2FHXA

Pseudomonas aeruginosa spm-1 metallo-beta-lactamase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
245
structure length
244
Chain Sequence
DHVDLPYNLTATKIDSDVFVVTDRDFYSSNVLVAKMLDGTVVIVSSPFENLGTQTLMDWVAKTMKPKKVVAINTHFHLDGTGGNEIYKKMGAETWSSDLTKQLRLEENKKDRIKAAEFYKNEDLKRRILSSHPVPADNVFDLKQGKVFSFSNELVEVSFPGPAHSPDNVVVYFPKKKLLFGGMIKPKELGYLGDANVKAWPDSARRLKKFDAKIVIPGHGEWGGPEMVNKTIKVAEKAVGEMRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase, metal binding protein
molecule keywords SPM-1
publication title Crystal Structure of Pseudomonas aeruginosa SPM-1 Provides Insights into Variable Zinc Affinity of Metallo-beta-lactamases.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 75
structure length 244
sequence length 245
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2fhxA00
4NQ2A 3QH8A 4Z6XA 2OHHA 5IQKA 5K4NA 3X30A 4NQ4A 2DKFA 2OHIA 3KL7A 4XWTA 5LS3A 1SMLA 4Z5YA 3I11A 5AEBA 2FHXB 2VW8A 2GFJA 3IE2A 4BZ3A 2QEDA 3PG4A 4RBSA 1L9YA 1BC2A 2BFZA 3VQZA 4RAMA 2R2DA 2NYPA 1MQOA 5LSCA 1JJTA 4ZO2A 5K4MA 1Y44A 2BFLA 3IEKA 4WD6A 2BG7A 3IE1A 2I7TA 4JO0A 1HLKA 2QDSA 5EHTA 2I7VA 4UBQA 5B15A 2XF4A 5HIQA 2BMIA 1ZTCA 4FSBA 1ZNBA 5HH5A 2Y87A 2UYXA 2WYMC 1P9EA 3BK1A 2P18A 5ACQA 3RKJA 4XUKA 2FU8A 1QH3A 5KILA 4NQ6A 5ACSA 2BG2A 2FU7A 2FU6A 3SW3A 1DXKA 4D1TA 4EFZA 4TYTA 2NZEA 2GMNA 4AWZA 4Z60A 3I0VA 3T9MA 4LE6A 1X8IA 2YNVA 2BGAA 3ZWFA 3TP9A 5HIOA 3AF5A 4Z5ZA 1E5DA 3R2UA 2Q42A 3Q6VA 2FK6A 1KR3A 5FQBA 3IOGA 5AXOA 2YNWA 2Q9UA 1BMCA 1VJNA 5HH4A 4ZO3A 5A5ZA 2FM6A 5LLDA 2HB9A 1DD6A 3PY5A 5LM6A 4P62A 5AHOA 3SFPA 5LCFA 3P2UA 5LCAA 3SRXA 3KNRA 1X8HA 4HL2A 3S0ZA 1WUPA 4EXSA 5EV8A 1JJEA 5ACXA 4C1DA 3A4YA 1ZKPA 3FAIA 4XWWA 2CBNA 4RL2A 4C1GA 4UWPB 5EVBA 2OHJA 4D1WA 4KEQA 1KO2A 2BIBA 1M2XA 3ZNBA 5AHRA 2BFKA 4EYLA 5KIKA 2BTNA 3H3EA 5EVDA 4EYFA 2M5DA 4EXYA 2WYLA 3I15A 4U4LA 3T3OA 2ZNBA 2QDTA 4CHLA 5LCHA 2GKLA 2BG8B 2NXAA 1XTOA 5K4KA 5B1UA 5HISA 2P1EA 4C09A 3FCZA 3IDZA 3WXCA 4FR7A 4TZEA 1JT1A 3SD9A 2YNTB 3ZR9A 3VPEA 3ZQ4A 4B87A 3RKKA 3BK2A 4UWRB 1BVTA 2QINA 2AZ4A 2GFKA 3DHBA 2GCUA 5HIPA 2BR6A 1XM8A 1KO3A 2P97A 2AIOA 5EV6A 3L6NA 4DILA 2Q0JA 4RAWA 2H6AA 2WRSA 1YCFA 4GYQA 3JXPA 5HH6A 5AYAA 5B3RA 2FHXA 3AF6A 2ZZIA 4TZBA 5ACWA 2QJSA 5A0VA 3BC2A 3X2XA 1X8GA 4DIKA 4AX1B 2BG6A 3SBLA 4D1VA 4EY2A 4F6ZA 4Z67A 5ACTA 3DHAA 3PY6A 1WW1A 3I14A 1YCGA 4H0DA 3IELA 4C1CA 4C1FA 1DDKA 3AJ3A 3MD7A 3G1PA 2YZ3A 4GCWA 4TZFA 1WUOA 4AD9A 4TYFA 4UAMA 1A7TA 5FQCA 3IEMA 2BG8A 4EYBA 2E7YA 5FQAA 4C1HA 5LMCA 4J5FA 2DOOA 4RM5A 4D1UA 4YSBA 3X2ZA 2I7XA 2WHGA 5EVKA 3KNSA 2BFZB 2Y8BA 4Z7RA 4F6HA 4HL1A 2YNTA 4GYUA 2WYMA 2Q0IA 1K07A 3I13A 2YCBA 5A0TA 2NZFA 4RL0A 4V0HA 3DH8A 4NQ5A 4PVOA 4PVTA 5DPXA 4TZ9A 5LE1A 3T3NA 4HKYA 3IOFA 1WRAA 1YCHA 3BV6A 1A8TA 2BC2A 5EWAA 4UA4A 5ACVA 2FU9A 5EW0A 5AXRA 4BP0A 5ACPA 3DHCA 4O98A 4ZNBA 3F9OA 3SPUA 5ACRA 5EH9A 4UWOB 3ADRA 1QH5A 4C1EA 2P4ZA 5ACUA 1VGNA 2Y8AA 4FEKA 1VMEA 4ZEJA 4D02A 3ESHA 4AX0B 3X2YA 4YSKA 4KEPA 4UWSB 5K0WA 2XR1A 2ZWRA 2YNUA 2YNVB 3LVZA 4YSLA 3RPCA 4AWYB 3IE0A 2A7MA 2M5CA 4J5HA 2ZO4A 5A87A
chains in the Genus database with same CATH superfamily
4NQ2A 3QH8A 4Z6XA 2OHHA 5IQKA 5K4NA 3X30A 4NQ4A 2DKFA 2OHIA 3KL7A 4XWTA 5LS3A 1SMLA 4Z5YA 3I11A 5AEBA 2FHXB 2VW8A 2GFJA 3IE2A 4BZ3A 2QEDA 3PG4A 4RBSA 1L9YA 1BC2A 2BFZA 3VQZA 4RAMA 2R2DA 2NYPA 1MQOA 5LSCA 1JJTA 4ZO2A 5K4MA 1Y44A 4AV7A 2BFLA 3IEKA 4NURA 4WD6A 2BG7A 3IE1A 2I7TA 4JO0A 1HLKA 2QDSA 5EHTA 2I7VA 4UBQA 5B15A 2XF4A 5HIQA 2BMIA 1ZTCA 4FSBA 1ZNBA 5HH5A 2Y87A 2UYXA 2WYMC 1P9EA 3BK1A 2P18A 5ACQA 3RKJA 4XUKA 2FU8A 1QH3A 5KILA 4NQ6A 5ACSA 2BG2A 2FU7A 2FU6A 3SW3A 1DXKA 4D1TA 4EFZA 4TYTA 2NZEA 2GMNA 4AWZA 4Z60A 3I0VA 3T9MA 4LE6A 1X8IA 4AXHA 2YNVA 2BGAA 3ZWFA 3TP9A 5HIOA 3AF5A 4Z5ZA 1E5DA 3R2UA 2Q42A 3Q6VA 2FK6A 1KR3A 5FQBA 3IOGA 5AXOA 2YNWA 2Q9UA 1BMCA 1VJNA 5HH4A 4ZO3A 5A5ZA 2FM6A 5LLDA 2HB9A 1DD6A 3PY5A 5LM6A 4P62A 5AHOA 3SFPA 5LCFA 3P2UA 5LCAA 3SRXA 3KNRA 1X8HA 4HL2A 3S0ZA 1WUPA 4EXSA 5EV8A 1JJEA 5ACXA 4C1DA 3A4YA 1ZKPA 5AIJA 3FAIA 4XWWA 2CBNA 4RL2A 4C1GA 4UWPB 5EVBA 2OHJA 4D1WA 4KEQA 1KO2A 2BIBA 1M2XA 3ZNBA 5AHRA 2BFKA 4EYLA 5KIKA 2BTNA 3H3EA 5EVDA 4EYFA 2M5DA 4EXYA 2WYLA 3I15A 4U4LA 3T3OA 2ZNBA 2QDTA 4CHLA 5LCHA 2GKLA 2BG8B 2NXAA 1XTOA 5K4KA 5B1UA 5HISA 2P1EA 4C09A 3FCZA 3IDZA 3WXCA 4FR7A 4TZEA 1JT1A 3SD9A 2YNTB 3ZR9A 3VPEA 3ZQ4A 4B87A 3RKKA 3BK2A 4UWRB 1BVTA 2QINA 2AZ4A 2GFKA 2YHEA 3DHBA 2GCUA 5HIPA 2BR6A 1XM8A 1KO3A 2P97A 2AIOA 5EV6A 3L6NA 4DILA 2Q0JA 4RAWA 2H6AA 2WRSA 1YCFA 4GYQA 3JXPA 5HH6A 5AYAA 5B3RA 2FHXA 3AF6A 2ZZIA 4TZBA 5ACWA 2QJSA 5A0VA 3BC2A 3X2XA 1X8GA 4DIKA 4AX1B 2BG6A 3SBLA 4D1VA 4EY2A 4F6ZA 4Z67A 5ACTA 3DHAA 2CG3A 3PY6A 1WW1A 3I14A 1YCGA 4H0DA 3IELA 4C1CA 4C1FA 1DDKA 3AJ3A 3MD7A 3G1PA 2CG2A 2CFUA 2YZ3A 4GCWA 4TZFA 1WUOA 4AD9A 4TYFA 4UAMA 1A7TA 5FQCA 3IEMA 2BG8A 4EYBA 2E7YA 5FQAA 4C1HA 5LMCA 4J5FA 2DOOA 4RM5A 4D1UA 4YSBA 3X2ZA 2I7XA 2WHGA 5EVKA 3KNSA 2BFZB 2Y8BA 4Z7RA 4F6HA 4HL1A 2YNTA 4GYUA 2WYMA 2Q0IA 1K07A 3I13A 2YCBA 5A0TA 2NZFA 4RL0A 4V0HA 5A23A 3DH8A 4NQ5A 4PVOA 4PVTA 5DPXA 4TZ9A 5LE1A 3T3NA 4HKYA 3IOFA 1WRAA 1YCHA 3BV6A 5AJLA 1A8TA 2BC2A 5EWAA 4UA4A 5ACVA 2FU9A 5EW0A 5AXRA 4BP0A 5ACPA 3DHCA 4PDXA 4O98A 4ZNBA 3F9OA 3SPUA 5ACRA 5EH9A 4UWOB 2CFZA 3ADRA 1QH5A 4C1EA 2P4ZA 5ACUA 1VGNA 2Y8AA 4FEKA 1VMEA 4ZEJA 4D02A 3ESHA 4AX0B 3X2YA 4YSKA 4KEPA 4UWSB 5K0WA 2XR1A 2ZWRA 2YNUA 2YNVB 3LVZA 4YSLA 3RPCA 4AWYB 3IE0A 2A7MA 2M5CA 4J5HA 2ZO4A 5A87A
chains in the Genus database with same CATH topology
4NQ2A 3QH8A 4Z6XA 2OHHA 5IQKA 5K4NA 3X30A 4NQ4A 2DKFA 2OHIA 3KL7A 4XWTA 5LS3A 1SMLA 4Z5YA 3I11A 5AEBA 2FHXB 2VW8A 2GFJA 3IE2A 4BZ3A 2QEDA 3PG4A 4RBSA 1L9YA 1BC2A 2BFZA 3VQZA 4RAMA 2R2DA 2NYPA 1MQOA 5LSCA 1JJTA 4ZO2A 5K4MA 1Y44A 2BFLA 3IEKA 4WD6A 2BG7A 3IE1A 2I7TA 4JO0A 1HLKA 2QDSA 5EHTA 2I7VA 4UBQA 5B15A 2XF4A 5HIQA 2BMIA 1ZTCA 4FSBA 1ZNBA 5HH5A 2Y87A 2UYXA 2WYMC 1P9EA 3BK1A 2P18A 5ACQA 3RKJA 4XUKA 2FU8A 1QH3A 5KILA 4NQ6A 5ACSA 2BG2A 2FU7A 2FU6A 3SW3A 1DXKA 4D1TA 4EFZA 4TYTA 2NZEA 2GMNA 4AWZA 4Z60A 3I0VA 3T9MA 4LE6A 1X8IA 2YNVA 2BGAA 3ZWFA 3TP9A 5HIOA 3AF5A 4Z5ZA 1E5DA 3R2UA 2Q42A 3Q6VA 2FK6A 1KR3A 5FQBA 3IOGA 5AXOA 2YNWA 2Q9UA 1BMCA 1VJNA 5HH4A 4ZO3A 5A5ZA 2FM6A 5LLDA 2HB9A 1DD6A 3PY5A 5LM6A 4P62A 5AHOA 3SFPA 5LCFA 3P2UA 5LCAA 3SRXA 3KNRA 1X8HA 4HL2A 3S0ZA 1WUPA 4EXSA 5EV8A 1JJEA 5ACXA 4C1DA 3A4YA 1ZKPA 3FAIA 4XWWA 2CBNA 4RL2A 4C1GA 4UWPB 5EVBA 2OHJA 4D1WA 4KEQA 1KO2A 2BIBA 1M2XA 3ZNBA 5AHRA 2BFKA 4EYLA 5KIKA 2BTNA 3H3EA 5EVDA 4EYFA 2M5DA 4EXYA 2WYLA 3I15A 4U4LA 3T3OA 2ZNBA 2QDTA 4CHLA 5LCHA 2GKLA 2BG8B 2NXAA 1XTOA 5K4KA 5B1UA 5HISA 2P1EA 4C09A 3FCZA 3IDZA 3WXCA 4FR7A 4TZEA 1JT1A 3SD9A 2YNTB 3ZR9A 3VPEA 3ZQ4A 4B87A 3RKKA 3BK2A 4UWRB 1BVTA 2QINA 2AZ4A 2GFKA 3DHBA 2GCUA 5HIPA 2BR6A 1XM8A 1KO3A 2P97A 2AIOA 5EV6A 3L6NA 4DILA 2Q0JA 4RAWA 2H6AA 2WRSA 1YCFA 4GYQA 3JXPA 5HH6A 5AYAA 5B3RA 2FHXA 3AF6A 2ZZIA 4TZBA 5ACWA 2QJSA 5A0VA 3BC2A 3X2XA 1X8GA 4DIKA 4AX1B 2BG6A 3SBLA 4D1VA 4EY2A 4F6ZA 4Z67A 5ACTA 3DHAA 3PY6A 1WW1A 3I14A 1YCGA 4H0DA 3IELA 4C1CA 4C1FA 1DDKA 3AJ3A 3MD7A 3G1PA 2YZ3A 4GCWA 4TZFA 1WUOA 4AD9A 4TYFA 4UAMA 1A7TA 5FQCA 3IEMA 2BG8A 4EYBA 2E7YA 5FQAA 4C1HA 5LMCA 4J5FA 2DOOA 4RM5A 4D1UA 4YSBA 3X2ZA 2I7XA 2WHGA 5EVKA 3KNSA 2BFZB 2Y8BA 4Z7RA 4F6HA 4HL1A 2YNTA 4GYUA 2WYMA 2Q0IA 1K07A 3I13A 2YCBA 5A0TA 2NZFA 4RL0A 4V0HA 3DH8A 4NQ5A 4PVOA 4PVTA 5DPXA 4TZ9A 5LE1A 3T3NA 4HKYA 3IOFA 1WRAA 1YCHA 3BV6A 1A8TA 2BC2A 5EWAA 4UA4A 5ACVA 2FU9A 5EW0A 5AXRA 4BP0A 5ACPA 3DHCA 4O98A 4ZNBA 3F9OA 3SPUA 5ACRA 5EH9A 4UWOB 3ADRA 1QH5A 4C1EA 2P4ZA 5ACUA 1VGNA 2Y8AA 4FEKA 1VMEA 4ZEJA 4D02A 3ESHA 4AX0B 3X2YA 4YSKA 4KEPA 4UWSB 5K0WA 2XR1A 2ZWRA 2YNUA 2YNVB 3LVZA 4YSLA 3RPCA 4AWYB 3IE0A 2A7MA 2M5CA 4J5HA 2ZO4A 5A87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NQ2 A;  3QH8 A;  4Z6X A;  2OHH A;  5IQK A;  5K4N A;  3X30 A;  4NQ4 A;  2DKF A;  2OHI A;  3KL7 A;  4XWT A;  5LS3 A;  1SML A;  4Z5Y A;  3I11 A;  5AEB A;  2FHX B;  2VW8 A;  2GFJ A;  3IE2 A;  4BZ3 A;  2QED A;  3PG4 A;  4RBS A;  1L9Y A;  1BC2 A;  2BFZ A;  3VQZ A;  4RAM A;  2R2D A;  2NYP A;  1MQO A;  5LSC A;  1JJT A;  4ZO2 A;  5K4M A;  1Y44 A;  2BFL A;  3IEK A;  4WD6 A;  2BG7 A;  3IE1 A;  2I7T A;  4JO0 A;  1HLK A;  2QDS A;  5EHT A;  2I7V A;  4UBQ A;  5B15 A;  2XF4 A;  5HIQ A;  2BMI A;  1ZTC A;  4FSB A;  1ZNB A;  5HH5 A;  2Y87 A;  2UYX A;  2WYM C;  1P9E A;  3BK1 A;  2P18 A;  5ACQ A;  3RKJ A;  4XUK A;  2FU8 A;  1QH3 A;  5KIL A;  4NQ6 A;  5ACS A;  2BG2 A;  2FU7 A;  2FU6 A;  3SW3 A;  1DXK A;  4D1T A;  4EFZ A;  4TYT A;  2NZE A;  2GMN A;  4AWZ A;  4Z60 A;  3I0V A;  3T9M A;  4LE6 A;  1X8I A;  2YNV A;  2BGA A;  3ZWF A;  3TP9 A;  5HIO A;  3AF5 A;  4Z5Z A;  1E5D A;  3R2U A;  2Q42 A;  3Q6V A;  2FK6 A;  1KR3 A;  5FQB A;  3IOG A;  5AXO A;  2YNW A;  2Q9U A;  1BMC A;  1VJN A;  5HH4 A;  4ZO3 A;  5A5Z A;  2FM6 A;  5LLD A;  2HB9 A;  1DD6 A;  3PY5 A;  5LM6 A;  4P62 A;  5AHO A;  3SFP A;  5LCF A;  3P2U A;  5LCA A;  3SRX A;  3KNR A;  1X8H A;  4HL2 A;  3S0Z A;  1WUP A;  4EXS A;  5EV8 A;  1JJE A;  5ACX A;  4C1D A;  3A4Y A;  1ZKP A;  3FAI A;  4XWW A;  2CBN A;  4RL2 A;  4C1G A;  4UWP B;  5EVB A;  2OHJ A;  4D1W A;  4KEQ A;  1KO2 A;  2BIB A;  1M2X A;  3ZNB A;  5AHR A;  2BFK A;  4EYL A;  5KIK A;  2BTN A;  3H3E A;  5EVD A;  4EYF A;  2M5D A;  4EXY A;  2WYL A;  3I15 A;  4U4L A;  3T3O A;  2ZNB A;  2QDT A;  4CHL A;  5LCH A;  2GKL A;  2BG8 B;  2NXA A;  1XTO A;  5K4K A;  5B1U A;  5HIS A;  2P1E A;  4C09 A;  3FCZ A;  3IDZ A;  3WXC A;  4FR7 A;  4TZE A;  1JT1 A;  3SD9 A;  2YNT B;  3ZR9 A;  3VPE A;  3ZQ4 A;  4B87 A;  3RKK A;  3BK2 A;  4UWR B;  1BVT A;  2QIN A;  2AZ4 A;  2GFK A;  3DHB A;  2GCU A;  5HIP A;  2BR6 A;  1XM8 A;  1KO3 A;  2P97 A;  2AIO A;  5EV6 A;  3L6N A;  4DIL A;  2Q0J A;  4RAW A;  2H6A A;  2WRS A;  1YCF A;  4GYQ A;  3JXP A;  5HH6 A;  5AYA A;  5B3R A;  2FHX A;  3AF6 A;  2ZZI A;  4TZB A;  5ACW A;  2QJS A;  5A0V A;  3BC2 A;  3X2X A;  1X8G A;  4DIK A;  4AX1 B;  2BG6 A;  3SBL A;  4D1V A;  4EY2 A;  4F6Z A;  4Z67 A;  5ACT A;  3DHA A;  3PY6 A;  1WW1 A;  3I14 A;  1YCG A;  4H0D A;  3IEL A;  4C1C A;  4C1F A;  1DDK A;  3AJ3 A;  3MD7 A;  3G1P A;  2YZ3 A;  4GCW A;  4TZF A;  1WUO A;  4AD9 A;  4TYF A;  4UAM A;  1A7T A;  5FQC A;  3IEM A;  2BG8 A;  4EYB A;  2E7Y A;  5FQA A;  4C1H A;  5LMC A;  4J5F A;  2DOO A;  4RM5 A;  4D1U A;  4YSB A;  3X2Z A;  2I7X A;  2WHG A;  5EVK A;  3KNS A;  2BFZ B;  2Y8B A;  4Z7R A;  4F6H A;  4HL1 A;  2YNT A;  4GYU A;  2WYM A;  2Q0I A;  1K07 A;  3I13 A;  2YCB A;  5A0T A;  2NZF A;  4RL0 A;  4V0H A;  3DH8 A;  4NQ5 A;  4PVO A;  4PVT A;  5DPX A;  4TZ9 A;  5LE1 A;  3T3N A;  4HKY A;  3IOF A;  1WRA A;  1YCH A;  3BV6 A;  1A8T A;  2BC2 A;  5EWA A;  4UA4 A;  5ACV A;  2FU9 A;  5EW0 A;  5AXR A;  4BP0 A;  5ACP A;  3DHC A;  4O98 A;  4ZNB A;  3F9O A;  3SPU A;  5ACR A;  5EH9 A;  4UWO B;  3ADR A;  1QH5 A;  4C1E A;  2P4Z A;  5ACU A;  1VGN A;  2Y8A A;  4FEK A;  1VME A;  4ZEJ A;  4D02 A;  3ESH A;  4AX0 B;  3X2Y A;  4YSK A;  4KEP A;  4UWS B;  5K0W A;  2XR1 A;  2ZWR A;  2YNU A;  2YNV B;  3LVZ A;  4YSL A;  3RPC A;  4AWY B;  3IE0 A;  2A7M A;  2M5C A;  4J5H A;  2ZO4 A;  5A87 A; 
#chains in the Genus database with same CATH topology
 4NQ2 A;  3QH8 A;  4Z6X A;  2OHH A;  5IQK A;  5K4N A;  3X30 A;  4NQ4 A;  2DKF A;  2OHI A;  3KL7 A;  4XWT A;  5LS3 A;  1SML A;  4Z5Y A;  3I11 A;  5AEB A;  2FHX B;  2VW8 A;  2GFJ A;  3IE2 A;  4BZ3 A;  2QED A;  3PG4 A;  4RBS A;  1L9Y A;  1BC2 A;  2BFZ A;  3VQZ A;  4RAM A;  2R2D A;  2NYP A;  1MQO A;  5LSC A;  1JJT A;  4ZO2 A;  5K4M A;  1Y44 A;  4AV7 A;  2BFL A;  3IEK A;  4NUR A;  4WD6 A;  2BG7 A;  3IE1 A;  2I7T A;  4JO0 A;  1HLK A;  2QDS A;  5EHT A;  2I7V A;  4UBQ A;  5B15 A;  2XF4 A;  5HIQ A;  2BMI A;  1ZTC A;  4FSB A;  1ZNB A;  5HH5 A;  2Y87 A;  2UYX A;  2WYM C;  1P9E A;  3BK1 A;  2P18 A;  5ACQ A;  3RKJ A;  4XUK A;  2FU8 A;  1QH3 A;  5KIL A;  4NQ6 A;  5ACS A;  2BG2 A;  2FU7 A;  2FU6 A;  3SW3 A;  1DXK A;  4D1T A;  4EFZ A;  4TYT A;  2NZE A;  2GMN A;  4AWZ A;  4Z60 A;  3I0V A;  3T9M A;  4LE6 A;  1X8I A;  4AXH A;  2YNV A;  2BGA A;  3ZWF A;  3TP9 A;  5HIO A;  3AF5 A;  4Z5Z A;  1E5D A;  3R2U A;  2Q42 A;  3Q6V A;  2FK6 A;  1KR3 A;  5FQB A;  3IOG A;  5AXO A;  2YNW A;  2Q9U A;  1BMC A;  1VJN A;  5HH4 A;  4ZO3 A;  5A5Z A;  2FM6 A;  5LLD A;  2HB9 A;  1DD6 A;  3PY5 A;  5LM6 A;  4P62 A;  5AHO A;  3SFP A;  5LCF A;  3P2U A;  5LCA A;  3SRX A;  3KNR A;  1X8H A;  4HL2 A;  3S0Z A;  1WUP A;  4EXS A;  5EV8 A;  1JJE A;  5ACX A;  4C1D A;  3A4Y A;  1ZKP A;  5AIJ A;  3FAI A;  4XWW A;  2CBN A;  4RL2 A;  4C1G A;  4UWP B;  5EVB A;  2OHJ A;  4D1W A;  4KEQ A;  1KO2 A;  2BIB A;  1M2X A;  3ZNB A;  5AHR A;  2BFK A;  4EYL A;  5KIK A;  2BTN A;  3H3E A;  5EVD A;  4EYF A;  2M5D A;  4EXY A;  2WYL A;  3I15 A;  4U4L A;  3T3O A;  2ZNB A;  2QDT A;  4CHL A;  5LCH A;  2GKL A;  2BG8 B;  2NXA A;  1XTO A;  5K4K A;  5B1U A;  5HIS A;  2P1E A;  4C09 A;  3FCZ A;  3IDZ A;  3WXC A;  4FR7 A;  4TZE A;  1JT1 A;  3SD9 A;  2YNT B;  3ZR9 A;  3VPE A;  3ZQ4 A;  4B87 A;  3RKK A;  3BK2 A;  4UWR B;  1BVT A;  2QIN A;  2AZ4 A;  2GFK A;  2YHE A;  3DHB A;  2GCU A;  5HIP A;  2BR6 A;  1XM8 A;  1KO3 A;  2P97 A;  2AIO A;  5EV6 A;  3L6N A;  4DIL A;  2Q0J A;  4RAW A;  2H6A A;  2WRS A;  1YCF A;  4GYQ A;  3JXP A;  5HH6 A;  5AYA A;  5B3R A;  2FHX A;  3AF6 A;  2ZZI A;  4TZB A;  5ACW A;  2QJS A;  5A0V A;  3BC2 A;  3X2X A;  1X8G A;  4DIK A;  4AX1 B;  2BG6 A;  3SBL A;  4D1V A;  4EY2 A;  4F6Z A;  4Z67 A;  5ACT A;  3DHA A;  2CG3 A;  3PY6 A;  1WW1 A;  3I14 A;  1YCG A;  4H0D A;  3IEL A;  4C1C A;  4C1F A;  1DDK A;  3AJ3 A;  3MD7 A;  3G1P A;  2CG2 A;  2CFU A;  2YZ3 A;  4GCW A;  4TZF A;  1WUO A;  4AD9 A;  4TYF A;  4UAM A;  1A7T A;  5FQC A;  3IEM A;  2BG8 A;  4EYB A;  2E7Y A;  5FQA A;  4C1H A;  5LMC A;  4J5F A;  2DOO A;  4RM5 A;  4D1U A;  4YSB A;  3X2Z A;  2I7X A;  2WHG A;  5EVK A;  3KNS A;  2BFZ B;  2Y8B A;  4Z7R A;  4F6H A;  4HL1 A;  2YNT A;  4GYU A;  2WYM A;  2Q0I A;  1K07 A;  3I13 A;  2YCB A;  5A0T A;  2NZF A;  4RL0 A;  4V0H A;  5A23 A;  3DH8 A;  4NQ5 A;  4PVO A;  4PVT A;  5DPX A;  4TZ9 A;  5LE1 A;  3T3N A;  4HKY A;  3IOF A;  1WRA A;  1YCH A;  3BV6 A;  5AJL A;  1A8T A;  2BC2 A;  5EWA A;  4UA4 A;  5ACV A;  2FU9 A;  5EW0 A;  5AXR A;  4BP0 A;  5ACP A;  3DHC A;  4PDX A;  4O98 A;  4ZNB A;  3F9O A;  3SPU A;  5ACR A;  5EH9 A;  4UWO B;  2CFZ A;  3ADR A;  1QH5 A;  4C1E A;  2P4Z A;  5ACU A;  1VGN A;  2Y8A A;  4FEK A;  1VME A;  4ZEJ A;  4D02 A;  3ESH A;  4AX0 B;  3X2Y A;  4YSK A;  4KEP A;  4UWS B;  5K0W A;  2XR1 A;  2ZWR A;  2YNU A;  2YNV B;  3LVZ A;  4YSL A;  3RPC A;  4AWY B;  3IE0 A;  2A7M A;  2M5C A;  4J5H A;  2ZO4 A;  5A87 A; 
#chains in the Genus database with same CATH homology
 4NQ2 A;  3QH8 A;  4Z6X A;  2OHH A;  5IQK A;  5K4N A;  3X30 A;  4NQ4 A;  2DKF A;  2OHI A;  3KL7 A;  4XWT A;  5LS3 A;  1SML A;  4Z5Y A;  3I11 A;  5AEB A;  2FHX B;  2VW8 A;  2GFJ A;  3IE2 A;  4BZ3 A;  2QED A;  3PG4 A;  4RBS A;  1L9Y A;  1BC2 A;  2BFZ A;  3VQZ A;  4RAM A;  2R2D A;  2NYP A;  1MQO A;  5LSC A;  1JJT A;  4ZO2 A;  5K4M A;  1Y44 A;  2BFL A;  3IEK A;  4WD6 A;  2BG7 A;  3IE1 A;  2I7T A;  4JO0 A;  1HLK A;  2QDS A;  5EHT A;  2I7V A;  4UBQ A;  5B15 A;  2XF4 A;  5HIQ A;  2BMI A;  1ZTC A;  4FSB A;  1ZNB A;  5HH5 A;  2Y87 A;  2UYX A;  2WYM C;  1P9E A;  3BK1 A;  2P18 A;  5ACQ A;  3RKJ A;  4XUK A;  2FU8 A;  1QH3 A;  5KIL A;  4NQ6 A;  5ACS A;  2BG2 A;  2FU7 A;  2FU6 A;  3SW3 A;  1DXK A;  4D1T A;  4EFZ A;  4TYT A;  2NZE A;  2GMN A;  4AWZ A;  4Z60 A;  3I0V A;  3T9M A;  4LE6 A;  1X8I A;  2YNV A;  2BGA A;  3ZWF A;  3TP9 A;  5HIO A;  3AF5 A;  4Z5Z A;  1E5D A;  3R2U A;  2Q42 A;  3Q6V A;  2FK6 A;  1KR3 A;  5FQB A;  3IOG A;  5AXO A;  2YNW A;  2Q9U A;  1BMC A;  1VJN A;  5HH4 A;  4ZO3 A;  5A5Z A;  2FM6 A;  5LLD A;  2HB9 A;  1DD6 A;  3PY5 A;  5LM6 A;  4P62 A;  5AHO A;  3SFP A;  5LCF A;  3P2U A;  5LCA A;  3SRX A;  3KNR A;  1X8H A;  4HL2 A;  3S0Z A;  1WUP A;  4EXS A;  5EV8 A;  1JJE A;  5ACX A;  4C1D A;  3A4Y A;  1ZKP A;  3FAI A;  4XWW A;  2CBN A;  4RL2 A;  4C1G A;  4UWP B;  5EVB A;  2OHJ A;  4D1W A;  4KEQ A;  1KO2 A;  2BIB A;  1M2X A;  3ZNB A;  5AHR A;  2BFK A;  4EYL A;  5KIK A;  2BTN A;  3H3E A;  5EVD A;  4EYF A;  2M5D A;  4EXY A;  2WYL A;  3I15 A;  4U4L A;  3T3O A;  2ZNB A;  2QDT A;  4CHL A;  5LCH A;  2GKL A;  2BG8 B;  2NXA A;  1XTO A;  5K4K A;  5B1U A;  5HIS A;  2P1E A;  4C09 A;  3FCZ A;  3IDZ A;  3WXC A;  4FR7 A;  4TZE A;  1JT1 A;  3SD9 A;  2YNT B;  3ZR9 A;  3VPE A;  3ZQ4 A;  4B87 A;  3RKK A;  3BK2 A;  4UWR B;  1BVT A;  2QIN A;  2AZ4 A;  2GFK A;  3DHB A;  2GCU A;  5HIP A;  2BR6 A;  1XM8 A;  1KO3 A;  2P97 A;  2AIO A;  5EV6 A;  3L6N A;  4DIL A;  2Q0J A;  4RAW A;  2H6A A;  2WRS A;  1YCF A;  4GYQ A;  3JXP A;  5HH6 A;  5AYA A;  5B3R A;  2FHX A;  3AF6 A;  2ZZI A;  4TZB A;  5ACW A;  2QJS A;  5A0V A;  3BC2 A;  3X2X A;  1X8G A;  4DIK A;  4AX1 B;  2BG6 A;  3SBL A;  4D1V A;  4EY2 A;  4F6Z A;  4Z67 A;  5ACT A;  3DHA A;  3PY6 A;  1WW1 A;  3I14 A;  1YCG A;  4H0D A;  3IEL A;  4C1C A;  4C1F A;  1DDK A;  3AJ3 A;  3MD7 A;  3G1P A;  2YZ3 A;  4GCW A;  4TZF A;  1WUO A;  4AD9 A;  4TYF A;  4UAM A;  1A7T A;  5FQC A;  3IEM A;  2BG8 A;  4EYB A;  2E7Y A;  5FQA A;  4C1H A;  5LMC A;  4J5F A;  2DOO A;  4RM5 A;  4D1U A;  4YSB A;  3X2Z A;  2I7X A;  2WHG A;  5EVK A;  3KNS A;  2BFZ B;  2Y8B A;  4Z7R A;  4F6H A;  4HL1 A;  2YNT A;  4GYU A;  2WYM A;  2Q0I A;  1K07 A;  3I13 A;  2YCB A;  5A0T A;  2NZF A;  4RL0 A;  4V0H A;  3DH8 A;  4NQ5 A;  4PVO A;  4PVT A;  5DPX A;  4TZ9 A;  5LE1 A;  3T3N A;  4HKY A;  3IOF A;  1WRA A;  1YCH A;  3BV6 A;  1A8T A;  2BC2 A;  5EWA A;  4UA4 A;  5ACV A;  2FU9 A;  5EW0 A;  5AXR A;  4BP0 A;  5ACP A;  3DHC A;  4O98 A;  4ZNB A;  3F9O A;  3SPU A;  5ACR A;  5EH9 A;  4UWO B;  3ADR A;  1QH5 A;  4C1E A;  2P4Z A;  5ACU A;  1VGN A;  2Y8A A;  4FEK A;  1VME A;  4ZEJ A;  4D02 A;  3ESH A;  4AX0 B;  3X2Y A;  4YSK A;  4KEP A;  4UWS B;  5K0W A;  2XR1 A;  2ZWR A;  2YNU A;  2YNV B;  3LVZ A;  4YSL A;  3RPC A;  4AWY B;  3IE0 A;  2A7M A;  2M5C A;  4J5H A;  2ZO4 A;  5A87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...