2FHXA

Pseudomonas aeruginosa spm-1 metallo-beta-lactamase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
245
structure length
244
Chain Sequence
DHVDLPYNLTATKIDSDVFVVTDRDFYSSNVLVAKMLDGTVVIVSSPFENLGTQTLMDWVAKTMKPKKVVAINTHFHLDGTGGNEIYKKMGAETWSSDLTKQLRLEENKKDRIKAAEFYKNEDLKRRILSSHPVPADNVFDLKQGKVFSFSNELVEVSFPGPAHSPDNVVVYFPKKKLLFGGMIKPKELGYLGDANVKAWPDSARRLKKFDAKIVIPGHGEWGGPEMVNKTIKVAEKAVGEMRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPM-1
publication title Crystal Structure of Pseudomonas aeruginosa SPM-1 Provides Insights into Variable Zinc Affinity of Metallo-beta-lactamases.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase, metal binding protein
total genus 75
structure length 244
sequence length 245
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2fhxA00
4F6ZA 5IQKA 4J5HA 4B87A 3X30A 5LLDA 5EV6A 5ACQA 4TZEA 2UYXA 2QEDA 1M2XA 2YCBA 2WYLA 2YNTB 3F9OA 2HB9A 4EYFA 1QH3A 4TZ9A 5KILA 4D1WA 2VW8A 5ACXA 5AEBA 3SPUA 4NQ6A 2BG2A 4YSBA 3LVZA 2AIOA 5AXOA 2QINA 3PY5A 4H0DA 5LCFA 3IE1A 2P4ZA 4NQ4A 1A7TA 3VPEA 5LCAA 5LMCA 5EWAA 4PVOA 4ZO2A 5AHOA 5LSCA 4WD6A 4UWRB 4Z7RA 2NYPA 5HISA 3X2YA 3JXPA 3SRXA 3BV6A 1KR3A 3A4YA 2FU9A 5B15A 2WHGA 4TYTA 2GMNA 2NZFA 3IELA 1DD6A 4U4LA 5HH4A 4P62A 2YNUA 4XWTA 3IE0A 4UA4A 2YNVA 3AJ3A 2BFZB 3IEKA 4RAMA 2BC2A 4AD9A 4HL1A 2WRSA 1XTOA 2WYMA 4EY2A 3AF6A 2GFJA 2Q9UA 5ACRA 2BR6A 3KNRA 3VQZA 5EVBA 2NZEA 2GFKA 2ZWRA 1BC2A 3FCZA 4Z5YA 3ADRA 1DXKA 5HIPA 4AWYB 3IE2A 4C1CA 1SMLA 1KO2A 2ZZIA 2Y8AA 4UBQA 3SW3A 3PG4A 3MD7A 4ZO3A 4D1TA 3P2UA 2QDTA 1YCFA 3IOFA 5A5ZA 2BG6A 3DHAA 2GCUA 4GYQA 3DH8A 4FSBA 4CHLA 4YSLA 3I11A 4GCWA 4C09A 2Q42A 2YNWA 3ESHA 4FEKA 5EW0A 2P18A 2YNTA 1P9EA 4UWOB 3PY6A 4AX0B 2I7VA 2NXAA 4AX1B 3T3NA 3ZR9A 5EHTA 4C1FA 4XWWA 2BFLA 5B3RA 2GKLA 4F6HA 4GYUA 2Q0IA 5ACUA 1ZKPA 2R2DA 4RM5A 1VJNA 2XF4A 4HKYA 2WYMC 3RKKA 1VMEA 5AHRA 5FQBA 4XUKA 4EYBA 1ZNBA 3WXCA 1ZTCA 1VGNA 5DPXA 2ZO4A 1Y44A 5AYAA 2BG8B 5ACVA 3I15A 2BTNA 3L6NA 5EVDA 4Z6XA 3ZNBA 2FHXA 4AWZA 4PVTA 5KIKA 2FU8A 4NQ5A 5K4MA 4JO0A 5EVKA 5EH9A 2YNVB 4UAMA 3I14A 5K4KA 4TYFA 3X2XA 2BGAA 3Q6VA 1X8IA 1DDKA 1WRAA 2OHHA 4D02A 3T9MA 4D1UA 3BK1A 3KNSA 4EXYA 4C1EA 4DILA 2P97A 4EYLA 5FQCA 4Z60A 3DHBA 4Z5ZA 5HIQA 4O98A 4LE6A 5K4NA 3R2UA 5HH6A 4NQ2A 2A7MA 5ACSA 3G1PA 1JJTA 2BG7A 4C1HA 4RL2A 1X8HA 4KEQA 4RL0A 5A87A 4EFZA 1K07A 3TP9A 4DIKA 1KO3A 2ZNBA 4ZNBA 4D1VA 2QJSA 5A0VA 3QH8A 2Y87A 5A0TA 3IEMA 2M5DA 2BIBA 2OHIA 2CBNA 2YZ3A 5LM6A 1WUPA 2DKFA 1WW1A 2I7XA 4TZFA 4UWPB 3RPCA 2OHJA 3I13A 5ACPA 3AF5A 3RKJA 2P1EA 4HL2A 3S0ZA 4RAWA 2Y8BA 3KL7A 2Q0JA 4TZBA 2FU6A 2FK6A 1E5DA 2M5CA 1YCHA 4YSKA 3X2ZA 4RBSA 4C1GA 4Z67A 1A8TA 2AZ4A 3FAIA 5ACWA 3SFPA 1XM8A 1QH5A 1HLKA 2BG8A 2BMIA 5FQAA 1JT1A 3DHCA 3SD9A 2FU7A 2QDSA 3I0VA 1X8GA 4V0HA 1BMCA 4BP0A 2BFZA 5EV8A 1L9YA 5HH5A 2FHXB 3BC2A 5LCHA 4C1DA 2XR1A 5LS3A 3ZQ4A 4BZ3A 3SBLA 5HIOA 4EXSA 2DOOA 5K0WA 2FM6A 1MQOA 1JJEA 4KEPA 1WUOA 5LE1A 5ACTA 2BFKA 5AXRA 2H6AA 3IOGA 1YCGA 3IDZA 2E7YA 1BVTA 5B1UA 3H3EA 4ZEJA 4UWSB 4FR7A 4J5FA 3T3OA 3ZWFA 2I7TA 3BK2A
chains in the Genus database with same CATH superfamily
4F6ZA 5IQKA 4J5HA 4B87A 3X30A 5LLDA 5EV6A 5ACQA 4TZEA 2UYXA 2QEDA 1M2XA 2YCBA 2WYLA 2YNTB 3F9OA 2HB9A 4EYFA 1QH3A 4TZ9A 5KILA 4D1WA 2VW8A 5ACXA 5AEBA 3SPUA 4NQ6A 2BG2A 4YSBA 3LVZA 2AIOA 5AXOA 2QINA 3PY5A 4H0DA 5LCFA 3IE1A 2P4ZA 4NQ4A 1A7TA 3VPEA 5LCAA 5LMCA 5EWAA 4PVOA 4ZO2A 5AHOA 5LSCA 4WD6A 4UWRB 4Z7RA 2NYPA 5HISA 3X2YA 3JXPA 3SRXA 3BV6A 1KR3A 3A4YA 2FU9A 5B15A 2WHGA 4TYTA 2GMNA 4PDXA 2NZFA 3IELA 1DD6A 4U4LA 5HH4A 4P62A 2YNUA 4XWTA 3IE0A 4UA4A 2YNVA 3AJ3A 2BFZB 3IEKA 4RAMA 2BC2A 5AJLA 4AD9A 4HL1A 2WRSA 1XTOA 2WYMA 4EY2A 3AF6A 2GFJA 5A23A 2Q9UA 5ACRA 2BR6A 3KNRA 2CFUA 3VQZA 5EVBA 2NZEA 2GFKA 4AV7A 2ZWRA 1BC2A 3FCZA 4Z5YA 3ADRA 1DXKA 5HIPA 4AWYB 3IE2A 4C1CA 1SMLA 1KO2A 2ZZIA 2Y8AA 4UBQA 3SW3A 3PG4A 3MD7A 4ZO3A 4D1TA 3P2UA 2QDTA 1YCFA 3IOFA 5A5ZA 2YHEA 2BG6A 3DHAA 2GCUA 4GYQA 3DH8A 4FSBA 4CHLA 4YSLA 3I11A 4GCWA 4C09A 2Q42A 2YNWA 3ESHA 4FEKA 5EW0A 2P18A 2YNTA 1P9EA 4UWOB 3PY6A 4AX0B 2I7VA 2NXAA 4AX1B 3T3NA 3ZR9A 5EHTA 4C1FA 4XWWA 2BFLA 5B3RA 2GKLA 4F6HA 4GYUA 2Q0IA 5ACUA 1ZKPA 2R2DA 4RM5A 1VJNA 2XF4A 4HKYA 2WYMC 3RKKA 1VMEA 5AHRA 5FQBA 4XUKA 4EYBA 1ZNBA 3WXCA 1ZTCA 1VGNA 5DPXA 2ZO4A 1Y44A 5AYAA 2BG8B 5ACVA 3I15A 2BTNA 3L6NA 5EVDA 4Z6XA 3ZNBA 2FHXA 4AWZA 4PVTA 5KIKA 2FU8A 4NQ5A 5K4MA 4JO0A 5EVKA 5EH9A 2YNVB 4UAMA 3I14A 5K4KA 4TYFA 3X2XA 2BGAA 3Q6VA 1X8IA 1DDKA 2CFZA 1WRAA 2OHHA 4D02A 3T9MA 4D1UA 3BK1A 3KNSA 4EXYA 4C1EA 4DILA 2P97A 4EYLA 5FQCA 4Z60A 3DHBA 4Z5ZA 5HIQA 4O98A 4LE6A 5K4NA 3R2UA 5HH6A 4NQ2A 2A7MA 5ACSA 3G1PA 1JJTA 4AXHA 2BG7A 4C1HA 4RL2A 1X8HA 4KEQA 4RL0A 5A87A 4EFZA 1K07A 3TP9A 4DIKA 1KO3A 2ZNBA 4ZNBA 4D1VA 2QJSA 5A0VA 2CG3A 3QH8A 2Y87A 5A0TA 3IEMA 2M5DA 2BIBA 2OHIA 2CBNA 2YZ3A 5LM6A 2CG2A 1WUPA 2DKFA 1WW1A 2I7XA 4TZFA 4UWPB 3RPCA 2OHJA 3I13A 5ACPA 3AF5A 4NURA 3RKJA 2P1EA 4HL2A 3S0ZA 4RAWA 2Y8BA 3KL7A 2Q0JA 4TZBA 2FU6A 2FK6A 1E5DA 2M5CA 1YCHA 4YSKA 3X2ZA 4RBSA 4C1GA 4Z67A 1A8TA 2AZ4A 3FAIA 5ACWA 3SFPA 1XM8A 1QH5A 1HLKA 2BG8A 2BMIA 5FQAA 1JT1A 3DHCA 3SD9A 2FU7A 2QDSA 3I0VA 1X8GA 4V0HA 1BMCA 4BP0A 2BFZA 5EV8A 1L9YA 5HH5A 2FHXB 3BC2A 5LCHA 4C1DA 2XR1A 5LS3A 3ZQ4A 4BZ3A 3SBLA 5HIOA 4EXSA 2DOOA 5K0WA 2FM6A 1MQOA 1JJEA 4KEPA 1WUOA 5LE1A 5ACTA 5AIJA 2BFKA 5AXRA 2H6AA 3IOGA 1YCGA 3IDZA 2E7YA 1BVTA 5B1UA 3H3EA 4ZEJA 4UWSB 4FR7A 4J5FA 3T3OA 3ZWFA 2I7TA 3BK2A
chains in the Genus database with same CATH topology
4F6ZA 5IQKA 4J5HA 4B87A 3X30A 5LLDA 5EV6A 5ACQA 4TZEA 2UYXA 2QEDA 1M2XA 2YCBA 2WYLA 2YNTB 3F9OA 2HB9A 4EYFA 1QH3A 4TZ9A 5KILA 4D1WA 2VW8A 5ACXA 5AEBA 3SPUA 4NQ6A 2BG2A 4YSBA 3LVZA 2AIOA 5AXOA 2QINA 3PY5A 4H0DA 5LCFA 3IE1A 2P4ZA 4NQ4A 1A7TA 3VPEA 5LCAA 5LMCA 5EWAA 4PVOA 4ZO2A 5AHOA 5LSCA 4WD6A 4UWRB 4Z7RA 2NYPA 5HISA 3X2YA 3JXPA 3SRXA 3BV6A 1KR3A 3A4YA 2FU9A 5B15A 2WHGA 4TYTA 2GMNA 2NZFA 3IELA 1DD6A 4U4LA 5HH4A 4P62A 2YNUA 4XWTA 3IE0A 4UA4A 2YNVA 3AJ3A 2BFZB 3IEKA 4RAMA 2BC2A 4AD9A 4HL1A 2WRSA 1XTOA 2WYMA 4EY2A 3AF6A 2GFJA 2Q9UA 5ACRA 2BR6A 3KNRA 3VQZA 5EVBA 2NZEA 2GFKA 2ZWRA 1BC2A 3FCZA 4Z5YA 3ADRA 1DXKA 5HIPA 4AWYB 3IE2A 4C1CA 1SMLA 1KO2A 2ZZIA 2Y8AA 4UBQA 3SW3A 3PG4A 3MD7A 4ZO3A 4D1TA 3P2UA 2QDTA 1YCFA 3IOFA 5A5ZA 2BG6A 3DHAA 2GCUA 4GYQA 3DH8A 4FSBA 4CHLA 4YSLA 3I11A 4GCWA 4C09A 2Q42A 2YNWA 3ESHA 4FEKA 5EW0A 2P18A 2YNTA 1P9EA 4UWOB 3PY6A 4AX0B 2I7VA 2NXAA 4AX1B 3T3NA 3ZR9A 5EHTA 4C1FA 4XWWA 2BFLA 5B3RA 2GKLA 4F6HA 4GYUA 2Q0IA 5ACUA 1ZKPA 2R2DA 4RM5A 1VJNA 2XF4A 4HKYA 2WYMC 3RKKA 1VMEA 5AHRA 5FQBA 4XUKA 4EYBA 1ZNBA 3WXCA 1ZTCA 1VGNA 5DPXA 2ZO4A 1Y44A 5AYAA 2BG8B 5ACVA 3I15A 2BTNA 3L6NA 5EVDA 4Z6XA 3ZNBA 2FHXA 4AWZA 4PVTA 5KIKA 2FU8A 4NQ5A 5K4MA 4JO0A 5EVKA 5EH9A 2YNVB 4UAMA 3I14A 5K4KA 4TYFA 3X2XA 2BGAA 3Q6VA 1X8IA 1DDKA 1WRAA 2OHHA 4D02A 3T9MA 4D1UA 3BK1A 3KNSA 4EXYA 4C1EA 4DILA 2P97A 4EYLA 5FQCA 4Z60A 3DHBA 4Z5ZA 5HIQA 4O98A 4LE6A 5K4NA 3R2UA 5HH6A 4NQ2A 2A7MA 5ACSA 3G1PA 1JJTA 2BG7A 4C1HA 4RL2A 1X8HA 4KEQA 4RL0A 5A87A 4EFZA 1K07A 3TP9A 4DIKA 1KO3A 2ZNBA 4ZNBA 4D1VA 2QJSA 5A0VA 3QH8A 2Y87A 5A0TA 3IEMA 2M5DA 2BIBA 2OHIA 2CBNA 2YZ3A 5LM6A 1WUPA 2DKFA 1WW1A 2I7XA 4TZFA 4UWPB 3RPCA 2OHJA 3I13A 5ACPA 3AF5A 3RKJA 2P1EA 4HL2A 3S0ZA 4RAWA 2Y8BA 3KL7A 2Q0JA 4TZBA 2FU6A 2FK6A 1E5DA 2M5CA 1YCHA 4YSKA 3X2ZA 4RBSA 4C1GA 4Z67A 1A8TA 2AZ4A 3FAIA 5ACWA 3SFPA 1XM8A 1QH5A 1HLKA 2BG8A 2BMIA 5FQAA 1JT1A 3DHCA 3SD9A 2FU7A 2QDSA 3I0VA 1X8GA 4V0HA 1BMCA 4BP0A 2BFZA 5EV8A 1L9YA 5HH5A 2FHXB 3BC2A 5LCHA 4C1DA 2XR1A 5LS3A 3ZQ4A 4BZ3A 3SBLA 5HIOA 4EXSA 2DOOA 5K0WA 2FM6A 1MQOA 1JJEA 4KEPA 1WUOA 5LE1A 5ACTA 2BFKA 5AXRA 2H6AA 3IOGA 1YCGA 3IDZA 2E7YA 1BVTA 5B1UA 3H3EA 4ZEJA 4UWSB 4FR7A 4J5FA 3T3OA 3ZWFA 2I7TA 3BK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F6Z A;  5IQK A;  4J5H A;  4B87 A;  3X30 A;  5LLD A;  5EV6 A;  5ACQ A;  4TZE A;  2UYX A;  2QED A;  1M2X A;  2YCB A;  2WYL A;  2YNT B;  3F9O A;  2HB9 A;  4EYF A;  1QH3 A;  4TZ9 A;  5KIL A;  4D1W A;  2VW8 A;  5ACX A;  5AEB A;  3SPU A;  4NQ6 A;  2BG2 A;  4YSB A;  3LVZ A;  2AIO A;  5AXO A;  2QIN A;  3PY5 A;  4H0D A;  5LCF A;  3IE1 A;  2P4Z A;  4NQ4 A;  1A7T A;  3VPE A;  5LCA A;  5LMC A;  5EWA A;  4PVO A;  4ZO2 A;  5AHO A;  5LSC A;  4WD6 A;  4UWR B;  4Z7R A;  2NYP A;  5HIS A;  3X2Y A;  3JXP A;  3SRX A;  3BV6 A;  1KR3 A;  3A4Y A;  2FU9 A;  5B15 A;  2WHG A;  4TYT A;  2GMN A;  2NZF A;  3IEL A;  1DD6 A;  4U4L A;  5HH4 A;  4P62 A;  2YNU A;  4XWT A;  3IE0 A;  4UA4 A;  2YNV A;  3AJ3 A;  2BFZ B;  3IEK A;  4RAM A;  2BC2 A;  4AD9 A;  4HL1 A;  2WRS A;  1XTO A;  2WYM A;  4EY2 A;  3AF6 A;  2GFJ A;  2Q9U A;  5ACR A;  2BR6 A;  3KNR A;  3VQZ A;  5EVB A;  2NZE A;  2GFK A;  2ZWR A;  1BC2 A;  3FCZ A;  4Z5Y A;  3ADR A;  1DXK A;  5HIP A;  4AWY B;  3IE2 A;  4C1C A;  1SML A;  1KO2 A;  2ZZI A;  2Y8A A;  4UBQ A;  3SW3 A;  3PG4 A;  3MD7 A;  4ZO3 A;  4D1T A;  3P2U A;  2QDT A;  1YCF A;  3IOF A;  5A5Z A;  2BG6 A;  3DHA A;  2GCU A;  4GYQ A;  3DH8 A;  4FSB A;  4CHL A;  4YSL A;  3I11 A;  4GCW A;  4C09 A;  2Q42 A;  2YNW A;  3ESH A;  4FEK A;  5EW0 A;  2P18 A;  2YNT A;  1P9E A;  4UWO B;  3PY6 A;  4AX0 B;  2I7V A;  2NXA A;  4AX1 B;  3T3N A;  3ZR9 A;  5EHT A;  4C1F A;  4XWW A;  2BFL A;  5B3R A;  2GKL A;  4F6H A;  4GYU A;  2Q0I A;  5ACU A;  1ZKP A;  2R2D A;  4RM5 A;  1VJN A;  2XF4 A;  4HKY A;  2WYM C;  3RKK A;  1VME A;  5AHR A;  5FQB A;  4XUK A;  4EYB A;  1ZNB A;  3WXC A;  1ZTC A;  1VGN A;  5DPX A;  2ZO4 A;  1Y44 A;  5AYA A;  2BG8 B;  5ACV A;  3I15 A;  2BTN A;  3L6N A;  5EVD A;  4Z6X A;  3ZNB A;  2FHX A;  4AWZ A;  4PVT A;  5KIK A;  2FU8 A;  4NQ5 A;  5K4M A;  4JO0 A;  5EVK A;  5EH9 A;  2YNV B;  4UAM A;  3I14 A;  5K4K A;  4TYF A;  3X2X A;  2BGA A;  3Q6V A;  1X8I A;  1DDK A;  1WRA A;  2OHH A;  4D02 A;  3T9M A;  4D1U A;  3BK1 A;  3KNS A;  4EXY A;  4C1E A;  4DIL A;  2P97 A;  4EYL A;  5FQC A;  4Z60 A;  3DHB A;  4Z5Z A;  5HIQ A;  4O98 A;  4LE6 A;  5K4N A;  3R2U A;  5HH6 A;  4NQ2 A;  2A7M A;  5ACS A;  3G1P A;  1JJT A;  2BG7 A;  4C1H A;  4RL2 A;  1X8H A;  4KEQ A;  4RL0 A;  5A87 A;  4EFZ A;  1K07 A;  3TP9 A;  4DIK A;  1KO3 A;  2ZNB A;  4ZNB A;  4D1V A;  2QJS A;  5A0V A;  3QH8 A;  2Y87 A;  5A0T A;  3IEM A;  2M5D A;  2BIB A;  2OHI A;  2CBN A;  2YZ3 A;  5LM6 A;  1WUP A;  2DKF A;  1WW1 A;  2I7X A;  4TZF A;  4UWP B;  3RPC A;  2OHJ A;  3I13 A;  5ACP A;  3AF5 A;  3RKJ A;  2P1E A;  4HL2 A;  3S0Z A;  4RAW A;  2Y8B A;  3KL7 A;  2Q0J A;  4TZB A;  2FU6 A;  2FK6 A;  1E5D A;  2M5C A;  1YCH A;  4YSK A;  3X2Z A;  4RBS A;  4C1G A;  4Z67 A;  1A8T A;  2AZ4 A;  3FAI A;  5ACW A;  3SFP A;  1XM8 A;  1QH5 A;  1HLK A;  2BG8 A;  2BMI A;  5FQA A;  1JT1 A;  3DHC A;  3SD9 A;  2FU7 A;  2QDS A;  3I0V A;  1X8G A;  4V0H A;  1BMC A;  4BP0 A;  2BFZ A;  5EV8 A;  1L9Y A;  5HH5 A;  2FHX B;  3BC2 A;  5LCH A;  4C1D A;  2XR1 A;  5LS3 A;  3ZQ4 A;  4BZ3 A;  3SBL A;  5HIO A;  4EXS A;  2DOO A;  5K0W A;  2FM6 A;  1MQO A;  1JJE A;  4KEP A;  1WUO A;  5LE1 A;  5ACT A;  2BFK A;  5AXR A;  2H6A A;  3IOG A;  1YCG A;  3IDZ A;  2E7Y A;  1BVT A;  5B1U A;  3H3E A;  4ZEJ A;  4UWS B;  4FR7 A;  4J5F A;  3T3O A;  3ZWF A;  2I7T A;  3BK2 A; 
#chains in the Genus database with same CATH topology
 4F6Z A;  5IQK A;  4J5H A;  4B87 A;  3X30 A;  5LLD A;  5EV6 A;  5ACQ A;  4TZE A;  2UYX A;  2QED A;  1M2X A;  2YCB A;  2WYL A;  2YNT B;  3F9O A;  2HB9 A;  4EYF A;  1QH3 A;  4TZ9 A;  5KIL A;  4D1W A;  2VW8 A;  5ACX A;  5AEB A;  3SPU A;  4NQ6 A;  2BG2 A;  4YSB A;  3LVZ A;  2AIO A;  5AXO A;  2QIN A;  3PY5 A;  4H0D A;  5LCF A;  3IE1 A;  2P4Z A;  4NQ4 A;  1A7T A;  3VPE A;  5LCA A;  5LMC A;  5EWA A;  4PVO A;  4ZO2 A;  5AHO A;  5LSC A;  4WD6 A;  4UWR B;  4Z7R A;  2NYP A;  5HIS A;  3X2Y A;  3JXP A;  3SRX A;  3BV6 A;  1KR3 A;  3A4Y A;  2FU9 A;  5B15 A;  2WHG A;  4TYT A;  2GMN A;  4PDX A;  2NZF A;  3IEL A;  1DD6 A;  4U4L A;  5HH4 A;  4P62 A;  2YNU A;  4XWT A;  3IE0 A;  4UA4 A;  2YNV A;  3AJ3 A;  2BFZ B;  3IEK A;  4RAM A;  2BC2 A;  5AJL A;  4AD9 A;  4HL1 A;  2WRS A;  1XTO A;  2WYM A;  4EY2 A;  3AF6 A;  2GFJ A;  5A23 A;  2Q9U A;  5ACR A;  2BR6 A;  3KNR A;  2CFU A;  3VQZ A;  5EVB A;  2NZE A;  2GFK A;  4AV7 A;  2ZWR A;  1BC2 A;  3FCZ A;  4Z5Y A;  3ADR A;  1DXK A;  5HIP A;  4AWY B;  3IE2 A;  4C1C A;  1SML A;  1KO2 A;  2ZZI A;  2Y8A A;  4UBQ A;  3SW3 A;  3PG4 A;  3MD7 A;  4ZO3 A;  4D1T A;  3P2U A;  2QDT A;  1YCF A;  3IOF A;  5A5Z A;  2YHE A;  2BG6 A;  3DHA A;  2GCU A;  4GYQ A;  3DH8 A;  4FSB A;  4CHL A;  4YSL A;  3I11 A;  4GCW A;  4C09 A;  2Q42 A;  2YNW A;  3ESH A;  4FEK A;  5EW0 A;  2P18 A;  2YNT A;  1P9E A;  4UWO B;  3PY6 A;  4AX0 B;  2I7V A;  2NXA A;  4AX1 B;  3T3N A;  3ZR9 A;  5EHT A;  4C1F A;  4XWW A;  2BFL A;  5B3R A;  2GKL A;  4F6H A;  4GYU A;  2Q0I A;  5ACU A;  1ZKP A;  2R2D A;  4RM5 A;  1VJN A;  2XF4 A;  4HKY A;  2WYM C;  3RKK A;  1VME A;  5AHR A;  5FQB A;  4XUK A;  4EYB A;  1ZNB A;  3WXC A;  1ZTC A;  1VGN A;  5DPX A;  2ZO4 A;  1Y44 A;  5AYA A;  2BG8 B;  5ACV A;  3I15 A;  2BTN A;  3L6N A;  5EVD A;  4Z6X A;  3ZNB A;  2FHX A;  4AWZ A;  4PVT A;  5KIK A;  2FU8 A;  4NQ5 A;  5K4M A;  4JO0 A;  5EVK A;  5EH9 A;  2YNV B;  4UAM A;  3I14 A;  5K4K A;  4TYF A;  3X2X A;  2BGA A;  3Q6V A;  1X8I A;  1DDK A;  2CFZ A;  1WRA A;  2OHH A;  4D02 A;  3T9M A;  4D1U A;  3BK1 A;  3KNS A;  4EXY A;  4C1E A;  4DIL A;  2P97 A;  4EYL A;  5FQC A;  4Z60 A;  3DHB A;  4Z5Z A;  5HIQ A;  4O98 A;  4LE6 A;  5K4N A;  3R2U A;  5HH6 A;  4NQ2 A;  2A7M A;  5ACS A;  3G1P A;  1JJT A;  4AXH A;  2BG7 A;  4C1H A;  4RL2 A;  1X8H A;  4KEQ A;  4RL0 A;  5A87 A;  4EFZ A;  1K07 A;  3TP9 A;  4DIK A;  1KO3 A;  2ZNB A;  4ZNB A;  4D1V A;  2QJS A;  5A0V A;  2CG3 A;  3QH8 A;  2Y87 A;  5A0T A;  3IEM A;  2M5D A;  2BIB A;  2OHI A;  2CBN A;  2YZ3 A;  5LM6 A;  2CG2 A;  1WUP A;  2DKF A;  1WW1 A;  2I7X A;  4TZF A;  4UWP B;  3RPC A;  2OHJ A;  3I13 A;  5ACP A;  3AF5 A;  4NUR A;  3RKJ A;  2P1E A;  4HL2 A;  3S0Z A;  4RAW A;  2Y8B A;  3KL7 A;  2Q0J A;  4TZB A;  2FU6 A;  2FK6 A;  1E5D A;  2M5C A;  1YCH A;  4YSK A;  3X2Z A;  4RBS A;  4C1G A;  4Z67 A;  1A8T A;  2AZ4 A;  3FAI A;  5ACW A;  3SFP A;  1XM8 A;  1QH5 A;  1HLK A;  2BG8 A;  2BMI A;  5FQA A;  1JT1 A;  3DHC A;  3SD9 A;  2FU7 A;  2QDS A;  3I0V A;  1X8G A;  4V0H A;  1BMC A;  4BP0 A;  2BFZ A;  5EV8 A;  1L9Y A;  5HH5 A;  2FHX B;  3BC2 A;  5LCH A;  4C1D A;  2XR1 A;  5LS3 A;  3ZQ4 A;  4BZ3 A;  3SBL A;  5HIO A;  4EXS A;  2DOO A;  5K0W A;  2FM6 A;  1MQO A;  1JJE A;  4KEP A;  1WUO A;  5LE1 A;  5ACT A;  5AIJ A;  2BFK A;  5AXR A;  2H6A A;  3IOG A;  1YCG A;  3IDZ A;  2E7Y A;  1BVT A;  5B1U A;  3H3E A;  4ZEJ A;  4UWS B;  4FR7 A;  4J5F A;  3T3O A;  3ZWF A;  2I7T A;  3BK2 A; 
#chains in the Genus database with same CATH homology
 4F6Z A;  5IQK A;  4J5H A;  4B87 A;  3X30 A;  5LLD A;  5EV6 A;  5ACQ A;  4TZE A;  2UYX A;  2QED A;  1M2X A;  2YCB A;  2WYL A;  2YNT B;  3F9O A;  2HB9 A;  4EYF A;  1QH3 A;  4TZ9 A;  5KIL A;  4D1W A;  2VW8 A;  5ACX A;  5AEB A;  3SPU A;  4NQ6 A;  2BG2 A;  4YSB A;  3LVZ A;  2AIO A;  5AXO A;  2QIN A;  3PY5 A;  4H0D A;  5LCF A;  3IE1 A;  2P4Z A;  4NQ4 A;  1A7T A;  3VPE A;  5LCA A;  5LMC A;  5EWA A;  4PVO A;  4ZO2 A;  5AHO A;  5LSC A;  4WD6 A;  4UWR B;  4Z7R A;  2NYP A;  5HIS A;  3X2Y A;  3JXP A;  3SRX A;  3BV6 A;  1KR3 A;  3A4Y A;  2FU9 A;  5B15 A;  2WHG A;  4TYT A;  2GMN A;  2NZF A;  3IEL A;  1DD6 A;  4U4L A;  5HH4 A;  4P62 A;  2YNU A;  4XWT A;  3IE0 A;  4UA4 A;  2YNV A;  3AJ3 A;  2BFZ B;  3IEK A;  4RAM A;  2BC2 A;  4AD9 A;  4HL1 A;  2WRS A;  1XTO A;  2WYM A;  4EY2 A;  3AF6 A;  2GFJ A;  2Q9U A;  5ACR A;  2BR6 A;  3KNR A;  3VQZ A;  5EVB A;  2NZE A;  2GFK A;  2ZWR A;  1BC2 A;  3FCZ A;  4Z5Y A;  3ADR A;  1DXK A;  5HIP A;  4AWY B;  3IE2 A;  4C1C A;  1SML A;  1KO2 A;  2ZZI A;  2Y8A A;  4UBQ A;  3SW3 A;  3PG4 A;  3MD7 A;  4ZO3 A;  4D1T A;  3P2U A;  2QDT A;  1YCF A;  3IOF A;  5A5Z A;  2BG6 A;  3DHA A;  2GCU A;  4GYQ A;  3DH8 A;  4FSB A;  4CHL A;  4YSL A;  3I11 A;  4GCW A;  4C09 A;  2Q42 A;  2YNW A;  3ESH A;  4FEK A;  5EW0 A;  2P18 A;  2YNT A;  1P9E A;  4UWO B;  3PY6 A;  4AX0 B;  2I7V A;  2NXA A;  4AX1 B;  3T3N A;  3ZR9 A;  5EHT A;  4C1F A;  4XWW A;  2BFL A;  5B3R A;  2GKL A;  4F6H A;  4GYU A;  2Q0I A;  5ACU A;  1ZKP A;  2R2D A;  4RM5 A;  1VJN A;  2XF4 A;  4HKY A;  2WYM C;  3RKK A;  1VME A;  5AHR A;  5FQB A;  4XUK A;  4EYB A;  1ZNB A;  3WXC A;  1ZTC A;  1VGN A;  5DPX A;  2ZO4 A;  1Y44 A;  5AYA A;  2BG8 B;  5ACV A;  3I15 A;  2BTN A;  3L6N A;  5EVD A;  4Z6X A;  3ZNB A;  2FHX A;  4AWZ A;  4PVT A;  5KIK A;  2FU8 A;  4NQ5 A;  5K4M A;  4JO0 A;  5EVK A;  5EH9 A;  2YNV B;  4UAM A;  3I14 A;  5K4K A;  4TYF A;  3X2X A;  2BGA A;  3Q6V A;  1X8I A;  1DDK A;  1WRA A;  2OHH A;  4D02 A;  3T9M A;  4D1U A;  3BK1 A;  3KNS A;  4EXY A;  4C1E A;  4DIL A;  2P97 A;  4EYL A;  5FQC A;  4Z60 A;  3DHB A;  4Z5Z A;  5HIQ A;  4O98 A;  4LE6 A;  5K4N A;  3R2U A;  5HH6 A;  4NQ2 A;  2A7M A;  5ACS A;  3G1P A;  1JJT A;  2BG7 A;  4C1H A;  4RL2 A;  1X8H A;  4KEQ A;  4RL0 A;  5A87 A;  4EFZ A;  1K07 A;  3TP9 A;  4DIK A;  1KO3 A;  2ZNB A;  4ZNB A;  4D1V A;  2QJS A;  5A0V A;  3QH8 A;  2Y87 A;  5A0T A;  3IEM A;  2M5D A;  2BIB A;  2OHI A;  2CBN A;  2YZ3 A;  5LM6 A;  1WUP A;  2DKF A;  1WW1 A;  2I7X A;  4TZF A;  4UWP B;  3RPC A;  2OHJ A;  3I13 A;  5ACP A;  3AF5 A;  3RKJ A;  2P1E A;  4HL2 A;  3S0Z A;  4RAW A;  2Y8B A;  3KL7 A;  2Q0J A;  4TZB A;  2FU6 A;  2FK6 A;  1E5D A;  2M5C A;  1YCH A;  4YSK A;  3X2Z A;  4RBS A;  4C1G A;  4Z67 A;  1A8T A;  2AZ4 A;  3FAI A;  5ACW A;  3SFP A;  1XM8 A;  1QH5 A;  1HLK A;  2BG8 A;  2BMI A;  5FQA A;  1JT1 A;  3DHC A;  3SD9 A;  2FU7 A;  2QDS A;  3I0V A;  1X8G A;  4V0H A;  1BMC A;  4BP0 A;  2BFZ A;  5EV8 A;  1L9Y A;  5HH5 A;  2FHX B;  3BC2 A;  5LCH A;  4C1D A;  2XR1 A;  5LS3 A;  3ZQ4 A;  4BZ3 A;  3SBL A;  5HIO A;  4EXS A;  2DOO A;  5K0W A;  2FM6 A;  1MQO A;  1JJE A;  4KEP A;  1WUO A;  5LE1 A;  5ACT A;  2BFK A;  5AXR A;  2H6A A;  3IOG A;  1YCG A;  3IDZ A;  2E7Y A;  1BVT A;  5B1U A;  3H3E A;  4ZEJ A;  4UWS B;  4FR7 A;  4J5F A;  3T3O A;  3ZWF A;  2I7T A;  3BK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...