2FHXA

Pseudomonas aeruginosa spm-1 metallo-beta-lactamase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
245
structure length
244
Chain Sequence
b'DHVDLPYNLTATKIDSDVFVVTDRDFYSSNVLVAKMLDGTVVIVSSPFENLGTQTLMDWVAKTMKPKKVVAINTHFHLDGTGGNEIYKKMGAETWSSDLTKQLRLEENKKDRIKAAEFYKNEDLKRRILSSHPVPADNVFDLKQGKVFSFSNELVEVSFPGPAHSPDNVVVYFPKKKLLFGGMIKPKELGYLGDANVKAWPDSARRLKKFDAKIVIPGHGEWGGPEMVNKTIKVAEKAVGEMRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPM-1
molecule tags Hydrolase, metal binding protein
source organism Pseudomonas aeruginosa
publication title Crystal Structure of Pseudomonas aeruginosa SPM-1 Provides Insights into Variable Zinc Affinity of Metallo-beta-lactamases.
pubmed doi rcsb
total genus 75
structure length 244
sequence length 245
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2fhxA00
3IE1A 2WYLA 2AZ4A 2YNVB 4BZ3A 4TZBA 4RL2A 2FU6A 4DIKA 2QEDA 1X8IA 3RPCA 1HLKA 1SMLA 2OHJA 4YSBA 1WUPA 4HL2A 5ACUA 4UA4A 2YCBA 4AWYB 4Z5ZA 3Q6VA 2ZNBA 3A4YA 5ACVA 1DXKA 1JJTA 3SFPA 4BP0A 2P1EA 3SD9A 4RAWA 5EVKA 3IOGA 2BG7A 1VJNA 2BTNA 3I14A 1VMEA 2BFZB 4F6HA 3SW3A 2ZO4A 1YCHA 3SRXA 4O98A 3BV6A 2YNUA 1YCFA 5A0VA 4EXYA 4AWZA 4EFZA 1ZTCA 4FR7A 4TZ9A 2Q42A 3X2YA 5HIQA 1MQOA 2DOOA 4NQ2A 4C09A 4D1VA 3ZWFA 4UWOB 4Z60A 4AX1B 4EYFA 4Z6XA 2BFKA 3ZNBA 1DD6A 2BFLA 3VPEA 2M5DA 5ACSA 2WYMC 4C1CA 2Q0JA 3ZR9A 4F6ZA 5A5ZA 4ZEJA 2FK6A 1XM8A 2BG8A 4KEPA 1X8HA 5K4NA 2YNWA 2BIBA 4NQ6A 3MD7A 3I11A 3LVZA 3SBLA 3IE0A 2NZEA 1X8GA 3L6NA 3F9OA 5FQCA 5KILA 5HH6A 5LM6A 1KR3A 2FHXA 2NYPA 3QH8A 4XUKA 1P9EA 3JXPA 3AF6A 4C1DA 2P97A 3FAIA 1BMCA 5EVDA 3KNSA 3IEMA 3R2UA 2NXAA 4JO0A 3ESHA 4RAMA 3DHAA 4PVOA 1BVTA 4XWTA 2QDTA 5ACRA 4ZNBA 3IOFA 2Q9UA 5ACXA 4J5HA 4C1EA 4EY2A 4CHLA 4XWWA 5EWAA 2Y8AA 2VW8A 2XF4A 4C1FA 3T3OA 1WRAA 2Q0IA 5HH4A 2BR6A 2GKLA 1QH5A 2GFJA 1ZNBA 4PVTA 3I15A 5K4MA 5HH5A 2A7MA 5AYAA 3IELA 2H6AA 4WD6A 5ACPA 4UWRB 2GCUA 1KO3A 3RKKA 1QH3A 4DILA 3FCZA 4EXSA 5LCHA 4RL0A 2FM6A 3TP9A 2P4ZA 5B1UA 5A87A 2YNTB 2FU9A 2UYXA 4RBSA 4GYQA 5A0TA 2BG2A 4YSLA 1XTOA 4NQ5A 4D1WA 2YZ3A 5EV8A 5LS3A 2P18A 3X2XA 4Z5YA 4RM5A 3ZQ4A 4Z7RA 3AJ3A 3KNRA 5FQAA 2YNTA 2FU8A 3BK1A 3VQZA 1JJEA 5ACQA 5KIKA 5HIPA 2M5CA 3I13A 4V0HA 3KL7A 4UWSB 4HKYA 5EW0A 4TYFA 5DPXA 4D1TA 2CBNA 1WW1A 2E7YA 4UWPB 1YCGA 2BFZA 3H3EA 5EH9A 3WXCA 2QJSA 4HL1A 3S0ZA 5HISA 5HIOA 3RKJA 5B3RA 3PY5A 5K0WA 5EHTA 2DKFA 2BG6A 2I7VA 2Y87A 2QINA 1A8TA 4AD9A 2XR1A 4AX0B 2GFKA 3DH8A 4UAMA 1ZKPA 5ACTA 4U4LA 2I7TA 4B87A 1M2XA 4EYBA 4Z67A 5LCFA 3SPUA 4J5FA 3PY6A 1K07A 1BC2A 2OHHA 1VGNA 5LE1A 2ZWRA 5AXOA 2QDSA 3T3NA 3X30A 2YNVA 2BGAA 3I0VA 1Y44A 1L9YA 4GCWA 4UBQA 2Y8BA 3IDZA 3T9MA 4TYTA 2I7XA 4EYLA 5FQBA 3DHCA 5LMCA 2BMIA 3P2UA 5AHOA 5B15A 4LE6A 1WUOA 3DHBA 3X2ZA 3PG4A 4C1HA 4C1GA 5EVBA 2BC2A 2BG8B 4TZFA 4P62A 5AHRA 3IEKA 3IE2A 4D02A 4FEKA 2WYMA 2HB9A 5EV6A 5LSCA 3BC2A 5IQKA 4NQ4A 5LLDA 2GMNA 2FHXB 4ZO2A 4GYUA 3ADRA 4KEQA 2ZZIA 4D1UA 2WRSA 2AIOA 1KO2A 3G1PA 5LCAA 1A7TA 4ZO3A 2FU7A 3AF5A 2OHIA 2R2DA 1E5DA 4FSBA 1JT1A 3BK2A 5AEBA 5ACWA 4YSKA 2WHGA 4H0DA 5AXRA 5K4KA 2NZFA 4TZEA 1DDKA
chains in the Genus database with same CATH superfamily
3IE1A 2WYLA 2AZ4A 2YNVB 4BZ3A 4TZBA 4RL2A 2FU6A 4DIKA 2QEDA 1X8IA 3RPCA 1HLKA 1SMLA 2OHJA 4YSBA 1WUPA 4HL2A 5ACUA 4UA4A 2YCBA 4AWYB 4Z5ZA 3Q6VA 2ZNBA 3A4YA 5ACVA 1DXKA 1JJTA 3SFPA 4BP0A 2P1EA 3SD9A 4RAWA 5EVKA 3IOGA 2BG7A 1VJNA 2BTNA 3I14A 1VMEA 2BFZB 4F6HA 3SW3A 2ZO4A 1YCHA 5AJLA 3SRXA 4O98A 3BV6A 2YNUA 1YCFA 5A0VA 4EXYA 4AWZA 4EFZA 1ZTCA 4AXHA 4FR7A 4TZ9A 2Q42A 3X2YA 5HIQA 1MQOA 2DOOA 4NQ2A 4C09A 4D1VA 3ZWFA 4UWOB 4Z60A 4AX1B 4EYFA 4Z6XA 2BFKA 3ZNBA 1DD6A 2BFLA 3VPEA 2M5DA 5ACSA 2WYMC 4C1CA 2Q0JA 3ZR9A 4F6ZA 5A5ZA 4ZEJA 2FK6A 1XM8A 2BG8A 4KEPA 1X8HA 5K4NA 2YNWA 2BIBA 4NQ6A 3MD7A 3I11A 3LVZA 3SBLA 3IE0A 2NZEA 1X8GA 3L6NA 2CFUA 3F9OA 5FQCA 5KILA 5HH6A 5LM6A 1KR3A 2FHXA 2NYPA 3QH8A 4XUKA 1P9EA 2CFZA 3JXPA 3AF6A 4C1DA 2P97A 3FAIA 1BMCA 5EVDA 3KNSA 3IEMA 3R2UA 2NXAA 4JO0A 3ESHA 4RAMA 3DHAA 4PVOA 1BVTA 4XWTA 2QDTA 5ACRA 4ZNBA 3IOFA 2Q9UA 5ACXA 4J5HA 4C1EA 4EY2A 4CHLA 4XWWA 5EWAA 2Y8AA 2VW8A 2XF4A 4C1FA 3T3OA 2CG3A 1WRAA 2Q0IA 5HH4A 2BR6A 2GKLA 1QH5A 2GFJA 1ZNBA 4PVTA 3I15A 5K4MA 5HH5A 2A7MA 5AYAA 3IELA 2H6AA 4WD6A 5ACPA 4UWRB 2GCUA 1KO3A 3RKKA 1QH3A 4DILA 3FCZA 4EXSA 5LCHA 4RL0A 2FM6A 3TP9A 2P4ZA 5B1UA 5A87A 2YNTB 2FU9A 2UYXA 4RBSA 4GYQA 5A0TA 2BG2A 4YSLA 1XTOA 4NQ5A 2YHEA 4D1WA 2YZ3A 5EV8A 5LS3A 2P18A 3X2XA 4Z5YA 4RM5A 3ZQ4A 4Z7RA 3AJ3A 3KNRA 5FQAA 2YNTA 4AV7A 2FU8A 3BK1A 3VQZA 5AIJA 1JJEA 2CG2A 5ACQA 5KIKA 5HIPA 2M5CA 3I13A 4V0HA 3KL7A 4UWSB 4HKYA 5EW0A 4TYFA 5DPXA 4D1TA 2CBNA 1WW1A 2E7YA 4UWPB 1YCGA 2BFZA 3H3EA 5EH9A 3WXCA 2QJSA 4HL1A 3S0ZA 5HISA 5HIOA 3RKJA 5B3RA 3PY5A 5K0WA 5EHTA 2DKFA 2BG6A 2I7VA 2Y87A 2QINA 1A8TA 4AD9A 2XR1A 4AX0B 2GFKA 3DH8A 4UAMA 1ZKPA 5ACTA 4U4LA 2I7TA 4B87A 1M2XA 4EYBA 4Z67A 5LCFA 3SPUA 4J5FA 3PY6A 1K07A 1BC2A 2OHHA 1VGNA 5LE1A 2ZWRA 5A23A 5AXOA 2QDSA 3T3NA 3X30A 2YNVA 2BGAA 3I0VA 1Y44A 1L9YA 4GCWA 4UBQA 2Y8BA 3IDZA 3T9MA 4TYTA 2I7XA 4EYLA 5FQBA 3DHCA 5LMCA 2BMIA 3P2UA 5AHOA 5B15A 4LE6A 1WUOA 3DHBA 4PDXA 3X2ZA 3PG4A 4C1HA 4C1GA 5EVBA 2BC2A 2BG8B 4TZFA 4P62A 5AHRA 3IEKA 3IE2A 4D02A 4FEKA 2WYMA 2HB9A 5EV6A 5LSCA 3BC2A 5IQKA 4NQ4A 5LLDA 2GMNA 2FHXB 4ZO2A 4GYUA 3ADRA 4KEQA 2ZZIA 4D1UA 2WRSA 2AIOA 1KO2A 3G1PA 5LCAA 1A7TA 4ZO3A 2FU7A 3AF5A 2OHIA 2R2DA 1E5DA 4FSBA 1JT1A 4NURA 3BK2A 5AEBA 5ACWA 4YSKA 2WHGA 4H0DA 5AXRA 5K4KA 2NZFA 4TZEA 1DDKA
chains in the Genus database with same CATH topology
3IE1A 2WYLA 2AZ4A 2YNVB 4BZ3A 4TZBA 4RL2A 2FU6A 4DIKA 2QEDA 1X8IA 3RPCA 1HLKA 1SMLA 2OHJA 4YSBA 1WUPA 4HL2A 5ACUA 4UA4A 2YCBA 4AWYB 4Z5ZA 3Q6VA 2ZNBA 3A4YA 5ACVA 1DXKA 1JJTA 3SFPA 4BP0A 2P1EA 3SD9A 4RAWA 5EVKA 3IOGA 2BG7A 1VJNA 2BTNA 3I14A 1VMEA 2BFZB 4F6HA 3SW3A 2ZO4A 1YCHA 3SRXA 4O98A 3BV6A 2YNUA 1YCFA 5A0VA 4EXYA 4AWZA 4EFZA 1ZTCA 4FR7A 4TZ9A 2Q42A 3X2YA 5HIQA 1MQOA 2DOOA 4NQ2A 4C09A 4D1VA 3ZWFA 4UWOB 4Z60A 4AX1B 4EYFA 4Z6XA 2BFKA 3ZNBA 1DD6A 2BFLA 3VPEA 2M5DA 5ACSA 2WYMC 4C1CA 2Q0JA 3ZR9A 4F6ZA 5A5ZA 4ZEJA 2FK6A 1XM8A 2BG8A 4KEPA 1X8HA 5K4NA 2YNWA 2BIBA 4NQ6A 3MD7A 3I11A 3LVZA 3SBLA 3IE0A 2NZEA 1X8GA 3L6NA 3F9OA 5FQCA 5KILA 5HH6A 5LM6A 1KR3A 2FHXA 2NYPA 3QH8A 4XUKA 1P9EA 3JXPA 3AF6A 4C1DA 2P97A 3FAIA 1BMCA 5EVDA 3KNSA 3IEMA 3R2UA 2NXAA 4JO0A 3ESHA 4RAMA 3DHAA 4PVOA 1BVTA 4XWTA 2QDTA 5ACRA 4ZNBA 3IOFA 2Q9UA 5ACXA 4J5HA 4C1EA 4EY2A 4CHLA 4XWWA 5EWAA 2Y8AA 2VW8A 2XF4A 4C1FA 3T3OA 1WRAA 2Q0IA 5HH4A 2BR6A 2GKLA 1QH5A 2GFJA 1ZNBA 4PVTA 3I15A 5K4MA 5HH5A 2A7MA 5AYAA 3IELA 2H6AA 4WD6A 5ACPA 4UWRB 2GCUA 1KO3A 3RKKA 1QH3A 4DILA 3FCZA 4EXSA 5LCHA 4RL0A 2FM6A 3TP9A 2P4ZA 5B1UA 5A87A 2YNTB 2FU9A 2UYXA 4RBSA 4GYQA 5A0TA 2BG2A 4YSLA 1XTOA 4NQ5A 4D1WA 2YZ3A 5EV8A 5LS3A 2P18A 3X2XA 4Z5YA 4RM5A 3ZQ4A 4Z7RA 3AJ3A 3KNRA 5FQAA 2YNTA 2FU8A 3BK1A 3VQZA 1JJEA 5ACQA 5KIKA 5HIPA 2M5CA 3I13A 4V0HA 3KL7A 4UWSB 4HKYA 5EW0A 4TYFA 5DPXA 4D1TA 2CBNA 1WW1A 2E7YA 4UWPB 1YCGA 2BFZA 3H3EA 5EH9A 3WXCA 2QJSA 4HL1A 3S0ZA 5HISA 5HIOA 3RKJA 5B3RA 3PY5A 5K0WA 5EHTA 2DKFA 2BG6A 2I7VA 2Y87A 2QINA 1A8TA 4AD9A 2XR1A 4AX0B 2GFKA 3DH8A 4UAMA 1ZKPA 5ACTA 4U4LA 2I7TA 4B87A 1M2XA 4EYBA 4Z67A 5LCFA 3SPUA 4J5FA 3PY6A 1K07A 1BC2A 2OHHA 1VGNA 5LE1A 2ZWRA 5AXOA 2QDSA 3T3NA 3X30A 2YNVA 2BGAA 3I0VA 1Y44A 1L9YA 4GCWA 4UBQA 2Y8BA 3IDZA 3T9MA 4TYTA 2I7XA 4EYLA 5FQBA 3DHCA 5LMCA 2BMIA 3P2UA 5AHOA 5B15A 4LE6A 1WUOA 3DHBA 3X2ZA 3PG4A 4C1HA 4C1GA 5EVBA 2BC2A 2BG8B 4TZFA 4P62A 5AHRA 3IEKA 3IE2A 4D02A 4FEKA 2WYMA 2HB9A 5EV6A 5LSCA 3BC2A 5IQKA 4NQ4A 5LLDA 2GMNA 2FHXB 4ZO2A 4GYUA 3ADRA 4KEQA 2ZZIA 4D1UA 2WRSA 2AIOA 1KO2A 3G1PA 5LCAA 1A7TA 4ZO3A 2FU7A 3AF5A 2OHIA 2R2DA 1E5DA 4FSBA 1JT1A 3BK2A 5AEBA 5ACWA 4YSKA 2WHGA 4H0DA 5AXRA 5K4KA 2NZFA 4TZEA 1DDKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IE1 A;  2WYL A;  2AZ4 A;  2YNV B;  4BZ3 A;  4TZB A;  4RL2 A;  2FU6 A;  4DIK A;  2QED A;  1X8I A;  3RPC A;  1HLK A;  1SML A;  2OHJ A;  4YSB A;  1WUP A;  4HL2 A;  5ACU A;  4UA4 A;  2YCB A;  4AWY B;  4Z5Z A;  3Q6V A;  2ZNB A;  3A4Y A;  5ACV A;  1DXK A;  1JJT A;  3SFP A;  4BP0 A;  2P1E A;  3SD9 A;  4RAW A;  5EVK A;  3IOG A;  2BG7 A;  1VJN A;  2BTN A;  3I14 A;  1VME A;  2BFZ B;  4F6H A;  3SW3 A;  2ZO4 A;  1YCH A;  3SRX A;  4O98 A;  3BV6 A;  2YNU A;  1YCF A;  5A0V A;  4EXY A;  4AWZ A;  4EFZ A;  1ZTC A;  4FR7 A;  4TZ9 A;  2Q42 A;  3X2Y A;  5HIQ A;  1MQO A;  2DOO A;  4NQ2 A;  4C09 A;  4D1V A;  3ZWF A;  4UWO B;  4Z60 A;  4AX1 B;  4EYF A;  4Z6X A;  2BFK A;  3ZNB A;  1DD6 A;  2BFL A;  3VPE A;  2M5D A;  5ACS A;  2WYM C;  4C1C A;  2Q0J A;  3ZR9 A;  4F6Z A;  5A5Z A;  4ZEJ A;  2FK6 A;  1XM8 A;  2BG8 A;  4KEP A;  1X8H A;  5K4N A;  2YNW A;  2BIB A;  4NQ6 A;  3MD7 A;  3I11 A;  3LVZ A;  3SBL A;  3IE0 A;  2NZE A;  1X8G A;  3L6N A;  3F9O A;  5FQC A;  5KIL A;  5HH6 A;  5LM6 A;  1KR3 A;  2FHX A;  2NYP A;  3QH8 A;  4XUK A;  1P9E A;  3JXP A;  3AF6 A;  4C1D A;  2P97 A;  3FAI A;  1BMC A;  5EVD A;  3KNS A;  3IEM A;  3R2U A;  2NXA A;  4JO0 A;  3ESH A;  4RAM A;  3DHA A;  4PVO A;  1BVT A;  4XWT A;  2QDT A;  5ACR A;  4ZNB A;  3IOF A;  2Q9U A;  5ACX A;  4J5H A;  4C1E A;  4EY2 A;  4CHL A;  4XWW A;  5EWA A;  2Y8A A;  2VW8 A;  2XF4 A;  4C1F A;  3T3O A;  1WRA A;  2Q0I A;  5HH4 A;  2BR6 A;  2GKL A;  1QH5 A;  2GFJ A;  1ZNB A;  4PVT A;  3I15 A;  5K4M A;  5HH5 A;  2A7M A;  5AYA A;  3IEL A;  2H6A A;  4WD6 A;  5ACP A;  4UWR B;  2GCU A;  1KO3 A;  3RKK A;  1QH3 A;  4DIL A;  3FCZ A;  4EXS A;  5LCH A;  4RL0 A;  2FM6 A;  3TP9 A;  2P4Z A;  5B1U A;  5A87 A;  2YNT B;  2FU9 A;  2UYX A;  4RBS A;  4GYQ A;  5A0T A;  2BG2 A;  4YSL A;  1XTO A;  4NQ5 A;  4D1W A;  2YZ3 A;  5EV8 A;  5LS3 A;  2P18 A;  3X2X A;  4Z5Y A;  4RM5 A;  3ZQ4 A;  4Z7R A;  3AJ3 A;  3KNR A;  5FQA A;  2YNT A;  2FU8 A;  3BK1 A;  3VQZ A;  1JJE A;  5ACQ A;  5KIK A;  5HIP A;  2M5C A;  3I13 A;  4V0H A;  3KL7 A;  4UWS B;  4HKY A;  5EW0 A;  4TYF A;  5DPX A;  4D1T A;  2CBN A;  1WW1 A;  2E7Y A;  4UWP B;  1YCG A;  2BFZ A;  3H3E A;  5EH9 A;  3WXC A;  2QJS A;  4HL1 A;  3S0Z A;  5HIS A;  5HIO A;  3RKJ A;  5B3R A;  3PY5 A;  5K0W A;  5EHT A;  2DKF A;  2BG6 A;  2I7V A;  2Y87 A;  2QIN A;  1A8T A;  4AD9 A;  2XR1 A;  4AX0 B;  2GFK A;  3DH8 A;  4UAM A;  1ZKP A;  5ACT A;  4U4L A;  2I7T A;  4B87 A;  1M2X A;  4EYB A;  4Z67 A;  5LCF A;  3SPU A;  4J5F A;  3PY6 A;  1K07 A;  1BC2 A;  2OHH A;  1VGN A;  5LE1 A;  2ZWR A;  5AXO A;  2QDS A;  3T3N A;  3X30 A;  2YNV A;  2BGA A;  3I0V A;  1Y44 A;  1L9Y A;  4GCW A;  4UBQ A;  2Y8B A;  3IDZ A;  3T9M A;  4TYT A;  2I7X A;  4EYL A;  5FQB A;  3DHC A;  5LMC A;  2BMI A;  3P2U A;  5AHO A;  5B15 A;  4LE6 A;  1WUO A;  3DHB A;  3X2Z A;  3PG4 A;  4C1H A;  4C1G A;  5EVB A;  2BC2 A;  2BG8 B;  4TZF A;  4P62 A;  5AHR A;  3IEK A;  3IE2 A;  4D02 A;  4FEK A;  2WYM A;  2HB9 A;  5EV6 A;  5LSC A;  3BC2 A;  5IQK A;  4NQ4 A;  5LLD A;  2GMN A;  2FHX B;  4ZO2 A;  4GYU A;  3ADR A;  4KEQ A;  2ZZI A;  4D1U A;  2WRS A;  2AIO A;  1KO2 A;  3G1P A;  5LCA A;  1A7T A;  4ZO3 A;  2FU7 A;  3AF5 A;  2OHI A;  2R2D A;  1E5D A;  4FSB A;  1JT1 A;  3BK2 A;  5AEB A;  5ACW A;  4YSK A;  2WHG A;  4H0D A;  5AXR A;  5K4K A;  2NZF A;  4TZE A;  1DDK A; 
#chains in the Genus database with same CATH topology
 3IE1 A;  2WYL A;  2AZ4 A;  2YNV B;  4BZ3 A;  4TZB A;  4RL2 A;  2FU6 A;  4DIK A;  2QED A;  1X8I A;  3RPC A;  1HLK A;  1SML A;  2OHJ A;  4YSB A;  1WUP A;  4HL2 A;  5ACU A;  4UA4 A;  2YCB A;  4AWY B;  4Z5Z A;  3Q6V A;  2ZNB A;  3A4Y A;  5ACV A;  1DXK A;  1JJT A;  3SFP A;  4BP0 A;  2P1E A;  3SD9 A;  4RAW A;  5EVK A;  3IOG A;  2BG7 A;  1VJN A;  2BTN A;  3I14 A;  1VME A;  2BFZ B;  4F6H A;  3SW3 A;  2ZO4 A;  1YCH A;  5AJL A;  3SRX A;  4O98 A;  3BV6 A;  2YNU A;  1YCF A;  5A0V A;  4EXY A;  4AWZ A;  4EFZ A;  1ZTC A;  4AXH A;  4FR7 A;  4TZ9 A;  2Q42 A;  3X2Y A;  5HIQ A;  1MQO A;  2DOO A;  4NQ2 A;  4C09 A;  4D1V A;  3ZWF A;  4UWO B;  4Z60 A;  4AX1 B;  4EYF A;  4Z6X A;  2BFK A;  3ZNB A;  1DD6 A;  2BFL A;  3VPE A;  2M5D A;  5ACS A;  2WYM C;  4C1C A;  2Q0J A;  3ZR9 A;  4F6Z A;  5A5Z A;  4ZEJ A;  2FK6 A;  1XM8 A;  2BG8 A;  4KEP A;  1X8H A;  5K4N A;  2YNW A;  2BIB A;  4NQ6 A;  3MD7 A;  3I11 A;  3LVZ A;  3SBL A;  3IE0 A;  2NZE A;  1X8G A;  3L6N A;  2CFU A;  3F9O A;  5FQC A;  5KIL A;  5HH6 A;  5LM6 A;  1KR3 A;  2FHX A;  2NYP A;  3QH8 A;  4XUK A;  1P9E A;  2CFZ A;  3JXP A;  3AF6 A;  4C1D A;  2P97 A;  3FAI A;  1BMC A;  5EVD A;  3KNS A;  3IEM A;  3R2U A;  2NXA A;  4JO0 A;  3ESH A;  4RAM A;  3DHA A;  4PVO A;  1BVT A;  4XWT A;  2QDT A;  5ACR A;  4ZNB A;  3IOF A;  2Q9U A;  5ACX A;  4J5H A;  4C1E A;  4EY2 A;  4CHL A;  4XWW A;  5EWA A;  2Y8A A;  2VW8 A;  2XF4 A;  4C1F A;  3T3O A;  2CG3 A;  1WRA A;  2Q0I A;  5HH4 A;  2BR6 A;  2GKL A;  1QH5 A;  2GFJ A;  1ZNB A;  4PVT A;  3I15 A;  5K4M A;  5HH5 A;  2A7M A;  5AYA A;  3IEL A;  2H6A A;  4WD6 A;  5ACP A;  4UWR B;  2GCU A;  1KO3 A;  3RKK A;  1QH3 A;  4DIL A;  3FCZ A;  4EXS A;  5LCH A;  4RL0 A;  2FM6 A;  3TP9 A;  2P4Z A;  5B1U A;  5A87 A;  2YNT B;  2FU9 A;  2UYX A;  4RBS A;  4GYQ A;  5A0T A;  2BG2 A;  4YSL A;  1XTO A;  4NQ5 A;  2YHE A;  4D1W A;  2YZ3 A;  5EV8 A;  5LS3 A;  2P18 A;  3X2X A;  4Z5Y A;  4RM5 A;  3ZQ4 A;  4Z7R A;  3AJ3 A;  3KNR A;  5FQA A;  2YNT A;  4AV7 A;  2FU8 A;  3BK1 A;  3VQZ A;  5AIJ A;  1JJE A;  2CG2 A;  5ACQ A;  5KIK A;  5HIP A;  2M5C A;  3I13 A;  4V0H A;  3KL7 A;  4UWS B;  4HKY A;  5EW0 A;  4TYF A;  5DPX A;  4D1T A;  2CBN A;  1WW1 A;  2E7Y A;  4UWP B;  1YCG A;  2BFZ A;  3H3E A;  5EH9 A;  3WXC A;  2QJS A;  4HL1 A;  3S0Z A;  5HIS A;  5HIO A;  3RKJ A;  5B3R A;  3PY5 A;  5K0W A;  5EHT A;  2DKF A;  2BG6 A;  2I7V A;  2Y87 A;  2QIN A;  1A8T A;  4AD9 A;  2XR1 A;  4AX0 B;  2GFK A;  3DH8 A;  4UAM A;  1ZKP A;  5ACT A;  4U4L A;  2I7T A;  4B87 A;  1M2X A;  4EYB A;  4Z67 A;  5LCF A;  3SPU A;  4J5F A;  3PY6 A;  1K07 A;  1BC2 A;  2OHH A;  1VGN A;  5LE1 A;  2ZWR A;  5A23 A;  5AXO A;  2QDS A;  3T3N A;  3X30 A;  2YNV A;  2BGA A;  3I0V A;  1Y44 A;  1L9Y A;  4GCW A;  4UBQ A;  2Y8B A;  3IDZ A;  3T9M A;  4TYT A;  2I7X A;  4EYL A;  5FQB A;  3DHC A;  5LMC A;  2BMI A;  3P2U A;  5AHO A;  5B15 A;  4LE6 A;  1WUO A;  3DHB A;  4PDX A;  3X2Z A;  3PG4 A;  4C1H A;  4C1G A;  5EVB A;  2BC2 A;  2BG8 B;  4TZF A;  4P62 A;  5AHR A;  3IEK A;  3IE2 A;  4D02 A;  4FEK A;  2WYM A;  2HB9 A;  5EV6 A;  5LSC A;  3BC2 A;  5IQK A;  4NQ4 A;  5LLD A;  2GMN A;  2FHX B;  4ZO2 A;  4GYU A;  3ADR A;  4KEQ A;  2ZZI A;  4D1U A;  2WRS A;  2AIO A;  1KO2 A;  3G1P A;  5LCA A;  1A7T A;  4ZO3 A;  2FU7 A;  3AF5 A;  2OHI A;  2R2D A;  1E5D A;  4FSB A;  1JT1 A;  4NUR A;  3BK2 A;  5AEB A;  5ACW A;  4YSK A;  2WHG A;  4H0D A;  5AXR A;  5K4K A;  2NZF A;  4TZE A;  1DDK A; 
#chains in the Genus database with same CATH homology
 3IE1 A;  2WYL A;  2AZ4 A;  2YNV B;  4BZ3 A;  4TZB A;  4RL2 A;  2FU6 A;  4DIK A;  2QED A;  1X8I A;  3RPC A;  1HLK A;  1SML A;  2OHJ A;  4YSB A;  1WUP A;  4HL2 A;  5ACU A;  4UA4 A;  2YCB A;  4AWY B;  4Z5Z A;  3Q6V A;  2ZNB A;  3A4Y A;  5ACV A;  1DXK A;  1JJT A;  3SFP A;  4BP0 A;  2P1E A;  3SD9 A;  4RAW A;  5EVK A;  3IOG A;  2BG7 A;  1VJN A;  2BTN A;  3I14 A;  1VME A;  2BFZ B;  4F6H A;  3SW3 A;  2ZO4 A;  1YCH A;  3SRX A;  4O98 A;  3BV6 A;  2YNU A;  1YCF A;  5A0V A;  4EXY A;  4AWZ A;  4EFZ A;  1ZTC A;  4FR7 A;  4TZ9 A;  2Q42 A;  3X2Y A;  5HIQ A;  1MQO A;  2DOO A;  4NQ2 A;  4C09 A;  4D1V A;  3ZWF A;  4UWO B;  4Z60 A;  4AX1 B;  4EYF A;  4Z6X A;  2BFK A;  3ZNB A;  1DD6 A;  2BFL A;  3VPE A;  2M5D A;  5ACS A;  2WYM C;  4C1C A;  2Q0J A;  3ZR9 A;  4F6Z A;  5A5Z A;  4ZEJ A;  2FK6 A;  1XM8 A;  2BG8 A;  4KEP A;  1X8H A;  5K4N A;  2YNW A;  2BIB A;  4NQ6 A;  3MD7 A;  3I11 A;  3LVZ A;  3SBL A;  3IE0 A;  2NZE A;  1X8G A;  3L6N A;  3F9O A;  5FQC A;  5KIL A;  5HH6 A;  5LM6 A;  1KR3 A;  2FHX A;  2NYP A;  3QH8 A;  4XUK A;  1P9E A;  3JXP A;  3AF6 A;  4C1D A;  2P97 A;  3FAI A;  1BMC A;  5EVD A;  3KNS A;  3IEM A;  3R2U A;  2NXA A;  4JO0 A;  3ESH A;  4RAM A;  3DHA A;  4PVO A;  1BVT A;  4XWT A;  2QDT A;  5ACR A;  4ZNB A;  3IOF A;  2Q9U A;  5ACX A;  4J5H A;  4C1E A;  4EY2 A;  4CHL A;  4XWW A;  5EWA A;  2Y8A A;  2VW8 A;  2XF4 A;  4C1F A;  3T3O A;  1WRA A;  2Q0I A;  5HH4 A;  2BR6 A;  2GKL A;  1QH5 A;  2GFJ A;  1ZNB A;  4PVT A;  3I15 A;  5K4M A;  5HH5 A;  2A7M A;  5AYA A;  3IEL A;  2H6A A;  4WD6 A;  5ACP A;  4UWR B;  2GCU A;  1KO3 A;  3RKK A;  1QH3 A;  4DIL A;  3FCZ A;  4EXS A;  5LCH A;  4RL0 A;  2FM6 A;  3TP9 A;  2P4Z A;  5B1U A;  5A87 A;  2YNT B;  2FU9 A;  2UYX A;  4RBS A;  4GYQ A;  5A0T A;  2BG2 A;  4YSL A;  1XTO A;  4NQ5 A;  4D1W A;  2YZ3 A;  5EV8 A;  5LS3 A;  2P18 A;  3X2X A;  4Z5Y A;  4RM5 A;  3ZQ4 A;  4Z7R A;  3AJ3 A;  3KNR A;  5FQA A;  2YNT A;  2FU8 A;  3BK1 A;  3VQZ A;  1JJE A;  5ACQ A;  5KIK A;  5HIP A;  2M5C A;  3I13 A;  4V0H A;  3KL7 A;  4UWS B;  4HKY A;  5EW0 A;  4TYF A;  5DPX A;  4D1T A;  2CBN A;  1WW1 A;  2E7Y A;  4UWP B;  1YCG A;  2BFZ A;  3H3E A;  5EH9 A;  3WXC A;  2QJS A;  4HL1 A;  3S0Z A;  5HIS A;  5HIO A;  3RKJ A;  5B3R A;  3PY5 A;  5K0W A;  5EHT A;  2DKF A;  2BG6 A;  2I7V A;  2Y87 A;  2QIN A;  1A8T A;  4AD9 A;  2XR1 A;  4AX0 B;  2GFK A;  3DH8 A;  4UAM A;  1ZKP A;  5ACT A;  4U4L A;  2I7T A;  4B87 A;  1M2X A;  4EYB A;  4Z67 A;  5LCF A;  3SPU A;  4J5F A;  3PY6 A;  1K07 A;  1BC2 A;  2OHH A;  1VGN A;  5LE1 A;  2ZWR A;  5AXO A;  2QDS A;  3T3N A;  3X30 A;  2YNV A;  2BGA A;  3I0V A;  1Y44 A;  1L9Y A;  4GCW A;  4UBQ A;  2Y8B A;  3IDZ A;  3T9M A;  4TYT A;  2I7X A;  4EYL A;  5FQB A;  3DHC A;  5LMC A;  2BMI A;  3P2U A;  5AHO A;  5B15 A;  4LE6 A;  1WUO A;  3DHB A;  3X2Z A;  3PG4 A;  4C1H A;  4C1G A;  5EVB A;  2BC2 A;  2BG8 B;  4TZF A;  4P62 A;  5AHR A;  3IEK A;  3IE2 A;  4D02 A;  4FEK A;  2WYM A;  2HB9 A;  5EV6 A;  5LSC A;  3BC2 A;  5IQK A;  4NQ4 A;  5LLD A;  2GMN A;  2FHX B;  4ZO2 A;  4GYU A;  3ADR A;  4KEQ A;  2ZZI A;  4D1U A;  2WRS A;  2AIO A;  1KO2 A;  3G1P A;  5LCA A;  1A7T A;  4ZO3 A;  2FU7 A;  3AF5 A;  2OHI A;  2R2D A;  1E5D A;  4FSB A;  1JT1 A;  3BK2 A;  5AEB A;  5ACW A;  4YSK A;  2WHG A;  4H0D A;  5AXR A;  5K4K A;  2NZF A;  4TZE A;  1DDK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...