2WYMC

Structure of a metallo-b-lactamase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
336
structure length
297
Chain Sequence
SKVKSITRESWILSTFPEWGSWLNEEIEQEQVAPGTFAMWWLGCTGIWLKSEGGTNVCVDFWCGTGKQSHGQPNLRTTPFVLDPFAIRQIDAVLATHDHNDHIDVNVAAAVMQNCADDVPFIGPKTCVDLWIGWGVPKERCIVVKPGDVVKVKDIEIHALDAFGMDDRAVNYLFKTPGGSLYHSGDSHYSNYYAKHGNEHQIDVALGSYGENPRGITDKMTSADMLRMGEALNAKVVIPFHHDIWSNFQADPQEIRVLWEMKKDRLKYGFKPFIWQVGGKFTWPLDKDNFEYHYPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-ASCORBATE-6-PHOSPHATE LACTONASE ULAG
publication title Molecular Architecture of the Mn(2+)Dependent Lactonase Ulag Reveals an Rnase-Like Metallo-Beta-Lactamase Fold and a Novel Quaternary Structure.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 92
structure length 297
sequence length 336
chains with identical sequence F
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13483 Lactamase_B_3 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2wymC00
3I15A 2BG6A 4EXYA 4NQ6A 4UWRB 4XWWA 2R2DA 2H6AA 2E7YA 3RKJA 5FQAA 4HL2A 4FEKA 5EVKA 2YNTB 1BVTA 2YZ3A 5LCFA 2AZ4A 4Z67A 2WYLA 4EFZA 4TZEA 3T3NA 2OHJA 3KNSA 5DPXA 3IDZA 5ACTA 5K0WA 2BFZB 1JJTA 2P1EA 4YSLA 1QH3A 5FQBA 4LE6A 1KO3A 2BG7A 2GCUA 2NXAA 2QEDA 2QDTA 3I0VA 3X2YA 1K07A 1WUPA 3T9MA 5EVBA 3L6NA 2Y87A 1HLKA 4C1HA 2UYXA 3H3EA 3BK2A 3I13A 2I7XA 1L9YA 1BC2A 5LSCA 3VPEA 3X2ZA 5IQKA 5K4NA 4HL1A 4RL0A 4V0HA 5HIQA 4RL2A 5ACSA 3AF6A 4FSBA 3BC2A 1A7TA 5AYAA 4C1FA 3ZNBA 4C1GA 4DILA 2P97A 5FQCA 1WUOA 2ZZIA 1MQOA 2BG8B 1XTOA 2Y8AA 1Y44A 5EHTA 3FAIA 3WXCA 5HISA 2QINA 4C1DA 1SMLA 1VGNA 3SRXA 4NQ4A 5EH9A 2FM6A 4U4LA 1A8TA 5HIPA 2WYMA 2YNVB 5B1UA 3SBLA 1DD6A 2BFLA 5EV8A 4AWYB 5LE1A 4RBSA 1M2XA 3ESHA 3DH8A 3PG4A 2ZNBA 2NZEA 5EV6A 1P9EA 4ZEJA 1X8IA 1VMEA 3SD9A 1XM8A 2Q42A 4EYBA 2Q9UA 4Z5YA 1QH5A 1KR3A 2NYPA 2ZWRA 4TYTA 2CBNA 5A5ZA 3Q6VA 3IOGA 4GYQA 3IEMA 3PY5A 3AF5A 1YCFA 4D1TA 3BK1A 2P4ZA 5HH4A 2YCBA 5ACQA 4CHLA 4KEQA 3DHAA 5A0TA 4ZO2A 3SFPA 3SW3A 4C09A 2M5CA 2BFKA 2P18A 2AIOA 4F6ZA 4TZ9A 4PVTA 3P2UA 4ZO3A 1X8GA 3ZR9A 2FU8A 4EYFA 3IE2A 4DIKA 2GKLA 3VQZA 5KIKA 3IE0A 3X2XA 3QH8A 1VJNA 5K4KA 5ACVA 4B87A 4Z60A 4FR7A 5HIOA 3SPUA 3I11A 3IEKA 4PVOA 3IE1A 2BG8A 4TZBA 5LMCA 2BG2A 2BR6A 5LCHA 2XF4A 1X8HA 3S0ZA 3AJ3A 5ACWA 2FU9A 4UA4A 2ZO4A 3FCZA 3DHBA 1YCHA 5ACUA 2YNVA 5EWAA 4EYLA 4UBQA 2NZFA 5AHRA 1YCGA 1WRAA 2I7VA 4BP0A 4YSKA 2GMNA 2I7TA 3KL7A 3KNRA 2QJSA 5A87A 2WRSA 4J5FA 2Q0JA 3LVZA 2BIBA 1JJEA 3R2UA 5AHOA 5LS3A 4C1EA 4WD6A 2BGAA 4AWZA 4UAMA 2YNUA 2YNTA 5B3RA 5HH6A 2FU6A 4XWTA 5AEBA 1ZTCA 4D02A 2BFZA 4UWPB 2Q0IA 1ZNBA 4J5HA 5ACPA 5B15A 5A0VA 1JT1A 1WW1A 5HH5A 3MD7A 2DKFA 4AD9A 2VW8A 3G1PA 3RPCA 3T3OA 2FHXB 4KEPA 3ADRA 4EXSA 2BTNA 4AX1B 3PY6A 1ZKPA 4RM5A 1E5DA 2HB9A 2YNWA 4Z7RA 4O98A 5KILA 4H0DA 4HKYA 5LLDA 2DOOA 4NQ2A 2OHIA 4XUKA 4Z6XA 4TYFA 4P62A 2A7MA 3F9OA 4F6HA 2QDSA 2FK6A 2XR1A 3ZQ4A 3I14A 3IOFA 2BMIA 2GFKA 4UWSB 3RKKA 5K4MA 5AXOA 5ACXA 1KO2A 3JXPA 2OHHA 4AX0B 4D1VA 3DHCA 2Y8BA 5AXRA 2WYMC 3IELA 4D1UA 3A4YA 4C1CA 4EY2A 3TP9A 4YSBA 3X30A 4TZFA 2BC2A 1BMCA 4UWOB 3BV6A 4RAMA 2M5DA 4BZ3A 5LM6A 4D1WA 4JO0A 5ACRA 3ZWFA 1DDKA 2FU7A 2GFJA 4GYUA 4ZNBA 4NQ5A 4RAWA 2FHXA 5EVDA 5EW0A 4Z5ZA 1DXKA 4GCWA 5LCAA 2WHGA
chains in the Genus database with same CATH superfamily
3I15A 2BG6A 4EXYA 2CG2A 4NQ6A 4UWRB 4XWWA 2R2DA 2H6AA 4NURA 2CG3A 2E7YA 3RKJA 5FQAA 5AJLA 4HL2A 4FEKA 5EVKA 2YNTB 1BVTA 2YZ3A 5LCFA 2AZ4A 4Z67A 2WYLA 4EFZA 4TZEA 3T3NA 2OHJA 3KNSA 5DPXA 3IDZA 5ACTA 5K0WA 2BFZB 1JJTA 2P1EA 4YSLA 1QH3A 5FQBA 4LE6A 1KO3A 2BG7A 2GCUA 2NXAA 2QEDA 2QDTA 3I0VA 3X2YA 1K07A 1WUPA 3T9MA 5EVBA 3L6NA 2Y87A 1HLKA 4C1HA 2UYXA 3H3EA 3BK2A 3I13A 2I7XA 1L9YA 1BC2A 5LSCA 3VPEA 3X2ZA 5IQKA 5K4NA 4HL1A 2CFZA 5A23A 4RL0A 4V0HA 5HIQA 4RL2A 5ACSA 3AF6A 4FSBA 3BC2A 1A7TA 5AYAA 4C1FA 3ZNBA 4C1GA 4DILA 2P97A 5FQCA 1WUOA 2ZZIA 1MQOA 2BG8B 1XTOA 2Y8AA 1Y44A 5EHTA 3FAIA 3WXCA 5HISA 2QINA 4C1DA 1SMLA 1VGNA 3SRXA 4NQ4A 5EH9A 2FM6A 4U4LA 1A8TA 5HIPA 2WYMA 2YNVB 5B1UA 3SBLA 1DD6A 2BFLA 5EV8A 4AWYB 5LE1A 4RBSA 1M2XA 3ESHA 3DH8A 3PG4A 2ZNBA 2NZEA 5EV6A 1P9EA 4ZEJA 1X8IA 1VMEA 3SD9A 1XM8A 2Q42A 4EYBA 2Q9UA 4Z5YA 1QH5A 1KR3A 2NYPA 2ZWRA 4TYTA 2CBNA 5A5ZA 3Q6VA 3IOGA 4GYQA 3IEMA 3PY5A 3AF5A 1YCFA 4D1TA 3BK1A 2P4ZA 5HH4A 2YCBA 5ACQA 4CHLA 4KEQA 3DHAA 5A0TA 4ZO2A 3SFPA 3SW3A 4C09A 2M5CA 2BFKA 2P18A 2AIOA 4F6ZA 4TZ9A 4PVTA 3P2UA 4ZO3A 1X8GA 3ZR9A 2FU8A 4EYFA 3IE2A 4DIKA 2GKLA 3VQZA 5KIKA 3IE0A 3X2XA 3QH8A 1VJNA 5K4KA 5ACVA 4B87A 4Z60A 4FR7A 5HIOA 3SPUA 3I11A 3IEKA 4PVOA 3IE1A 2BG8A 4TZBA 5LMCA 2BG2A 2BR6A 5LCHA 2XF4A 1X8HA 3S0ZA 3AJ3A 5ACWA 2FU9A 4UA4A 2ZO4A 3FCZA 3DHBA 1YCHA 5ACUA 2YNVA 5EWAA 4EYLA 4UBQA 2NZFA 5AHRA 1YCGA 1WRAA 2I7VA 4BP0A 4YSKA 2GMNA 2I7TA 3KL7A 3KNRA 4AXHA 2QJSA 5A87A 2WRSA 4J5FA 2Q0JA 3LVZA 2BIBA 1JJEA 3R2UA 5AHOA 5LS3A 4C1EA 4WD6A 2BGAA 4AWZA 4UAMA 2YNUA 2YNTA 5B3RA 5HH6A 2FU6A 4XWTA 5AEBA 1ZTCA 4D02A 2BFZA 4UWPB 2Q0IA 1ZNBA 4J5HA 5ACPA 5B15A 5A0VA 1JT1A 1WW1A 5HH5A 3MD7A 2DKFA 4AD9A 2VW8A 3G1PA 3RPCA 3T3OA 2FHXB 4KEPA 3ADRA 4EXSA 2BTNA 4AX1B 3PY6A 1ZKPA 4RM5A 1E5DA 2HB9A 2YNWA 4Z7RA 4O98A 5KILA 4H0DA 4HKYA 5LLDA 2DOOA 4NQ2A 2OHIA 4XUKA 2YHEA 4TYFA 4Z6XA 4P62A 2A7MA 3F9OA 4F6HA 2QDSA 5AIJA 2FK6A 2XR1A 3ZQ4A 3I14A 3IOFA 2BMIA 2GFKA 4UWSB 3RKKA 5K4MA 5AXOA 5ACXA 1KO2A 3JXPA 2OHHA 4AX0B 4D1VA 4AV7A 3DHCA 2Y8BA 5AXRA 2WYMC 3IELA 4D1UA 3A4YA 4C1CA 4EY2A 3TP9A 4YSBA 3X30A 4TZFA 2BC2A 1BMCA 4UWOB 3BV6A 4RAMA 2M5DA 4BZ3A 5LM6A 4D1WA 4JO0A 5ACRA 3ZWFA 1DDKA 2CFUA 4PDXA 2FU7A 2GFJA 4GYUA 4ZNBA 4NQ5A 4RAWA 2FHXA 5EVDA 5EW0A 4Z5ZA 1DXKA 4GCWA 5LCAA 2WHGA
chains in the Genus database with same CATH topology
3I15A 2BG6A 4EXYA 4NQ6A 4UWRB 4XWWA 2R2DA 2H6AA 2E7YA 3RKJA 5FQAA 4HL2A 4FEKA 5EVKA 2YNTB 1BVTA 2YZ3A 5LCFA 2AZ4A 4Z67A 2WYLA 4EFZA 4TZEA 3T3NA 2OHJA 3KNSA 5DPXA 3IDZA 5ACTA 5K0WA 2BFZB 1JJTA 2P1EA 4YSLA 1QH3A 5FQBA 4LE6A 1KO3A 2BG7A 2GCUA 2NXAA 2QEDA 2QDTA 3I0VA 3X2YA 1K07A 1WUPA 3T9MA 5EVBA 3L6NA 2Y87A 1HLKA 4C1HA 2UYXA 3H3EA 3BK2A 3I13A 2I7XA 1L9YA 1BC2A 5LSCA 3VPEA 3X2ZA 5IQKA 5K4NA 4HL1A 4RL0A 4V0HA 5HIQA 4RL2A 5ACSA 3AF6A 4FSBA 3BC2A 1A7TA 5AYAA 4C1FA 3ZNBA 4C1GA 4DILA 2P97A 5FQCA 1WUOA 2ZZIA 1MQOA 2BG8B 1XTOA 2Y8AA 1Y44A 5EHTA 3FAIA 3WXCA 5HISA 2QINA 4C1DA 1SMLA 1VGNA 3SRXA 4NQ4A 5EH9A 2FM6A 4U4LA 1A8TA 5HIPA 2WYMA 2YNVB 5B1UA 3SBLA 1DD6A 2BFLA 5EV8A 4AWYB 5LE1A 4RBSA 1M2XA 3ESHA 3DH8A 3PG4A 2ZNBA 2NZEA 5EV6A 1P9EA 4ZEJA 1X8IA 1VMEA 3SD9A 1XM8A 2Q42A 4EYBA 2Q9UA 4Z5YA 1QH5A 1KR3A 2NYPA 2ZWRA 4TYTA 2CBNA 5A5ZA 3Q6VA 3IOGA 4GYQA 3IEMA 3PY5A 3AF5A 1YCFA 4D1TA 3BK1A 2P4ZA 5HH4A 2YCBA 5ACQA 4CHLA 4KEQA 3DHAA 5A0TA 4ZO2A 3SFPA 3SW3A 4C09A 2M5CA 2BFKA 2P18A 2AIOA 4F6ZA 4TZ9A 4PVTA 3P2UA 4ZO3A 1X8GA 3ZR9A 2FU8A 4EYFA 3IE2A 4DIKA 2GKLA 3VQZA 5KIKA 3IE0A 3X2XA 3QH8A 1VJNA 5K4KA 5ACVA 4B87A 4Z60A 4FR7A 5HIOA 3SPUA 3I11A 3IEKA 4PVOA 3IE1A 2BG8A 4TZBA 5LMCA 2BG2A 2BR6A 5LCHA 2XF4A 1X8HA 3S0ZA 3AJ3A 5ACWA 2FU9A 4UA4A 2ZO4A 3FCZA 3DHBA 1YCHA 5ACUA 2YNVA 5EWAA 4EYLA 4UBQA 2NZFA 5AHRA 1YCGA 1WRAA 2I7VA 4BP0A 4YSKA 2GMNA 2I7TA 3KL7A 3KNRA 2QJSA 5A87A 2WRSA 4J5FA 2Q0JA 3LVZA 2BIBA 1JJEA 3R2UA 5AHOA 5LS3A 4C1EA 4WD6A 2BGAA 4AWZA 4UAMA 2YNUA 2YNTA 5B3RA 5HH6A 2FU6A 4XWTA 5AEBA 1ZTCA 4D02A 2BFZA 4UWPB 2Q0IA 1ZNBA 4J5HA 5ACPA 5B15A 5A0VA 1JT1A 1WW1A 5HH5A 3MD7A 2DKFA 4AD9A 2VW8A 3G1PA 3RPCA 3T3OA 2FHXB 4KEPA 3ADRA 4EXSA 2BTNA 4AX1B 3PY6A 1ZKPA 4RM5A 1E5DA 2HB9A 2YNWA 4Z7RA 4O98A 5KILA 4H0DA 4HKYA 5LLDA 2DOOA 4NQ2A 2OHIA 4XUKA 4Z6XA 4TYFA 4P62A 2A7MA 3F9OA 4F6HA 2QDSA 2FK6A 2XR1A 3ZQ4A 3I14A 3IOFA 2BMIA 2GFKA 4UWSB 3RKKA 5K4MA 5AXOA 5ACXA 1KO2A 3JXPA 2OHHA 4AX0B 4D1VA 3DHCA 2Y8BA 5AXRA 2WYMC 3IELA 4D1UA 3A4YA 4C1CA 4EY2A 3TP9A 4YSBA 3X30A 4TZFA 2BC2A 1BMCA 4UWOB 3BV6A 4RAMA 2M5DA 4BZ3A 5LM6A 4D1WA 4JO0A 5ACRA 3ZWFA 1DDKA 2FU7A 2GFJA 4GYUA 4ZNBA 4NQ5A 4RAWA 2FHXA 5EVDA 5EW0A 4Z5ZA 1DXKA 4GCWA 5LCAA 2WHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I15 A;  2BG6 A;  4EXY A;  4NQ6 A;  4UWR B;  4XWW A;  2R2D A;  2H6A A;  2E7Y A;  3RKJ A;  5FQA A;  4HL2 A;  4FEK A;  5EVK A;  2YNT B;  1BVT A;  2YZ3 A;  5LCF A;  2AZ4 A;  4Z67 A;  2WYL A;  4EFZ A;  4TZE A;  3T3N A;  2OHJ A;  3KNS A;  5DPX A;  3IDZ A;  5ACT A;  5K0W A;  2BFZ B;  1JJT A;  2P1E A;  4YSL A;  1QH3 A;  5FQB A;  4LE6 A;  1KO3 A;  2BG7 A;  2GCU A;  2NXA A;  2QED A;  2QDT A;  3I0V A;  3X2Y A;  1K07 A;  1WUP A;  3T9M A;  5EVB A;  3L6N A;  2Y87 A;  1HLK A;  4C1H A;  2UYX A;  3H3E A;  3BK2 A;  3I13 A;  2I7X A;  1L9Y A;  1BC2 A;  5LSC A;  3VPE A;  3X2Z A;  5IQK A;  5K4N A;  4HL1 A;  4RL0 A;  4V0H A;  5HIQ A;  4RL2 A;  5ACS A;  3AF6 A;  4FSB A;  3BC2 A;  1A7T A;  5AYA A;  4C1F A;  3ZNB A;  4C1G A;  4DIL A;  2P97 A;  5FQC A;  1WUO A;  2ZZI A;  1MQO A;  2BG8 B;  1XTO A;  2Y8A A;  1Y44 A;  5EHT A;  3FAI A;  3WXC A;  5HIS A;  2QIN A;  4C1D A;  1SML A;  1VGN A;  3SRX A;  4NQ4 A;  5EH9 A;  2FM6 A;  4U4L A;  1A8T A;  5HIP A;  2WYM A;  2YNV B;  5B1U A;  3SBL A;  1DD6 A;  2BFL A;  5EV8 A;  4AWY B;  5LE1 A;  4RBS A;  1M2X A;  3ESH A;  3DH8 A;  3PG4 A;  2ZNB A;  2NZE A;  5EV6 A;  1P9E A;  4ZEJ A;  1X8I A;  1VME A;  3SD9 A;  1XM8 A;  2Q42 A;  4EYB A;  2Q9U A;  4Z5Y A;  1QH5 A;  1KR3 A;  2NYP A;  2ZWR A;  4TYT A;  2CBN A;  5A5Z A;  3Q6V A;  3IOG A;  4GYQ A;  3IEM A;  3PY5 A;  3AF5 A;  1YCF A;  4D1T A;  3BK1 A;  2P4Z A;  5HH4 A;  2YCB A;  5ACQ A;  4CHL A;  4KEQ A;  3DHA A;  5A0T A;  4ZO2 A;  3SFP A;  3SW3 A;  4C09 A;  2M5C A;  2BFK A;  2P18 A;  2AIO A;  4F6Z A;  4TZ9 A;  4PVT A;  3P2U A;  4ZO3 A;  1X8G A;  3ZR9 A;  2FU8 A;  4EYF A;  3IE2 A;  4DIK A;  2GKL A;  3VQZ A;  5KIK A;  3IE0 A;  3X2X A;  3QH8 A;  1VJN A;  5K4K A;  5ACV A;  4B87 A;  4Z60 A;  4FR7 A;  5HIO A;  3SPU A;  3I11 A;  3IEK A;  4PVO A;  3IE1 A;  2BG8 A;  4TZB A;  5LMC A;  2BG2 A;  2BR6 A;  5LCH A;  2XF4 A;  1X8H A;  3S0Z A;  3AJ3 A;  5ACW A;  2FU9 A;  4UA4 A;  2ZO4 A;  3FCZ A;  3DHB A;  1YCH A;  5ACU A;  2YNV A;  5EWA A;  4EYL A;  4UBQ A;  2NZF A;  5AHR A;  1YCG A;  1WRA A;  2I7V A;  4BP0 A;  4YSK A;  2GMN A;  2I7T A;  3KL7 A;  3KNR A;  2QJS A;  5A87 A;  2WRS A;  4J5F A;  2Q0J A;  3LVZ A;  2BIB A;  1JJE A;  3R2U A;  5AHO A;  5LS3 A;  4C1E A;  4WD6 A;  2BGA A;  4AWZ A;  4UAM A;  2YNU A;  2YNT A;  5B3R A;  5HH6 A;  2FU6 A;  4XWT A;  5AEB A;  1ZTC A;  4D02 A;  2BFZ A;  4UWP B;  2Q0I A;  1ZNB A;  4J5H A;  5ACP A;  5B15 A;  5A0V A;  1JT1 A;  1WW1 A;  5HH5 A;  3MD7 A;  2DKF A;  4AD9 A;  2VW8 A;  3G1P A;  3RPC A;  3T3O A;  2FHX B;  4KEP A;  3ADR A;  4EXS A;  2BTN A;  4AX1 B;  3PY6 A;  1ZKP A;  4RM5 A;  1E5D A;  2HB9 A;  2YNW A;  4Z7R A;  4O98 A;  5KIL A;  4H0D A;  4HKY A;  5LLD A;  2DOO A;  4NQ2 A;  2OHI A;  4XUK A;  4Z6X A;  4TYF A;  4P62 A;  2A7M A;  3F9O A;  4F6H A;  2QDS A;  2FK6 A;  2XR1 A;  3ZQ4 A;  3I14 A;  3IOF A;  2BMI A;  2GFK A;  4UWS B;  3RKK A;  5K4M A;  5AXO A;  5ACX A;  1KO2 A;  3JXP A;  2OHH A;  4AX0 B;  4D1V A;  3DHC A;  2Y8B A;  5AXR A;  2WYM C;  3IEL A;  4D1U A;  3A4Y A;  4C1C A;  4EY2 A;  3TP9 A;  4YSB A;  3X30 A;  4TZF A;  2BC2 A;  1BMC A;  4UWO B;  3BV6 A;  4RAM A;  2M5D A;  4BZ3 A;  5LM6 A;  4D1W A;  4JO0 A;  5ACR A;  3ZWF A;  1DDK A;  2FU7 A;  2GFJ A;  4GYU A;  4ZNB A;  4NQ5 A;  4RAW A;  2FHX A;  5EVD A;  5EW0 A;  4Z5Z A;  1DXK A;  4GCW A;  5LCA A;  2WHG A; 
#chains in the Genus database with same CATH topology
 3I15 A;  2BG6 A;  4EXY A;  2CG2 A;  4NQ6 A;  4UWR B;  4XWW A;  2R2D A;  2H6A A;  4NUR A;  2CG3 A;  2E7Y A;  3RKJ A;  5FQA A;  5AJL A;  4HL2 A;  4FEK A;  5EVK A;  2YNT B;  1BVT A;  2YZ3 A;  5LCF A;  2AZ4 A;  4Z67 A;  2WYL A;  4EFZ A;  4TZE A;  3T3N A;  2OHJ A;  3KNS A;  5DPX A;  3IDZ A;  5ACT A;  5K0W A;  2BFZ B;  1JJT A;  2P1E A;  4YSL A;  1QH3 A;  5FQB A;  4LE6 A;  1KO3 A;  2BG7 A;  2GCU A;  2NXA A;  2QED A;  2QDT A;  3I0V A;  3X2Y A;  1K07 A;  1WUP A;  3T9M A;  5EVB A;  3L6N A;  2Y87 A;  1HLK A;  4C1H A;  2UYX A;  3H3E A;  3BK2 A;  3I13 A;  2I7X A;  1L9Y A;  1BC2 A;  5LSC A;  3VPE A;  3X2Z A;  5IQK A;  5K4N A;  4HL1 A;  2CFZ A;  5A23 A;  4RL0 A;  4V0H A;  5HIQ A;  4RL2 A;  5ACS A;  3AF6 A;  4FSB A;  3BC2 A;  1A7T A;  5AYA A;  4C1F A;  3ZNB A;  4C1G A;  4DIL A;  2P97 A;  5FQC A;  1WUO A;  2ZZI A;  1MQO A;  2BG8 B;  1XTO A;  2Y8A A;  1Y44 A;  5EHT A;  3FAI A;  3WXC A;  5HIS A;  2QIN A;  4C1D A;  1SML A;  1VGN A;  3SRX A;  4NQ4 A;  5EH9 A;  2FM6 A;  4U4L A;  1A8T A;  5HIP A;  2WYM A;  2YNV B;  5B1U A;  3SBL A;  1DD6 A;  2BFL A;  5EV8 A;  4AWY B;  5LE1 A;  4RBS A;  1M2X A;  3ESH A;  3DH8 A;  3PG4 A;  2ZNB A;  2NZE A;  5EV6 A;  1P9E A;  4ZEJ A;  1X8I A;  1VME A;  3SD9 A;  1XM8 A;  2Q42 A;  4EYB A;  2Q9U A;  4Z5Y A;  1QH5 A;  1KR3 A;  2NYP A;  2ZWR A;  4TYT A;  2CBN A;  5A5Z A;  3Q6V A;  3IOG A;  4GYQ A;  3IEM A;  3PY5 A;  3AF5 A;  1YCF A;  4D1T A;  3BK1 A;  2P4Z A;  5HH4 A;  2YCB A;  5ACQ A;  4CHL A;  4KEQ A;  3DHA A;  5A0T A;  4ZO2 A;  3SFP A;  3SW3 A;  4C09 A;  2M5C A;  2BFK A;  2P18 A;  2AIO A;  4F6Z A;  4TZ9 A;  4PVT A;  3P2U A;  4ZO3 A;  1X8G A;  3ZR9 A;  2FU8 A;  4EYF A;  3IE2 A;  4DIK A;  2GKL A;  3VQZ A;  5KIK A;  3IE0 A;  3X2X A;  3QH8 A;  1VJN A;  5K4K A;  5ACV A;  4B87 A;  4Z60 A;  4FR7 A;  5HIO A;  3SPU A;  3I11 A;  3IEK A;  4PVO A;  3IE1 A;  2BG8 A;  4TZB A;  5LMC A;  2BG2 A;  2BR6 A;  5LCH A;  2XF4 A;  1X8H A;  3S0Z A;  3AJ3 A;  5ACW A;  2FU9 A;  4UA4 A;  2ZO4 A;  3FCZ A;  3DHB A;  1YCH A;  5ACU A;  2YNV A;  5EWA A;  4EYL A;  4UBQ A;  2NZF A;  5AHR A;  1YCG A;  1WRA A;  2I7V A;  4BP0 A;  4YSK A;  2GMN A;  2I7T A;  3KL7 A;  3KNR A;  4AXH A;  2QJS A;  5A87 A;  2WRS A;  4J5F A;  2Q0J A;  3LVZ A;  2BIB A;  1JJE A;  3R2U A;  5AHO A;  5LS3 A;  4C1E A;  4WD6 A;  2BGA A;  4AWZ A;  4UAM A;  2YNU A;  2YNT A;  5B3R A;  5HH6 A;  2FU6 A;  4XWT A;  5AEB A;  1ZTC A;  4D02 A;  2BFZ A;  4UWP B;  2Q0I A;  1ZNB A;  4J5H A;  5ACP A;  5B15 A;  5A0V A;  1JT1 A;  1WW1 A;  5HH5 A;  3MD7 A;  2DKF A;  4AD9 A;  2VW8 A;  3G1P A;  3RPC A;  3T3O A;  2FHX B;  4KEP A;  3ADR A;  4EXS A;  2BTN A;  4AX1 B;  3PY6 A;  1ZKP A;  4RM5 A;  1E5D A;  2HB9 A;  2YNW A;  4Z7R A;  4O98 A;  5KIL A;  4H0D A;  4HKY A;  5LLD A;  2DOO A;  4NQ2 A;  2OHI A;  4XUK A;  2YHE A;  4TYF A;  4Z6X A;  4P62 A;  2A7M A;  3F9O A;  4F6H A;  2QDS A;  5AIJ A;  2FK6 A;  2XR1 A;  3ZQ4 A;  3I14 A;  3IOF A;  2BMI A;  2GFK A;  4UWS B;  3RKK A;  5K4M A;  5AXO A;  5ACX A;  1KO2 A;  3JXP A;  2OHH A;  4AX0 B;  4D1V A;  4AV7 A;  3DHC A;  2Y8B A;  5AXR A;  2WYM C;  3IEL A;  4D1U A;  3A4Y A;  4C1C A;  4EY2 A;  3TP9 A;  4YSB A;  3X30 A;  4TZF A;  2BC2 A;  1BMC A;  4UWO B;  3BV6 A;  4RAM A;  2M5D A;  4BZ3 A;  5LM6 A;  4D1W A;  4JO0 A;  5ACR A;  3ZWF A;  1DDK A;  2CFU A;  4PDX A;  2FU7 A;  2GFJ A;  4GYU A;  4ZNB A;  4NQ5 A;  4RAW A;  2FHX A;  5EVD A;  5EW0 A;  4Z5Z A;  1DXK A;  4GCW A;  5LCA A;  2WHG A; 
#chains in the Genus database with same CATH homology
 3I15 A;  2BG6 A;  4EXY A;  4NQ6 A;  4UWR B;  4XWW A;  2R2D A;  2H6A A;  2E7Y A;  3RKJ A;  5FQA A;  4HL2 A;  4FEK A;  5EVK A;  2YNT B;  1BVT A;  2YZ3 A;  5LCF A;  2AZ4 A;  4Z67 A;  2WYL A;  4EFZ A;  4TZE A;  3T3N A;  2OHJ A;  3KNS A;  5DPX A;  3IDZ A;  5ACT A;  5K0W A;  2BFZ B;  1JJT A;  2P1E A;  4YSL A;  1QH3 A;  5FQB A;  4LE6 A;  1KO3 A;  2BG7 A;  2GCU A;  2NXA A;  2QED A;  2QDT A;  3I0V A;  3X2Y A;  1K07 A;  1WUP A;  3T9M A;  5EVB A;  3L6N A;  2Y87 A;  1HLK A;  4C1H A;  2UYX A;  3H3E A;  3BK2 A;  3I13 A;  2I7X A;  1L9Y A;  1BC2 A;  5LSC A;  3VPE A;  3X2Z A;  5IQK A;  5K4N A;  4HL1 A;  4RL0 A;  4V0H A;  5HIQ A;  4RL2 A;  5ACS A;  3AF6 A;  4FSB A;  3BC2 A;  1A7T A;  5AYA A;  4C1F A;  3ZNB A;  4C1G A;  4DIL A;  2P97 A;  5FQC A;  1WUO A;  2ZZI A;  1MQO A;  2BG8 B;  1XTO A;  2Y8A A;  1Y44 A;  5EHT A;  3FAI A;  3WXC A;  5HIS A;  2QIN A;  4C1D A;  1SML A;  1VGN A;  3SRX A;  4NQ4 A;  5EH9 A;  2FM6 A;  4U4L A;  1A8T A;  5HIP A;  2WYM A;  2YNV B;  5B1U A;  3SBL A;  1DD6 A;  2BFL A;  5EV8 A;  4AWY B;  5LE1 A;  4RBS A;  1M2X A;  3ESH A;  3DH8 A;  3PG4 A;  2ZNB A;  2NZE A;  5EV6 A;  1P9E A;  4ZEJ A;  1X8I A;  1VME A;  3SD9 A;  1XM8 A;  2Q42 A;  4EYB A;  2Q9U A;  4Z5Y A;  1QH5 A;  1KR3 A;  2NYP A;  2ZWR A;  4TYT A;  2CBN A;  5A5Z A;  3Q6V A;  3IOG A;  4GYQ A;  3IEM A;  3PY5 A;  3AF5 A;  1YCF A;  4D1T A;  3BK1 A;  2P4Z A;  5HH4 A;  2YCB A;  5ACQ A;  4CHL A;  4KEQ A;  3DHA A;  5A0T A;  4ZO2 A;  3SFP A;  3SW3 A;  4C09 A;  2M5C A;  2BFK A;  2P18 A;  2AIO A;  4F6Z A;  4TZ9 A;  4PVT A;  3P2U A;  4ZO3 A;  1X8G A;  3ZR9 A;  2FU8 A;  4EYF A;  3IE2 A;  4DIK A;  2GKL A;  3VQZ A;  5KIK A;  3IE0 A;  3X2X A;  3QH8 A;  1VJN A;  5K4K A;  5ACV A;  4B87 A;  4Z60 A;  4FR7 A;  5HIO A;  3SPU A;  3I11 A;  3IEK A;  4PVO A;  3IE1 A;  2BG8 A;  4TZB A;  5LMC A;  2BG2 A;  2BR6 A;  5LCH A;  2XF4 A;  1X8H A;  3S0Z A;  3AJ3 A;  5ACW A;  2FU9 A;  4UA4 A;  2ZO4 A;  3FCZ A;  3DHB A;  1YCH A;  5ACU A;  2YNV A;  5EWA A;  4EYL A;  4UBQ A;  2NZF A;  5AHR A;  1YCG A;  1WRA A;  2I7V A;  4BP0 A;  4YSK A;  2GMN A;  2I7T A;  3KL7 A;  3KNR A;  2QJS A;  5A87 A;  2WRS A;  4J5F A;  2Q0J A;  3LVZ A;  2BIB A;  1JJE A;  3R2U A;  5AHO A;  5LS3 A;  4C1E A;  4WD6 A;  2BGA A;  4AWZ A;  4UAM A;  2YNU A;  2YNT A;  5B3R A;  5HH6 A;  2FU6 A;  4XWT A;  5AEB A;  1ZTC A;  4D02 A;  2BFZ A;  4UWP B;  2Q0I A;  1ZNB A;  4J5H A;  5ACP A;  5B15 A;  5A0V A;  1JT1 A;  1WW1 A;  5HH5 A;  3MD7 A;  2DKF A;  4AD9 A;  2VW8 A;  3G1P A;  3RPC A;  3T3O A;  2FHX B;  4KEP A;  3ADR A;  4EXS A;  2BTN A;  4AX1 B;  3PY6 A;  1ZKP A;  4RM5 A;  1E5D A;  2HB9 A;  2YNW A;  4Z7R A;  4O98 A;  5KIL A;  4H0D A;  4HKY A;  5LLD A;  2DOO A;  4NQ2 A;  2OHI A;  4XUK A;  4Z6X A;  4TYF A;  4P62 A;  2A7M A;  3F9O A;  4F6H A;  2QDS A;  2FK6 A;  2XR1 A;  3ZQ4 A;  3I14 A;  3IOF A;  2BMI A;  2GFK A;  4UWS B;  3RKK A;  5K4M A;  5AXO A;  5ACX A;  1KO2 A;  3JXP A;  2OHH A;  4AX0 B;  4D1V A;  3DHC A;  2Y8B A;  5AXR A;  2WYM C;  3IEL A;  4D1U A;  3A4Y A;  4C1C A;  4EY2 A;  3TP9 A;  4YSB A;  3X30 A;  4TZF A;  2BC2 A;  1BMC A;  4UWO B;  3BV6 A;  4RAM A;  2M5D A;  4BZ3 A;  5LM6 A;  4D1W A;  4JO0 A;  5ACR A;  3ZWF A;  1DDK A;  2FU7 A;  2GFJ A;  4GYU A;  4ZNB A;  4NQ5 A;  4RAW A;  2FHX A;  5EVD A;  5EW0 A;  4Z5Z A;  1DXK A;  4GCW A;  5LCA A;  2WHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...