2FHXA

Pseudomonas aeruginosa spm-1 metallo-beta-lactamase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
245
structure length
244
Chain Sequence
DHVDLPYNLTATKIDSDVFVVTDRDFYSSNVLVAKMLDGTVVIVSSPFENLGTQTLMDWVAKTMKPKKVVAINTHFHLDGTGGNEIYKKMGAETWSSDLTKQLRLEENKKDRIKAAEFYKNEDLKRRILSSHPVPADNVFDLKQGKVFSFSNELVEVSFPGPAHSPDNVVVYFPKKKLLFGGMIKPKELGYLGDANVKAWPDSARRLKKFDAKIVIPGHGEWGGPEMVNKTIKVAEKAVGEMRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Pseudomonas aeruginosa SPM-1 Provides Insights into Variable Zinc Affinity of Metallo-beta-lactamases.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase, metal binding protein
molecule keywords SPM-1
total genus 75
structure length 244
sequence length 245
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2fhxA00
4RL2A 2P1EA 5FQCA 2XR1A 3PY6A 4EFZA 3A4YA 3RPCA 2GFJA 4P62A 2GFKA 5AHRA 4C1EA 5EVDA 2ZNBA 4YSLA 5EV8A 4HL2A 4H0DA 5LS3A 5HIPA 1ZTCA 3I0VA 4AWZA 1HLKA 5K4MA 4C1FA 4AD9A 5HH6A 5A0VA 1JT1A 2P18A 2QJSA 1QH5A 4RAWA 2BC2A 1VJNA 5AEBA 4FR7A 4ZO2A 4UA4A 5FQBA 5B3RA 4C09A 5ACQA 1MQOA 4D1UA 1SMLA 3G1PA 3DHCA 3JXPA 4DILA 2GCUA 3IE2A 4Z5ZA 3X2XA 3ZR9A 4O98A 2VW8A 4RBSA 5A87A 3DHBA 4AWYB 1BMCA 5ACVA 3IELA 4EYFA 1WUPA 1BC2A 3T3OA 4RAMA 4NQ2A 3AF6A 3TP9A 2BFKA 5K0WA 1E5DA 2YCBA 2Q42A 1KO3A 4J5HA 3L6NA 3F9OA 1XM8A 2AIOA 2YNTA 2UYXA 5LCFA 4DIKA 3ZNBA 4V0HA 5B1UA 4UWPB 3KL7A 3X30A 4ZNBA 2QEDA 5HIQA 4Z5YA 1X8HA 2BTNA 2QDTA 5LE1A 1XTOA 4NQ4A 3BV6A 2OHHA 1ZKPA 5ACUA 4B87A 2Q0JA 3SRXA 5A5ZA 5ACSA 5LSCA 3KNRA 5IQKA 2A7MA 2BR6A 1A8TA 3PY5A 2YNUA 4TZBA 2I7VA 5ACTA 2Q0IA 2ZZIA 4TZEA 4FSBA 3T9MA 3VQZA 5A0TA 4XWTA 5LM6A 2FU7A 5HIOA 5ACPA 5EHTA 2BG2A 3IE1A 2YZ3A 1P9EA 2ZWRA 3BC2A 3SBLA 4PVTA 3I15A 4CHLA 2FU6A 2WYMA 2WYLA 4C1CA 2Y8AA 5EVKA 1L9YA 4BP0A 1DD6A 2BG6A 4F6HA 5DPXA 4UWSB 2BMIA 4TZFA 1X8IA 2YNTB 4GYUA 4HL1A 5KILA 5EV6A 3VPEA 1DDKA 2Y87A 3MD7A 4Z6XA 4HKYA 4GYQA 3X2ZA 2WRSA 3WXCA 2HB9A 2YNWA 2P97A 4D1TA 4KEPA 3S0ZA 3ADRA 4JO0A 4EXYA 3I14A 3DHAA 3BK2A 1DXKA 4UWOB 4C1DA 2H6AA 2I7XA 3AJ3A 2OHJA 5K4KA 4EYBA 1K07A 5LLDA 3Q6VA 4YSKA 1VGNA 5EW0A 2GKLA 2BGAA 4TYTA 5LCAA 2AZ4A 1BVTA 5K4NA 3IEMA 4NQ6A 5KIKA 5HH5A 4RM5A 2OHIA 1ZNBA 4EYLA 5HISA 2YNVB 5AXOA 2ZO4A 2CBNA 5EH9A 4LE6A 4EY2A 3ESHA 5HH4A 5ACWA 4UWRB 1YCGA 2FM6A 1JJTA 4YSBA 1WRAA 4KEQA 1WUOA 3PG4A 1A7TA 2QDSA 2BG8A 3T3NA 2FHXA 3RKJA 1KO2A 4D1WA 3KNSA 2FHXB 2GMNA 4D02A 2NZFA 3AF5A 2BG7A 3P2UA 4Z7RA 4TZ9A 3SFPA 3IDZA 3I11A 5AHOA 3IE0A 3QH8A 2I7TA 3SPUA 2BFZA 5ACRA 2NZEA 4PVOA 3X2YA 5LMCA 4GCWA 2DOOA 5EVBA 2YNVA 2QINA 3IOGA 5EWAA 1QH3A 4C1GA 2BIBA 5LCHA 3ZQ4A 4AX0B 4Z67A 2DKFA 3LVZA 4Z60A 2Q9UA 2FU8A 2NXAA 3R2UA 1X8GA 4F6ZA 4J5FA 4UAMA 5AYAA 4U4LA 5B15A 3I13A 3RKKA 1KR3A 4C1HA 2NYPA 5FQAA 4AX1B 2BFZB 4UBQA 3SD9A 2FK6A 4TYFA 2R2DA 3FAIA 4XUKA 5AXRA 4RL0A 2P4ZA 3DH8A 3H3EA 2M5CA 2WYMC 4XWWA 1YCHA 1JJEA 2Y8BA 1VMEA 4D1VA 1WW1A 4ZO3A 3ZWFA 3IEKA 1YCFA 2WHGA 4EXSA 4WD6A 3FCZA 4NQ5A 2FU9A 3IOFA 3BK1A 4FEKA 5ACXA 4ZEJA 2M5DA 2E7YA 4BZ3A 2BG8B 1Y44A 2BFLA 2XF4A 3SW3A 1M2XA
chains in the Genus database with same CATH superfamily
4RL2A 2P1EA 5FQCA 2XR1A 3PY6A 4EFZA 3A4YA 3RPCA 2CFZA 2GFJA 4P62A 2GFKA 5AHRA 4C1EA 5EVDA 2ZNBA 4YSLA 5EV8A 4HL2A 4H0DA 5LS3A 5HIPA 1ZTCA 3I0VA 4AWZA 1HLKA 5K4MA 4C1FA 4AD9A 5HH6A 5A0VA 1JT1A 2P18A 2QJSA 1QH5A 4RAWA 2BC2A 1VJNA 5AEBA 4FR7A 4ZO2A 4UA4A 5FQBA 5B3RA 4C09A 5ACQA 1MQOA 4D1UA 1SMLA 3G1PA 3DHCA 3JXPA 4DILA 2GCUA 3IE2A 4Z5ZA 3X2XA 3ZR9A 4O98A 2VW8A 4RBSA 5A87A 3DHBA 4AWYB 1BMCA 5ACVA 3IELA 4EYFA 1WUPA 1BC2A 3T3OA 4RAMA 4NQ2A 3AF6A 3TP9A 2BFKA 5K0WA 1E5DA 2YCBA 2Q42A 1KO3A 4J5HA 3L6NA 3F9OA 1XM8A 2AIOA 2YNTA 2UYXA 5LCFA 4DIKA 3ZNBA 4V0HA 5B1UA 4UWPB 3KL7A 5AIJA 3X30A 2CG2A 4ZNBA 2QEDA 5HIQA 4Z5YA 1X8HA 2BTNA 2QDTA 5LE1A 1XTOA 4NQ4A 3BV6A 2OHHA 1ZKPA 5ACUA 4B87A 2Q0JA 3SRXA 5A5ZA 5ACSA 5LSCA 3KNRA 5IQKA 2A7MA 2CG3A 2BR6A 4PDXA 1A8TA 3PY5A 2YNUA 4TZBA 2I7VA 5ACTA 2Q0IA 2ZZIA 4TZEA 4FSBA 3T9MA 3VQZA 5A0TA 4XWTA 5LM6A 2FU7A 5HIOA 5ACPA 5EHTA 2BG2A 3IE1A 2YZ3A 1P9EA 2ZWRA 3BC2A 3SBLA 4PVTA 3I15A 4CHLA 2FU6A 2WYMA 2WYLA 4C1CA 2Y8AA 5EVKA 1L9YA 4BP0A 1DD6A 2BG6A 4F6HA 5DPXA 4UWSB 2BMIA 4TZFA 1X8IA 2YNTB 4GYUA 4HL1A 5KILA 5EV6A 3VPEA 1DDKA 2Y87A 3MD7A 4Z6XA 4HKYA 4GYQA 3X2ZA 2WRSA 3WXCA 2HB9A 2YNWA 2P97A 4D1TA 4KEPA 3S0ZA 3ADRA 4JO0A 4EXYA 3I14A 3DHAA 3BK2A 4AV7A 1DXKA 4UWOB 4C1DA 2H6AA 2I7XA 3AJ3A 2OHJA 5K4KA 4EYBA 1K07A 5LLDA 3Q6VA 4YSKA 2CFUA 1VGNA 5EW0A 2GKLA 2BGAA 4TYTA 5LCAA 2AZ4A 1BVTA 5K4NA 3IEMA 4NQ6A 5KIKA 5HH5A 4RM5A 2OHIA 1ZNBA 4EYLA 5HISA 2YNVB 5AXOA 2ZO4A 2CBNA 5EH9A 4LE6A 4EY2A 3ESHA 5HH4A 5ACWA 4UWRB 1YCGA 2FM6A 1JJTA 4YSBA 1WRAA 4KEQA 1WUOA 3PG4A 1A7TA 2QDSA 2BG8A 3T3NA 2FHXA 3RKJA 1KO2A 4D1WA 3KNSA 2FHXB 2GMNA 4D02A 2NZFA 3AF5A 2BG7A 3P2UA 4Z7RA 4TZ9A 3SFPA 3IDZA 3I11A 5AHOA 3IE0A 4NURA 3QH8A 2I7TA 3SPUA 2BFZA 5ACRA 2NZEA 4PVOA 5AJLA 3X2YA 5LMCA 4GCWA 2DOOA 5EVBA 2YNVA 2QINA 4AXHA 3IOGA 5EWAA 1QH3A 4C1GA 2BIBA 5LCHA 3ZQ4A 4AX0B 4Z67A 2DKFA 3LVZA 4Z60A 2Q9UA 5A23A 2YHEA 2FU8A 2NXAA 3R2UA 1X8GA 4F6ZA 4J5FA 4UAMA 5AYAA 4U4LA 5B15A 3I13A 3RKKA 1KR3A 4C1HA 2NYPA 5FQAA 4AX1B 2BFZB 4UBQA 3SD9A 2FK6A 4TYFA 2R2DA 3FAIA 4XUKA 5AXRA 4RL0A 2P4ZA 3DH8A 3H3EA 2M5CA 2WYMC 4XWWA 1YCHA 1JJEA 2Y8BA 1VMEA 4D1VA 1WW1A 4ZO3A 3ZWFA 3IEKA 1YCFA 2WHGA 4EXSA 4WD6A 3FCZA 4NQ5A 2FU9A 3IOFA 3BK1A 4FEKA 5ACXA 4ZEJA 2M5DA 2E7YA 4BZ3A 2BG8B 1Y44A 2BFLA 2XF4A 3SW3A 1M2XA
chains in the Genus database with same CATH topology
4RL2A 2P1EA 5FQCA 2XR1A 3PY6A 4EFZA 3A4YA 3RPCA 2GFJA 4P62A 2GFKA 5AHRA 4C1EA 5EVDA 2ZNBA 4YSLA 5EV8A 4HL2A 4H0DA 5LS3A 5HIPA 1ZTCA 3I0VA 4AWZA 1HLKA 5K4MA 4C1FA 4AD9A 5HH6A 5A0VA 1JT1A 2P18A 2QJSA 1QH5A 4RAWA 2BC2A 1VJNA 5AEBA 4FR7A 4ZO2A 4UA4A 5FQBA 5B3RA 4C09A 5ACQA 1MQOA 4D1UA 1SMLA 3G1PA 3DHCA 3JXPA 4DILA 2GCUA 3IE2A 4Z5ZA 3X2XA 3ZR9A 4O98A 2VW8A 4RBSA 5A87A 3DHBA 4AWYB 1BMCA 5ACVA 3IELA 4EYFA 1WUPA 1BC2A 3T3OA 4RAMA 4NQ2A 3AF6A 3TP9A 2BFKA 5K0WA 1E5DA 2YCBA 2Q42A 1KO3A 4J5HA 3L6NA 3F9OA 1XM8A 2AIOA 2YNTA 2UYXA 5LCFA 4DIKA 3ZNBA 4V0HA 5B1UA 4UWPB 3KL7A 3X30A 4ZNBA 2QEDA 5HIQA 4Z5YA 1X8HA 2BTNA 2QDTA 5LE1A 1XTOA 4NQ4A 3BV6A 2OHHA 1ZKPA 5ACUA 4B87A 2Q0JA 3SRXA 5A5ZA 5ACSA 5LSCA 3KNRA 5IQKA 2A7MA 2BR6A 1A8TA 3PY5A 2YNUA 4TZBA 2I7VA 5ACTA 2Q0IA 2ZZIA 4TZEA 4FSBA 3T9MA 3VQZA 5A0TA 4XWTA 5LM6A 2FU7A 5HIOA 5ACPA 5EHTA 2BG2A 3IE1A 2YZ3A 1P9EA 2ZWRA 3BC2A 3SBLA 4PVTA 3I15A 4CHLA 2FU6A 2WYMA 2WYLA 4C1CA 2Y8AA 5EVKA 1L9YA 4BP0A 1DD6A 2BG6A 4F6HA 5DPXA 4UWSB 2BMIA 4TZFA 1X8IA 2YNTB 4GYUA 4HL1A 5KILA 5EV6A 3VPEA 1DDKA 2Y87A 3MD7A 4Z6XA 4HKYA 4GYQA 3X2ZA 2WRSA 3WXCA 2HB9A 2YNWA 2P97A 4D1TA 4KEPA 3S0ZA 3ADRA 4JO0A 4EXYA 3I14A 3DHAA 3BK2A 1DXKA 4UWOB 4C1DA 2H6AA 2I7XA 3AJ3A 2OHJA 5K4KA 4EYBA 1K07A 5LLDA 3Q6VA 4YSKA 1VGNA 5EW0A 2GKLA 2BGAA 4TYTA 5LCAA 2AZ4A 1BVTA 5K4NA 3IEMA 4NQ6A 5KIKA 5HH5A 4RM5A 2OHIA 1ZNBA 4EYLA 5HISA 2YNVB 5AXOA 2ZO4A 2CBNA 5EH9A 4LE6A 4EY2A 3ESHA 5HH4A 5ACWA 4UWRB 1YCGA 2FM6A 1JJTA 4YSBA 1WRAA 4KEQA 1WUOA 3PG4A 1A7TA 2QDSA 2BG8A 3T3NA 2FHXA 3RKJA 1KO2A 4D1WA 3KNSA 2FHXB 2GMNA 4D02A 2NZFA 3AF5A 2BG7A 3P2UA 4Z7RA 4TZ9A 3SFPA 3IDZA 3I11A 5AHOA 3IE0A 3QH8A 2I7TA 3SPUA 2BFZA 5ACRA 2NZEA 4PVOA 3X2YA 5LMCA 4GCWA 2DOOA 5EVBA 2YNVA 2QINA 3IOGA 5EWAA 1QH3A 4C1GA 2BIBA 5LCHA 3ZQ4A 4AX0B 4Z67A 2DKFA 3LVZA 4Z60A 2Q9UA 2FU8A 2NXAA 3R2UA 1X8GA 4F6ZA 4J5FA 4UAMA 5AYAA 4U4LA 5B15A 3I13A 3RKKA 1KR3A 4C1HA 2NYPA 5FQAA 4AX1B 2BFZB 4UBQA 3SD9A 2FK6A 4TYFA 2R2DA 3FAIA 4XUKA 5AXRA 4RL0A 2P4ZA 3DH8A 3H3EA 2M5CA 2WYMC 4XWWA 1YCHA 1JJEA 2Y8BA 1VMEA 4D1VA 1WW1A 4ZO3A 3ZWFA 3IEKA 1YCFA 2WHGA 4EXSA 4WD6A 3FCZA 4NQ5A 2FU9A 3IOFA 3BK1A 4FEKA 5ACXA 4ZEJA 2M5DA 2E7YA 4BZ3A 2BG8B 1Y44A 2BFLA 2XF4A 3SW3A 1M2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RL2 A;  2P1E A;  5FQC A;  2XR1 A;  3PY6 A;  4EFZ A;  3A4Y A;  3RPC A;  2GFJ A;  4P62 A;  2GFK A;  5AHR A;  4C1E A;  5EVD A;  2ZNB A;  4YSL A;  5EV8 A;  4HL2 A;  4H0D A;  5LS3 A;  5HIP A;  1ZTC A;  3I0V A;  4AWZ A;  1HLK A;  5K4M A;  4C1F A;  4AD9 A;  5HH6 A;  5A0V A;  1JT1 A;  2P18 A;  2QJS A;  1QH5 A;  4RAW A;  2BC2 A;  1VJN A;  5AEB A;  4FR7 A;  4ZO2 A;  4UA4 A;  5FQB A;  5B3R A;  4C09 A;  5ACQ A;  1MQO A;  4D1U A;  1SML A;  3G1P A;  3DHC A;  3JXP A;  4DIL A;  2GCU A;  3IE2 A;  4Z5Z A;  3X2X A;  3ZR9 A;  4O98 A;  2VW8 A;  4RBS A;  5A87 A;  3DHB A;  4AWY B;  1BMC A;  5ACV A;  3IEL A;  4EYF A;  1WUP A;  1BC2 A;  3T3O A;  4RAM A;  4NQ2 A;  3AF6 A;  3TP9 A;  2BFK A;  5K0W A;  1E5D A;  2YCB A;  2Q42 A;  1KO3 A;  4J5H A;  3L6N A;  3F9O A;  1XM8 A;  2AIO A;  2YNT A;  2UYX A;  5LCF A;  4DIK A;  3ZNB A;  4V0H A;  5B1U A;  4UWP B;  3KL7 A;  3X30 A;  4ZNB A;  2QED A;  5HIQ A;  4Z5Y A;  1X8H A;  2BTN A;  2QDT A;  5LE1 A;  1XTO A;  4NQ4 A;  3BV6 A;  2OHH A;  1ZKP A;  5ACU A;  4B87 A;  2Q0J A;  3SRX A;  5A5Z A;  5ACS A;  5LSC A;  3KNR A;  5IQK A;  2A7M A;  2BR6 A;  1A8T A;  3PY5 A;  2YNU A;  4TZB A;  2I7V A;  5ACT A;  2Q0I A;  2ZZI A;  4TZE A;  4FSB A;  3T9M A;  3VQZ A;  5A0T A;  4XWT A;  5LM6 A;  2FU7 A;  5HIO A;  5ACP A;  5EHT A;  2BG2 A;  3IE1 A;  2YZ3 A;  1P9E A;  2ZWR A;  3BC2 A;  3SBL A;  4PVT A;  3I15 A;  4CHL A;  2FU6 A;  2WYM A;  2WYL A;  4C1C A;  2Y8A A;  5EVK A;  1L9Y A;  4BP0 A;  1DD6 A;  2BG6 A;  4F6H A;  5DPX A;  4UWS B;  2BMI A;  4TZF A;  1X8I A;  2YNT B;  4GYU A;  4HL1 A;  5KIL A;  5EV6 A;  3VPE A;  1DDK A;  2Y87 A;  3MD7 A;  4Z6X A;  4HKY A;  4GYQ A;  3X2Z A;  2WRS A;  3WXC A;  2HB9 A;  2YNW A;  2P97 A;  4D1T A;  4KEP A;  3S0Z A;  3ADR A;  4JO0 A;  4EXY A;  3I14 A;  3DHA A;  3BK2 A;  1DXK A;  4UWO B;  4C1D A;  2H6A A;  2I7X A;  3AJ3 A;  2OHJ A;  5K4K A;  4EYB A;  1K07 A;  5LLD A;  3Q6V A;  4YSK A;  1VGN A;  5EW0 A;  2GKL A;  2BGA A;  4TYT A;  5LCA A;  2AZ4 A;  1BVT A;  5K4N A;  3IEM A;  4NQ6 A;  5KIK A;  5HH5 A;  4RM5 A;  2OHI A;  1ZNB A;  4EYL A;  5HIS A;  2YNV B;  5AXO A;  2ZO4 A;  2CBN A;  5EH9 A;  4LE6 A;  4EY2 A;  3ESH A;  5HH4 A;  5ACW A;  4UWR B;  1YCG A;  2FM6 A;  1JJT A;  4YSB A;  1WRA A;  4KEQ A;  1WUO A;  3PG4 A;  1A7T A;  2QDS A;  2BG8 A;  3T3N A;  2FHX A;  3RKJ A;  1KO2 A;  4D1W A;  3KNS A;  2FHX B;  2GMN A;  4D02 A;  2NZF A;  3AF5 A;  2BG7 A;  3P2U A;  4Z7R A;  4TZ9 A;  3SFP A;  3IDZ A;  3I11 A;  5AHO A;  3IE0 A;  3QH8 A;  2I7T A;  3SPU A;  2BFZ A;  5ACR A;  2NZE A;  4PVO A;  3X2Y A;  5LMC A;  4GCW A;  2DOO A;  5EVB A;  2YNV A;  2QIN A;  3IOG A;  5EWA A;  1QH3 A;  4C1G A;  2BIB A;  5LCH A;  3ZQ4 A;  4AX0 B;  4Z67 A;  2DKF A;  3LVZ A;  4Z60 A;  2Q9U A;  2FU8 A;  2NXA A;  3R2U A;  1X8G A;  4F6Z A;  4J5F A;  4UAM A;  5AYA A;  4U4L A;  5B15 A;  3I13 A;  3RKK A;  1KR3 A;  4C1H A;  2NYP A;  5FQA A;  4AX1 B;  2BFZ B;  4UBQ A;  3SD9 A;  2FK6 A;  4TYF A;  2R2D A;  3FAI A;  4XUK A;  5AXR A;  4RL0 A;  2P4Z A;  3DH8 A;  3H3E A;  2M5C A;  2WYM C;  4XWW A;  1YCH A;  1JJE A;  2Y8B A;  1VME A;  4D1V A;  1WW1 A;  4ZO3 A;  3ZWF A;  3IEK A;  1YCF A;  2WHG A;  4EXS A;  4WD6 A;  3FCZ A;  4NQ5 A;  2FU9 A;  3IOF A;  3BK1 A;  4FEK A;  5ACX A;  4ZEJ A;  2M5D A;  2E7Y A;  4BZ3 A;  2BG8 B;  1Y44 A;  2BFL A;  2XF4 A;  3SW3 A;  1M2X A; 
#chains in the Genus database with same CATH topology
 4RL2 A;  2P1E A;  5FQC A;  2XR1 A;  3PY6 A;  4EFZ A;  3A4Y A;  3RPC A;  2CFZ A;  2GFJ A;  4P62 A;  2GFK A;  5AHR A;  4C1E A;  5EVD A;  2ZNB A;  4YSL A;  5EV8 A;  4HL2 A;  4H0D A;  5LS3 A;  5HIP A;  1ZTC A;  3I0V A;  4AWZ A;  1HLK A;  5K4M A;  4C1F A;  4AD9 A;  5HH6 A;  5A0V A;  1JT1 A;  2P18 A;  2QJS A;  1QH5 A;  4RAW A;  2BC2 A;  1VJN A;  5AEB A;  4FR7 A;  4ZO2 A;  4UA4 A;  5FQB A;  5B3R A;  4C09 A;  5ACQ A;  1MQO A;  4D1U A;  1SML A;  3G1P A;  3DHC A;  3JXP A;  4DIL A;  2GCU A;  3IE2 A;  4Z5Z A;  3X2X A;  3ZR9 A;  4O98 A;  2VW8 A;  4RBS A;  5A87 A;  3DHB A;  4AWY B;  1BMC A;  5ACV A;  3IEL A;  4EYF A;  1WUP A;  1BC2 A;  3T3O A;  4RAM A;  4NQ2 A;  3AF6 A;  3TP9 A;  2BFK A;  5K0W A;  1E5D A;  2YCB A;  2Q42 A;  1KO3 A;  4J5H A;  3L6N A;  3F9O A;  1XM8 A;  2AIO A;  2YNT A;  2UYX A;  5LCF A;  4DIK A;  3ZNB A;  4V0H A;  5B1U A;  4UWP B;  3KL7 A;  5AIJ A;  3X30 A;  2CG2 A;  4ZNB A;  2QED A;  5HIQ A;  4Z5Y A;  1X8H A;  2BTN A;  2QDT A;  5LE1 A;  1XTO A;  4NQ4 A;  3BV6 A;  2OHH A;  1ZKP A;  5ACU A;  4B87 A;  2Q0J A;  3SRX A;  5A5Z A;  5ACS A;  5LSC A;  3KNR A;  5IQK A;  2A7M A;  2CG3 A;  2BR6 A;  4PDX A;  1A8T A;  3PY5 A;  2YNU A;  4TZB A;  2I7V A;  5ACT A;  2Q0I A;  2ZZI A;  4TZE A;  4FSB A;  3T9M A;  3VQZ A;  5A0T A;  4XWT A;  5LM6 A;  2FU7 A;  5HIO A;  5ACP A;  5EHT A;  2BG2 A;  3IE1 A;  2YZ3 A;  1P9E A;  2ZWR A;  3BC2 A;  3SBL A;  4PVT A;  3I15 A;  4CHL A;  2FU6 A;  2WYM A;  2WYL A;  4C1C A;  2Y8A A;  5EVK A;  1L9Y A;  4BP0 A;  1DD6 A;  2BG6 A;  4F6H A;  5DPX A;  4UWS B;  2BMI A;  4TZF A;  1X8I A;  2YNT B;  4GYU A;  4HL1 A;  5KIL A;  5EV6 A;  3VPE A;  1DDK A;  2Y87 A;  3MD7 A;  4Z6X A;  4HKY A;  4GYQ A;  3X2Z A;  2WRS A;  3WXC A;  2HB9 A;  2YNW A;  2P97 A;  4D1T A;  4KEP A;  3S0Z A;  3ADR A;  4JO0 A;  4EXY A;  3I14 A;  3DHA A;  3BK2 A;  4AV7 A;  1DXK A;  4UWO B;  4C1D A;  2H6A A;  2I7X A;  3AJ3 A;  2OHJ A;  5K4K A;  4EYB A;  1K07 A;  5LLD A;  3Q6V A;  4YSK A;  2CFU A;  1VGN A;  5EW0 A;  2GKL A;  2BGA A;  4TYT A;  5LCA A;  2AZ4 A;  1BVT A;  5K4N A;  3IEM A;  4NQ6 A;  5KIK A;  5HH5 A;  4RM5 A;  2OHI A;  1ZNB A;  4EYL A;  5HIS A;  2YNV B;  5AXO A;  2ZO4 A;  2CBN A;  5EH9 A;  4LE6 A;  4EY2 A;  3ESH A;  5HH4 A;  5ACW A;  4UWR B;  1YCG A;  2FM6 A;  1JJT A;  4YSB A;  1WRA A;  4KEQ A;  1WUO A;  3PG4 A;  1A7T A;  2QDS A;  2BG8 A;  3T3N A;  2FHX A;  3RKJ A;  1KO2 A;  4D1W A;  3KNS A;  2FHX B;  2GMN A;  4D02 A;  2NZF A;  3AF5 A;  2BG7 A;  3P2U A;  4Z7R A;  4TZ9 A;  3SFP A;  3IDZ A;  3I11 A;  5AHO A;  3IE0 A;  4NUR A;  3QH8 A;  2I7T A;  3SPU A;  2BFZ A;  5ACR A;  2NZE A;  4PVO A;  5AJL A;  3X2Y A;  5LMC A;  4GCW A;  2DOO A;  5EVB A;  2YNV A;  2QIN A;  4AXH A;  3IOG A;  5EWA A;  1QH3 A;  4C1G A;  2BIB A;  5LCH A;  3ZQ4 A;  4AX0 B;  4Z67 A;  2DKF A;  3LVZ A;  4Z60 A;  2Q9U A;  5A23 A;  2YHE A;  2FU8 A;  2NXA A;  3R2U A;  1X8G A;  4F6Z A;  4J5F A;  4UAM A;  5AYA A;  4U4L A;  5B15 A;  3I13 A;  3RKK A;  1KR3 A;  4C1H A;  2NYP A;  5FQA A;  4AX1 B;  2BFZ B;  4UBQ A;  3SD9 A;  2FK6 A;  4TYF A;  2R2D A;  3FAI A;  4XUK A;  5AXR A;  4RL0 A;  2P4Z A;  3DH8 A;  3H3E A;  2M5C A;  2WYM C;  4XWW A;  1YCH A;  1JJE A;  2Y8B A;  1VME A;  4D1V A;  1WW1 A;  4ZO3 A;  3ZWF A;  3IEK A;  1YCF A;  2WHG A;  4EXS A;  4WD6 A;  3FCZ A;  4NQ5 A;  2FU9 A;  3IOF A;  3BK1 A;  4FEK A;  5ACX A;  4ZEJ A;  2M5D A;  2E7Y A;  4BZ3 A;  2BG8 B;  1Y44 A;  2BFL A;  2XF4 A;  3SW3 A;  1M2X A; 
#chains in the Genus database with same CATH homology
 4RL2 A;  2P1E A;  5FQC A;  2XR1 A;  3PY6 A;  4EFZ A;  3A4Y A;  3RPC A;  2GFJ A;  4P62 A;  2GFK A;  5AHR A;  4C1E A;  5EVD A;  2ZNB A;  4YSL A;  5EV8 A;  4HL2 A;  4H0D A;  5LS3 A;  5HIP A;  1ZTC A;  3I0V A;  4AWZ A;  1HLK A;  5K4M A;  4C1F A;  4AD9 A;  5HH6 A;  5A0V A;  1JT1 A;  2P18 A;  2QJS A;  1QH5 A;  4RAW A;  2BC2 A;  1VJN A;  5AEB A;  4FR7 A;  4ZO2 A;  4UA4 A;  5FQB A;  5B3R A;  4C09 A;  5ACQ A;  1MQO A;  4D1U A;  1SML A;  3G1P A;  3DHC A;  3JXP A;  4DIL A;  2GCU A;  3IE2 A;  4Z5Z A;  3X2X A;  3ZR9 A;  4O98 A;  2VW8 A;  4RBS A;  5A87 A;  3DHB A;  4AWY B;  1BMC A;  5ACV A;  3IEL A;  4EYF A;  1WUP A;  1BC2 A;  3T3O A;  4RAM A;  4NQ2 A;  3AF6 A;  3TP9 A;  2BFK A;  5K0W A;  1E5D A;  2YCB A;  2Q42 A;  1KO3 A;  4J5H A;  3L6N A;  3F9O A;  1XM8 A;  2AIO A;  2YNT A;  2UYX A;  5LCF A;  4DIK A;  3ZNB A;  4V0H A;  5B1U A;  4UWP B;  3KL7 A;  3X30 A;  4ZNB A;  2QED A;  5HIQ A;  4Z5Y A;  1X8H A;  2BTN A;  2QDT A;  5LE1 A;  1XTO A;  4NQ4 A;  3BV6 A;  2OHH A;  1ZKP A;  5ACU A;  4B87 A;  2Q0J A;  3SRX A;  5A5Z A;  5ACS A;  5LSC A;  3KNR A;  5IQK A;  2A7M A;  2BR6 A;  1A8T A;  3PY5 A;  2YNU A;  4TZB A;  2I7V A;  5ACT A;  2Q0I A;  2ZZI A;  4TZE A;  4FSB A;  3T9M A;  3VQZ A;  5A0T A;  4XWT A;  5LM6 A;  2FU7 A;  5HIO A;  5ACP A;  5EHT A;  2BG2 A;  3IE1 A;  2YZ3 A;  1P9E A;  2ZWR A;  3BC2 A;  3SBL A;  4PVT A;  3I15 A;  4CHL A;  2FU6 A;  2WYM A;  2WYL A;  4C1C A;  2Y8A A;  5EVK A;  1L9Y A;  4BP0 A;  1DD6 A;  2BG6 A;  4F6H A;  5DPX A;  4UWS B;  2BMI A;  4TZF A;  1X8I A;  2YNT B;  4GYU A;  4HL1 A;  5KIL A;  5EV6 A;  3VPE A;  1DDK A;  2Y87 A;  3MD7 A;  4Z6X A;  4HKY A;  4GYQ A;  3X2Z A;  2WRS A;  3WXC A;  2HB9 A;  2YNW A;  2P97 A;  4D1T A;  4KEP A;  3S0Z A;  3ADR A;  4JO0 A;  4EXY A;  3I14 A;  3DHA A;  3BK2 A;  1DXK A;  4UWO B;  4C1D A;  2H6A A;  2I7X A;  3AJ3 A;  2OHJ A;  5K4K A;  4EYB A;  1K07 A;  5LLD A;  3Q6V A;  4YSK A;  1VGN A;  5EW0 A;  2GKL A;  2BGA A;  4TYT A;  5LCA A;  2AZ4 A;  1BVT A;  5K4N A;  3IEM A;  4NQ6 A;  5KIK A;  5HH5 A;  4RM5 A;  2OHI A;  1ZNB A;  4EYL A;  5HIS A;  2YNV B;  5AXO A;  2ZO4 A;  2CBN A;  5EH9 A;  4LE6 A;  4EY2 A;  3ESH A;  5HH4 A;  5ACW A;  4UWR B;  1YCG A;  2FM6 A;  1JJT A;  4YSB A;  1WRA A;  4KEQ A;  1WUO A;  3PG4 A;  1A7T A;  2QDS A;  2BG8 A;  3T3N A;  2FHX A;  3RKJ A;  1KO2 A;  4D1W A;  3KNS A;  2FHX B;  2GMN A;  4D02 A;  2NZF A;  3AF5 A;  2BG7 A;  3P2U A;  4Z7R A;  4TZ9 A;  3SFP A;  3IDZ A;  3I11 A;  5AHO A;  3IE0 A;  3QH8 A;  2I7T A;  3SPU A;  2BFZ A;  5ACR A;  2NZE A;  4PVO A;  3X2Y A;  5LMC A;  4GCW A;  2DOO A;  5EVB A;  2YNV A;  2QIN A;  3IOG A;  5EWA A;  1QH3 A;  4C1G A;  2BIB A;  5LCH A;  3ZQ4 A;  4AX0 B;  4Z67 A;  2DKF A;  3LVZ A;  4Z60 A;  2Q9U A;  2FU8 A;  2NXA A;  3R2U A;  1X8G A;  4F6Z A;  4J5F A;  4UAM A;  5AYA A;  4U4L A;  5B15 A;  3I13 A;  3RKK A;  1KR3 A;  4C1H A;  2NYP A;  5FQA A;  4AX1 B;  2BFZ B;  4UBQ A;  3SD9 A;  2FK6 A;  4TYF A;  2R2D A;  3FAI A;  4XUK A;  5AXR A;  4RL0 A;  2P4Z A;  3DH8 A;  3H3E A;  2M5C A;  2WYM C;  4XWW A;  1YCH A;  1JJE A;  2Y8B A;  1VME A;  4D1V A;  1WW1 A;  4ZO3 A;  3ZWF A;  3IEK A;  1YCF A;  2WHG A;  4EXS A;  4WD6 A;  3FCZ A;  4NQ5 A;  2FU9 A;  3IOF A;  3BK1 A;  4FEK A;  5ACX A;  4ZEJ A;  2M5D A;  2E7Y A;  4BZ3 A;  2BG8 B;  1Y44 A;  2BFL A;  2XF4 A;  3SW3 A;  1M2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...