3L6N A;  2AIO A;  1ZKP A;  2Q0I A;  2FU8 A;  2WYM A;  2I7X A;  5EVK A;  3Q6V A;  2YCB A;  4UWO B;  3SPU A;  5ACR A;  2NZF A;  1MQO A;  3SD9 A;  2A7M A;  4LE6 A;  3IE0 A;  5ACP A;  2FU9 A;  4NQ6 A;  4AD9 A;  5A0V A;  2GCU A;  1A8T A;  3KNR A;  4D1V A;  2Y8A A;  3BC2 A;  2ZWR A;  2H6A A;  4EYF A;  2GFK A;  3H3E A;  2M5D A;  5KIK A;  2BFZ B;  3SW3 A;  1KR3 A;  5ACX A;  3AJ3 A;  3I0V A;  4NQ5 A;  3S0Z A;  2BG8 B;  4FSB A;  4UA4 A;  4KEP A;  5LMC A;  3ADR A;  2UYX A;  4XUK A;  1DD6 A;  2Q9U A;  2BG8 A;  2NZE A;  4RM5 A;  2ZZI A;  2BFL A;  5HIS A;  5K4M A;  3T9M A;  3SRX A;  1QH5 A;  4DIK A;  4NQ2 A;  2BMI A;  3PY5 A;  4D1W A;  3BV6 A;  2YNW A;  3IOG A;  3ZR9 A;  4C1F A;  4UBQ A;  2BGA A;  4NQ4 A;  3ZQ4 A;  1VJN A;  3BK2 A;  3KL7 A;  4C1C A;  2NXA A;  3I11 A;  4EYB A;  4HL1 A;  2GFJ A;  2WYM C;  1X8I A;  1VME A;  5KIL A;  2GMN A;  3IE2 A;  5K0W A;  2GKL A;  4RAW A;  5B3R A;  3AF6 A;  5B1U A;  2FU6 A;  1KO2 A;  4HKY A;  2Q42 A;  2M5C A;  5EVD A;  3ESH A;  2P97 A;  3FCZ A;  4YSL A;  2WHG A;  2QDT A;  2OHI A;  5ACS A;  4UAM A;  5ACU A;  4AWY B;  3ZNB A;  5AEB A;  4EXY A;  3VQZ A;  3T3N A;  5A0T A;  4H0D A;  2P1E A;  4GYQ A;  4TZE A;  2P4Z A;  2BC2 A;  3G1P A;  2WYL A;  3RKJ A;  4RBS A;  4D1T A;  4C1G A;  2YNU A;  4FR7 A;  4C1E A;  4EFZ A;  4Z60 A;  1P9E A;  1YCF A;  3T3O A;  1ZTC A;  2QED A;  2YNT B;  4UWR B;  3DH8 A;  4Z5Y A;  3DHC A;  1XM8 A;  5FQB A;  4YSK A;  3TP9 A;  4TYF A;  3PG4 A;  1E5D A;  1DXK A;  2FM6 A;  4GCW A;  1ZNB A;  5LE1 A;  2BFZ A;  4F6H A;  1M2X A;  2OHJ A;  4UWS B;  2BG6 A;  5ACQ A;  4ZO3 A;  1JJT A;  2ZNB A;  3IE1 A;  3LVZ A;  4Z67 A;  4EY2 A;  2BG2 A;  4TZ9 A;  4RAM A;  3QH8 A;  2BFK A;  2CBN A;  2FHX A;  1BVT A;  4HL2 A;  5K4K A;  4J5F A;  5AYA A;  2Y87 A;  5FQA A;  5ACV A;  4WD6 A;  2Y8B A;  3AF5 A;  3X2Y A;  4XWW A;  2I7V A;  3FAI A;  3X2X A;  3F9O A;  5HIP A;  4EYL A;  5LLD A;  5DPX A;  3IDZ A;  2AZ4 A;  1YCG A;  4TZF A;  3I13 A;  3WXC A;  5B15 A;  4C1D A;  3RKK A;  1JT1 A;  2HB9 A;  5LSC A;  1JJE A;  4D02 A;  2I7T A;  4AX0 B;  5AXR A;  4AWZ A;  4CHL A;  2QJS A;  5AHR A;  5AXO A;  1L9Y A;  2YNV B;  2YNT A;  3JXP A;  3I15 A;  3BK1 A;  4ZO2 A;  1WUO A;  1X8G A;  4TZB A;  5EV8 A;  4RL2 A;  1SML A;  5A87 A;  5HH6 A;  1QH3 A;  1KO3 A;  5AHO A;  5EWA A;  5LCA A;  4YSB A;  4FEK A;  5EW0 A;  3MD7 A;  4TYT A;  2DKF A;  4B87 A;  1K07 A;  3KNS A;  5ACW A;  4V0H A;  5IQK A;  3X2Z A;  3IEL A;  4EXS A;  5A5Z A;  5HH4 A;  4ZEJ A;  2BR6 A;  2QDS A;  2E7Y A;  3I14 A;  1VGN A;  1YCH A;  5EHT A;  3R2U A;  4KEQ A;  4D1U A;  2ZO4 A;  3A4Y A;  4JO0 A;  5K4N A;  5HIO A;  1XTO A;  5LM6 A;  4U4L A;  5HIQ A;  3SFP A;  3DHA A;  4AX1 B;  4BZ3 A; 
#chains in the Genus database with same CATH topology
 1BC2 A;  2OHH A;  5EH9 A;  4C1H A;  3ZWF A;  4Z6X A;  2XF4 A;  1BMC A;  4RL0 A;  4BP0 A;  2YNV A;  1WRA A;  3IEK A;  2BG7 A;  4ZNB A;  4DIL A;  1X8H A;  2YZ3 A;  2R2D A;  5FQC A;  3PY6 A;  5HH5 A;  1HLK A;  3X30 A;  2BTN A;  2CG2 A;  2CG3 A;  4Z7R A;  4O98 A;  4XWT A;  3DHB A;  2NYP A;  4P62 A;  3IOF A;  5EVB A;  2BIB A;  4GYU A;  3SBL A;  3IEM A;  4UWP B;  2WRS A;  4C09 A;  1Y44 A;  2VW8 A;  3VPE A;  4F6Z A;  1DDK A;  3RPC A;  4J5H A;  4PVO A;  4Z5Z A;  2QIN A;  4PVT A;  5EV6 A;  2FU7 A;  3P2U A;  1A7T A;  5LS3 A;  2FHX B;  2FK6 A;  1WW1 A;  2XR1 A;  5LCH A;  2Q0J A;  2P18 A;  5LCF A;  2DOO A;  1WUP A;  5ACT A;  3L6N A;  2AIO A;  1ZKP A;  2Q0I A;  2FU8 A;  2WYM A;  2I7X A;  5EVK A;  3Q6V A;  2YCB A;  4UWO B;  3SPU A;  5ACR A;  2NZF A;  1MQO A;  3SD9 A;  2A7M A;  4LE6 A;  3IE0 A;  5ACP A;  2FU9 A;  4NQ6 A;  4AV7 A;  4AD9 A;  5A0V A;  2GCU A;  1A8T A;  3KNR A;  4D1V A;  2Y8A A;  3BC2 A;  2ZWR A;  2H6A A;  4EYF A;  2GFK A;  3H3E A;  2M5D A;  5KIK A;  2BFZ B;  3SW3 A;  1KR3 A;  5ACX A;  3AJ3 A;  3I0V A;  4NQ5 A;  3S0Z A;  2BG8 B;  4FSB A;  4UA4 A;  4KEP A;  5LMC A;  3ADR A;  2UYX A;  4XUK A;  1DD6 A;  2Q9U A;  2BG8 A;  2NZE A;  4RM5 A;  2ZZI A;  2BFL A;  5HIS A;  2CFU A;  5K4M A;  3SRX A;  1QH5 A;  3T9M A;  4DIK A;  4NQ2 A;  2BMI A;  3PY5 A;  4D1W A;  3BV6 A;  2YNW A;  3IOG A;  3ZR9 A;  4C1F A;  4UBQ A;  2BGA A;  4NQ4 A;  3ZQ4 A;  1VJN A;  3BK2 A;  3KL7 A;  4C1C A;  2NXA A;  3I11 A;  4EYB A;  4HL1 A;  2GFJ A;  2WYM C;  1X8I A;  1VME A;  5AJL A;  5A23 A;  5KIL A;  2GMN A;  3IE2 A;  2GKL A;  4RAW A;  5K0W A;  5B3R A;  3AF6 A;  5B1U A;  2FU6 A;  1KO2 A;  4HKY A;  2Q42 A;  2M5C A;  5EVD A;  4AXH A;  3ESH A;  2P97 A;  3FCZ A;  4YSL A;  2WHG A;  2QDT A;  2OHI A;  5ACS A;  4UAM A;  5ACU A;  4AWY B;  3ZNB A;  5AEB A;  4EXY A;  3VQZ A;  3T3N A;  5A0T A;  4H0D A;  2P1E A;  4GYQ A;  4TZE A;  2P4Z A;  2BC2 A;  3G1P A;  2WYL A;  3RKJ A;  4RBS A;  4D1T A;  4C1G A;  2YNU A;  4FR7 A;  4C1E A;  4EFZ A;  4Z60 A;  4NUR A;  1P9E A;  1YCF A;  3T3O A;  1ZTC A;  2QED A;  2YNT B;  4UWR B;  3DH8 A;  4Z5Y A;  3DHC A;  1XM8 A;  5FQB A;  4YSK A;  3TP9 A;  4TYF A;  3PG4 A;  1E5D A;  1DXK A;  2FM6 A;  4GCW A;  1ZNB A;  5LE1 A;  2BFZ A;  4F6H A;  2CFZ A;  1M2X A;  2OHJ A;  4UWS B;  2BG6 A;  5ACQ A;  4ZO3 A;  1JJT A;  2ZNB A;  3IE1 A;  3LVZ A;  4Z67 A;  4EY2 A;  2BG2 A;  4TZ9 A;  4RAM A;  3QH8 A;  2BFK A;  2CBN A;  2FHX A;  1BVT A;  4HL2 A;  5K4K A;  4J5F A;  5AYA A;  2Y87 A;  5FQA A;  5ACV A;  4WD6 A;  2Y8B A;  3AF5 A;  3X2Y A;  4XWW A;  2I7V A;  3FAI A;  3X2X A;  3F9O A;  5HIP A;  4EYL A;  5LLD A;  5DPX A;  3IDZ A;  2AZ4 A;  1YCG A;  4TZF A;  3I13 A;  2YHE A;  3WXC A;  5B15 A;  4C1D A;  3RKK A;  1JT1 A;  2HB9 A;  5LSC A;  1JJE A;  4D02 A;  2I7T A;  4AX0 B;  5AXR A;  4AWZ A;  4CHL A;  2QJS A;  5AHR A;  5AXO A;  1L9Y A;  2YNV B;  2YNT A;  3JXP A;  4PDX A;  3I15 A;  3BK1 A;  5AIJ A;  4ZO2 A;  1WUO A;  1X8G A;  4TZB A;  5EV8 A;  4RL2 A;  1SML A;  5A87 A;  5HH6 A;  1QH3 A;  1KO3 A;  5AHO A;  5EWA A;  5LCA A;  4YSB A;  4FEK A;  5EW0 A;  3MD7 A;  4TYT A;  2DKF A;  4B87 A;  1K07 A;  3KNS A;  5ACW A;  4V0H A;  5IQK A;  3X2Z A;  3IEL A;  4EXS A;  5A5Z A;  5HH4 A;  4ZEJ A;  2BR6 A;  2QDS A;  2E7Y A;  3I14 A;  1VGN A;  1YCH A;  5EHT A;  3R2U A;  4KEQ A;  4D1U A;  2ZO4 A;  3A4Y A;  4JO0 A;  5K4N A;  5HIO A;  1XTO A;  5LM6 A;  4U4L A;  5HIQ A;  3SFP A;  3DHA A;  4AX1 B;  4BZ3 A; 
#chains in the Genus database with same CATH homology
 1BC2 A;  2OHH A;  5EH9 A;  4C1H A;  3ZWF A;  4Z6X A;  2XF4 A;  1BMC A;  4RL0 A;  4BP0 A;  2YNV A;  1WRA A;  3IEK A;  2BG7 A;  4ZNB A;  4DIL A;  1X8H A;  2YZ3 A;  2R2D A;  5FQC A;  3PY6 A;  5HH5 A;  1HLK A;  3X30 A;  2BTN A;  4Z7R A;  4O98 A;  4XWT A;  3DHB A;  2NYP A;  4P62 A;  3IOF A;  5EVB A;  2BIB A;  4GYU A;  3SBL A;  3IEM A;  4UWP B;  2WRS A;  4C09 A;  1Y44 A;  2VW8 A;  3VPE A;  4F6Z A;  1DDK A;  3RPC A;  4J5H A;  4PVO A;  4Z5Z A;  2QIN A;  4PVT A;  5EV6 A;  2FU7 A;  3P2U A;  1A7T A;  5LS3 A;  2FHX B;  2FK6 A;  1WW1 A;  2XR1 A;  5LCH A;  2Q0J A;  2P18 A;  5LCF A;  2DOO A;  1WUP A;  5ACT A;  3L6N A;  2AIO A;  1ZKP A;  2Q0I A;  2FU8 A;  2WYM A;  2I7X A;  5EVK A;  3Q6V A;  2YCB A;  4UWO B;  3SPU A;  5ACR A;  2NZF A;  1MQO A;  3SD9 A;  2A7M A;  4LE6 A;  3IE0 A;  5ACP A;  2FU9 A;  4NQ6 A;  4AD9 A;  5A0V A;  2GCU A;  1A8T A;  3KNR A;  4D1V A;  2Y8A A;  3BC2 A;  2ZWR A;  2H6A A;  4EYF A;  2GFK A;  3H3E A;  2M5D A;  5KIK A;  2BFZ B;  3SW3 A;  1KR3 A;  5ACX A;  3AJ3 A;  3I0V A;  4NQ5 A;  3S0Z A;  2BG8 B;  4FSB A;  4UA4 A;  4KEP A;  5LMC A;  3ADR A;  2UYX A;  4XUK A;  1DD6 A;  2Q9U A;  2BG8 A;  2NZE A;  4RM5 A;  2ZZI A;  2BFL A;  5HIS A;  5K4M A;  3T9M A;  3SRX A;  1QH5 A;  4DIK A;  4NQ2 A;  2BMI A;  3PY5 A;  4D1W A;  3BV6 A;  2YNW A;  3IOG A;  3ZR9 A;  4C1F A;  4UBQ A;  2BGA A;  4NQ4 A;  3ZQ4 A;  1VJN A;  3BK2 A;  3KL7 A;  4C1C A;  2NXA A;  3I11 A;  4EYB A;  4HL1 A;  2GFJ A;  2WYM C;  1X8I A;  1VME A;  5KIL A;  2GMN A;  3IE2 A;  5K0W A;  2GKL A;  4RAW A;  5B3R A;  3AF6 A;  5B1U A;  2FU6 A;  1KO2 A;  4HKY A;  2Q42 A;  2M5C A;  5EVD A;  3ESH A;  2P97 A;  3FCZ A;  4YSL A;  2WHG A;  2QDT A;  2OHI A;  5ACS A;  4UAM A;  5ACU A;  4AWY B;  3ZNB A;  5AEB A;  4EXY A;  3VQZ A;  3T3N A;  5A0T A;  4H0D A;  2P1E A;  4GYQ A;  4TZE A;  2P4Z A;  2BC2 A;  3G1P A;  2WYL A;  3RKJ A;  4RBS A;  4D1T A;  4C1G A;  2YNU A;  4FR7 A;  4C1E A;  4EFZ A;  4Z60 A;  1P9E A;  1YCF A;  3T3O A;  1ZTC A;  2QED A;  2YNT B;  4UWR B;  3DH8 A;  4Z5Y A;  3DHC A;  1XM8 A;  5FQB A;  4YSK A;  3TP9 A;  4TYF A;  3PG4 A;  1E5D A;  1DXK A;  2FM6 A;  4GCW A;  1ZNB A;  5LE1 A;  2BFZ A;  4F6H A;  1M2X A;  2OHJ A;  4UWS B;  2BG6 A;  5ACQ A;  4ZO3 A;  1JJT A;  2ZNB A;  3IE1 A;  3LVZ A;  4Z67 A;  4EY2 A;  2BG2 A;  4TZ9 A;  4RAM A;  3QH8 A;  2BFK A;  2CBN A;  2FHX A;  1BVT A;  4HL2 A;  5K4K A;  4J5F A;  5AYA A;  2Y87 A;  5FQA A;  5ACV A;  4WD6 A;  2Y8B A;  3AF5 A;  3X2Y A;  4XWW A;  2I7V A;  3FAI A;  3X2X A;  3F9O A;  5HIP A;  4EYL A;  5LLD A;  5DPX A;  3IDZ A;  2AZ4 A;  1YCG A;  4TZF A;  3I13 A;  3WXC A;  5B15 A;  4C1D A;  3RKK A;  1JT1 A;  2HB9 A;  5LSC A;  1JJE A;  4D02 A;  2I7T A;  4AX0 B;  5AXR A;  4AWZ A;  4CHL A;  2QJS A;  5AHR A;  5AXO A;  1L9Y A;  2YNV B;  2YNT A;  3JXP A;  3I15 A;  3BK1 A;  4ZO2 A;  1WUO A;  1X8G A;  4TZB A;  5EV8 A;  4RL2 A;  1SML A;  5A87 A;  5HH6 A;  1QH3 A;  1KO3 A;  5AHO A;  5EWA A;  5LCA A;  4YSB A;  4FEK A;  5EW0 A;  3MD7 A;  4TYT A;  2DKF A;  4B87 A;  1K07 A;  3KNS A;  5ACW A;  4V0H A;  5IQK A;  3X2Z A;  3IEL A;  4EXS A;  5A5Z A;  5HH4 A;  4ZEJ A;  2BR6 A;  2QDS A;  2E7Y A;  3I14 A;  1VGN A;  1YCH A;  5EHT A;  3R2U A;  4KEQ A;  4D1U A;  2ZO4 A;  3A4Y A;  4JO0 A;  5K4N A;  5HIO A;  1XTO A;  5LM6 A;  4U4L A;  5HIQ A;  3SFP A;  3DHA A;  4AX1 B;  4BZ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...