2FHXA

Pseudomonas aeruginosa spm-1 metallo-beta-lactamase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
245
structure length
244
Chain Sequence
DHVDLPYNLTATKIDSDVFVVTDRDFYSSNVLVAKMLDGTVVIVSSPFENLGTQTLMDWVAKTMKPKKVVAINTHFHLDGTGGNEIYKKMGAETWSSDLTKQLRLEENKKDRIKAAEFYKNEDLKRRILSSHPVPADNVFDLKQGKVFSFSNELVEVSFPGPAHSPDNVVVYFPKKKLLFGGMIKPKELGYLGDANVKAWPDSARRLKKFDAKIVIPGHGEWGGPEMVNKTIKVAEKAVGEMRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Pseudomonas aeruginosa SPM-1 Provides Insights into Variable Zinc Affinity of Metallo-beta-lactamases.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase, metal binding protein
molecule keywords SPM-1
total genus 75
structure length 244
sequence length 245
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2fhxA00
1X8HA 1WUPA 3RPCA 2GFKA 4JO0A 4D1VA 3S0ZA 5EHTA 4DILA 4TZEA 2BFZB 4EYFA 4V0HA 5EVKA 2GCUA 4Z67A 4GYQA 4AX0B 2P97A 3PG4A 4UAMA 5IQKA 5DPXA 3FCZA 3IEKA 1A7TA 1SMLA 4RBSA 5HH6A 2QEDA 4TYFA 4BP0A 2Q0IA 1BVTA 5KILA 1ZNBA 4FEKA 2YNVB 3TP9A 5EH9A 2P4ZA 4C1CA 5B15A 5HIPA 4EYBA 3L6NA 5B3RA 3X2ZA 2AZ4A 5EVDA 2QDTA 1YCFA 3PY6A 3KNRA 5LE1A 4RAMA 4ZNBA 5ACQA 1DD6A 3I14A 3DHCA 5FQAA 5A87A 3VQZA 4PVOA 4WD6A 4F6ZA 3IOFA 2ZNBA 4C1GA 4FSBA 5ACSA 2BFKA 4C1EA 4UWPB 2Q42A 3MD7A 5ACPA 1P9EA 5ACWA 3IE0A 1KO3A 5KIKA 3IELA 4Z5YA 2OHIA 1X8GA 4LE6A 4ZEJA 4ZO2A 5HH4A 3SFPA 3BK2A 2DKFA 2FHXB 3LVZA 2H6AA 3ESHA 2NXAA 4D1TA 4YSKA 5LMCA 1ZTCA 3R2UA 2BMIA 2WYMC 3FAIA 4KEQA 5LCAA 1K07A 2QJSA 2DOOA 4ZO3A 4HL2A 5HISA 3KL7A 2R2DA 3AJ3A 2Y8BA 3IE2A 1JJTA 2YCBA 4RL2A 3X2YA 5LS3A 2YNVA 2BG2A 2XF4A 3IDZA 3AF5A 3I15A 3BC2A 4BZ3A 2BFLA 4FR7A 4HL1A 5HIOA 1VJNA 3DHBA 4XWTA 5LLDA 4UBQA 5LCHA 3T3OA 2CBNA 5EV8A 2UYXA 1KR3A 5K4NA 5LSCA 5EW0A 2GFJA 2M5DA 3A4YA 4J5HA 1DDKA 2BG6A 5AEBA 2WYMA 4TZ9A 4UA4A 4D1WA 4EYLA 3IOGA 4NQ2A 4RM5A 4AD9A 2HB9A 4P62A 3ZQ4A 2FU9A 4TYTA 4UWSB 5ACTA 5K4KA 3I13A 1HLKA 2Y8AA 1JT1A 1X8IA 1KO2A 2WYLA 1XM8A 2WHGA 2I7XA 1E5DA 3P2UA 5A0TA 3T9MA 3JXPA 2BG7A 3WXCA 2ZZIA 2FU6A 5LCFA 4F6HA 2ZWRA 5EWAA 4H0DA 4YSBA 3ZWFA 4CHLA 5HH5A 4XWWA 1DXKA 2FM6A 4PVTA 4EXYA 2BFZA 4DIKA 2QINA 2I7VA 4EY2A 1Y44A 2OHHA 4XUKA 1WW1A 1L9YA 4AWZA 2FK6A 4Z60A 2Y87A 3DH8A 4TZBA 1BMCA 3IEMA 2GMNA 2BC2A 5HIQA 4Z6XA 3I11A 1XTOA 4TZFA 2BR6A 1WRAA 2E7YA 3X2XA 3DHAA 3SD9A 4D02A 2BG8A 5K0WA 2GKLA 1MQOA 2NYPA 5A5ZA 3QH8A 4NQ4A 4D1UA 4C1DA 2YNTB 3KNSA 4B87A 4HKYA 2YNUA 2I7TA 2Q0JA 5ACRA 4EXSA 4AX1B 2P18A 3X30A 4C1HA 4RAWA 3SPUA 4NQ5A 3IE1A 5B1UA 1BC2A 5LM6A 4Z7RA 3G1PA 4RL0A 1YCHA 4C09A 2OHJA 4GYUA 5EV6A 5ACVA 3BV6A 4Z5ZA 2ZO4A 2BGAA 2QDSA 3H3EA 4GCWA 2WRSA 2NZFA 3PY5A 3RKJA 3I0VA 5A0VA 4KEPA 5AHRA 5AXRA 1A8TA 1JJEA 5AXOA 4O98A 5AYAA 3VPEA 5FQCA 4U4LA 3SBLA 2BIBA 4EFZA 1QH5A 3ADRA 3SW3A 5AHOA 5ACUA 2AIOA 2Q9UA 3AF6A 3RKKA 1M2XA 2XR1A 4C1FA 2M5CA 4YSLA 2A7MA 1VMEA 2YZ3A 2YNTA 4AWYB 2FU8A 1YCGA 5K4MA 2BTNA 3ZNBA 3SRXA 2NZEA 2FU7A 4UWRB 3T3NA 4J5FA 1WUOA 4UWOB 4NQ6A 1ZKPA 3BK1A 5FQBA 2VW8A 3ZR9A 2BG8B 5EVBA 1VGNA 2FHXA 2YNWA 2P1EA 3Q6VA 1QH3A 5ACXA 3F9OA
chains in the Genus database with same CATH superfamily
1X8HA 1WUPA 3RPCA 2GFKA 4JO0A 4D1VA 3S0ZA 5EHTA 4DILA 4TZEA 2BFZB 4EYFA 4V0HA 5EVKA 2GCUA 4Z67A 4GYQA 4AX0B 2P97A 3PG4A 4UAMA 5IQKA 5DPXA 3FCZA 3IEKA 1A7TA 1SMLA 4RBSA 5HH6A 2QEDA 2CFUA 4TYFA 4BP0A 2Q0IA 1BVTA 5KILA 1ZNBA 4FEKA 2YNVB 3TP9A 5EH9A 2P4ZA 4C1CA 5B15A 5HIPA 4EYBA 3L6NA 5B3RA 3X2ZA 2AZ4A 5EVDA 2QDTA 1YCFA 3PY6A 3KNRA 5LE1A 4RAMA 4ZNBA 5ACQA 1DD6A 3I14A 3DHCA 5FQAA 5A87A 3VQZA 4PVOA 4WD6A 4F6ZA 3IOFA 2ZNBA 4C1GA 4FSBA 5ACSA 4NURA 2BFKA 4C1EA 4UWPB 2Q42A 3MD7A 5ACPA 1P9EA 5ACWA 3IE0A 1KO3A 4AXHA 5KIKA 3IELA 4Z5YA 2OHIA 1X8GA 4LE6A 4ZEJA 4ZO2A 5HH4A 3SFPA 3BK2A 2DKFA 2FHXB 3LVZA 2H6AA 3ESHA 2NXAA 4D1TA 4YSKA 5LMCA 1ZTCA 3R2UA 5A23A 2BMIA 2WYMC 3FAIA 4KEQA 5LCAA 1K07A 2QJSA 2DOOA 4ZO3A 5AIJA 4HL2A 5HISA 3KL7A 2R2DA 3AJ3A 2Y8BA 3IE2A 1JJTA 2YCBA 4RL2A 3X2YA 5LS3A 2YNVA 2BG2A 2XF4A 3IDZA 3AF5A 3I15A 3BC2A 4BZ3A 2BFLA 4FR7A 4HL1A 5HIOA 1VJNA 3DHBA 4XWTA 5LLDA 4UBQA 5LCHA 3T3OA 2CBNA 5EV8A 2UYXA 1KR3A 5K4NA 5LSCA 5EW0A 2GFJA 2M5DA 3A4YA 4J5HA 1DDKA 2BG6A 5AEBA 2WYMA 4TZ9A 4UA4A 4D1WA 4EYLA 3IOGA 4NQ2A 4RM5A 4AD9A 2HB9A 4P62A 3ZQ4A 2FU9A 4TYTA 4UWSB 5ACTA 5K4KA 3I13A 1HLKA 2Y8AA 1JT1A 1X8IA 1KO2A 2WYLA 1XM8A 2WHGA 1E5DA 2CFZA 2I7XA 3P2UA 5A0TA 3T9MA 3JXPA 2BG7A 4AV7A 3WXCA 2ZZIA 2FU6A 5LCFA 4F6HA 2ZWRA 5EWAA 4H0DA 5AJLA 4YSBA 3ZWFA 4CHLA 5HH5A 4XWWA 1DXKA 2FM6A 4PVTA 4EXYA 2BFZA 4DIKA 2QINA 2I7VA 4EY2A 1Y44A 2OHHA 4XUKA 1WW1A 1L9YA 4AWZA 2FK6A 4Z60A 2Y87A 3DH8A 4TZBA 1BMCA 3IEMA 2GMNA 2BC2A 5HIQA 4Z6XA 4PDXA 3I11A 1XTOA 4TZFA 2BR6A 1WRAA 2E7YA 3X2XA 3DHAA 3SD9A 4D02A 2BG8A 2CG3A 5K0WA 2GKLA 1MQOA 2NYPA 5A5ZA 3QH8A 4NQ4A 4D1UA 4C1DA 2YNTB 3KNSA 4B87A 4HKYA 2YNUA 2I7TA 2Q0JA 5ACRA 4EXSA 4AX1B 2P18A 3X30A 4C1HA 4RAWA 3SPUA 4NQ5A 3IE1A 5B1UA 2YHEA 1BC2A 5LM6A 4Z7RA 3G1PA 4RL0A 1YCHA 4C09A 2OHJA 4GYUA 5EV6A 5ACVA 3BV6A 4Z5ZA 2ZO4A 2BGAA 2QDSA 3H3EA 4GCWA 2WRSA 2NZFA 3PY5A 3RKJA 3I0VA 5A0VA 4KEPA 5AHRA 5AXRA 1A8TA 1JJEA 5AXOA 4O98A 5AYAA 3VPEA 5FQCA 4U4LA 3SBLA 2BIBA 4EFZA 1QH5A 3ADRA 3SW3A 5AHOA 5ACUA 2AIOA 2Q9UA 3AF6A 3RKKA 1M2XA 2XR1A 4C1FA 2M5CA 4YSLA 2A7MA 1VMEA 2YZ3A 2YNTA 4AWYB 2FU8A 1YCGA 5K4MA 2BTNA 3ZNBA 3SRXA 2NZEA 2FU7A 4UWRB 3T3NA 4J5FA 1WUOA 4UWOB 4NQ6A 1ZKPA 3BK1A 5FQBA 2VW8A 3ZR9A 2BG8B 5EVBA 2CG2A 1VGNA 2FHXA 2YNWA 2P1EA 3Q6VA 1QH3A 5ACXA 3F9OA
chains in the Genus database with same CATH topology
1X8HA 1WUPA 3RPCA 2GFKA 4JO0A 4D1VA 3S0ZA 5EHTA 4DILA 4TZEA 2BFZB 4EYFA 4V0HA 5EVKA 2GCUA 4Z67A 4GYQA 4AX0B 2P97A 3PG4A 4UAMA 5IQKA 5DPXA 3FCZA 3IEKA 1A7TA 1SMLA 4RBSA 5HH6A 2QEDA 4TYFA 4BP0A 2Q0IA 1BVTA 5KILA 1ZNBA 4FEKA 2YNVB 3TP9A 5EH9A 2P4ZA 4C1CA 5B15A 5HIPA 4EYBA 3L6NA 5B3RA 3X2ZA 2AZ4A 5EVDA 2QDTA 1YCFA 3PY6A 3KNRA 5LE1A 4RAMA 4ZNBA 5ACQA 1DD6A 3I14A 3DHCA 5FQAA 5A87A 3VQZA 4PVOA 4WD6A 4F6ZA 3IOFA 2ZNBA 4C1GA 4FSBA 5ACSA 2BFKA 4C1EA 4UWPB 2Q42A 3MD7A 5ACPA 1P9EA 5ACWA 3IE0A 1KO3A 5KIKA 3IELA 4Z5YA 2OHIA 1X8GA 4LE6A 4ZEJA 4ZO2A 5HH4A 3SFPA 3BK2A 2DKFA 2FHXB 3LVZA 2H6AA 3ESHA 2NXAA 4D1TA 4YSKA 5LMCA 1ZTCA 3R2UA 2BMIA 2WYMC 3FAIA 4KEQA 5LCAA 1K07A 2QJSA 2DOOA 4ZO3A 4HL2A 5HISA 3KL7A 2R2DA 3AJ3A 2Y8BA 3IE2A 1JJTA 2YCBA 4RL2A 3X2YA 5LS3A 2YNVA 2BG2A 2XF4A 3IDZA 3AF5A 3I15A 3BC2A 4BZ3A 2BFLA 4FR7A 4HL1A 5HIOA 1VJNA 3DHBA 4XWTA 5LLDA 4UBQA 5LCHA 3T3OA 2CBNA 5EV8A 2UYXA 1KR3A 5K4NA 5LSCA 5EW0A 2GFJA 2M5DA 3A4YA 4J5HA 1DDKA 2BG6A 5AEBA 2WYMA 4TZ9A 4UA4A 4D1WA 4EYLA 3IOGA 4NQ2A 4RM5A 4AD9A 2HB9A 4P62A 3ZQ4A 2FU9A 4TYTA 4UWSB 5ACTA 5K4KA 3I13A 1HLKA 2Y8AA 1JT1A 1X8IA 1KO2A 2WYLA 1XM8A 2WHGA 2I7XA 1E5DA 3P2UA 5A0TA 3T9MA 3JXPA 2BG7A 3WXCA 2ZZIA 2FU6A 5LCFA 4F6HA 2ZWRA 5EWAA 4H0DA 4YSBA 3ZWFA 4CHLA 5HH5A 4XWWA 1DXKA 2FM6A 4PVTA 4EXYA 2BFZA 4DIKA 2QINA 2I7VA 4EY2A 1Y44A 2OHHA 4XUKA 1WW1A 1L9YA 4AWZA 2FK6A 4Z60A 2Y87A 3DH8A 4TZBA 1BMCA 3IEMA 2GMNA 2BC2A 5HIQA 4Z6XA 3I11A 1XTOA 4TZFA 2BR6A 1WRAA 2E7YA 3X2XA 3DHAA 3SD9A 4D02A 2BG8A 5K0WA 2GKLA 1MQOA 2NYPA 5A5ZA 3QH8A 4NQ4A 4D1UA 4C1DA 2YNTB 3KNSA 4B87A 4HKYA 2YNUA 2I7TA 2Q0JA 5ACRA 4EXSA 4AX1B 2P18A 3X30A 4C1HA 4RAWA 3SPUA 4NQ5A 3IE1A 5B1UA 1BC2A 5LM6A 4Z7RA 3G1PA 4RL0A 1YCHA 4C09A 2OHJA 4GYUA 5EV6A 5ACVA 3BV6A 4Z5ZA 2ZO4A 2BGAA 2QDSA 3H3EA 4GCWA 2WRSA 2NZFA 3PY5A 3RKJA 3I0VA 5A0VA 4KEPA 5AHRA 5AXRA 1A8TA 1JJEA 5AXOA 4O98A 5AYAA 3VPEA 5FQCA 4U4LA 3SBLA 2BIBA 4EFZA 1QH5A 3ADRA 3SW3A 5AHOA 5ACUA 2AIOA 2Q9UA 3AF6A 3RKKA 1M2XA 2XR1A 4C1FA 2M5CA 4YSLA 2A7MA 1VMEA 2YZ3A 2YNTA 4AWYB 2FU8A 1YCGA 5K4MA 2BTNA 3ZNBA 3SRXA 2NZEA 2FU7A 4UWRB 3T3NA 4J5FA 1WUOA 4UWOB 4NQ6A 1ZKPA 3BK1A 5FQBA 2VW8A 3ZR9A 2BG8B 5EVBA 1VGNA 2FHXA 2YNWA 2P1EA 3Q6VA 1QH3A 5ACXA 3F9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X8H A;  1WUP A;  3RPC A;  2GFK A;  4JO0 A;  4D1V A;  3S0Z A;  5EHT A;  4DIL A;  4TZE A;  2BFZ B;  4EYF A;  4V0H A;  5EVK A;  2GCU A;  4Z67 A;  4GYQ A;  4AX0 B;  2P97 A;  3PG4 A;  4UAM A;  5IQK A;  5DPX A;  3FCZ A;  3IEK A;  1A7T A;  1SML A;  4RBS A;  5HH6 A;  2QED A;  4TYF A;  4BP0 A;  2Q0I A;  1BVT A;  5KIL A;  1ZNB A;  4FEK A;  2YNV B;  3TP9 A;  5EH9 A;  2P4Z A;  4C1C A;  5B15 A;  5HIP A;  4EYB A;  3L6N A;  5B3R A;  3X2Z A;  2AZ4 A;  5EVD A;  2QDT A;  1YCF A;  3PY6 A;  3KNR A;  5LE1 A;  4RAM A;  4ZNB A;  5ACQ A;  1DD6 A;  3I14 A;  3DHC A;  5FQA A;  5A87 A;  3VQZ A;  4PVO A;  4WD6 A;  4F6Z A;  3IOF A;  2ZNB A;  4C1G A;  4FSB A;  5ACS A;  2BFK A;  4C1E A;  4UWP B;  2Q42 A;  3MD7 A;  5ACP A;  1P9E A;  5ACW A;  3IE0 A;  1KO3 A;  5KIK A;  3IEL A;  4Z5Y A;  2OHI A;  1X8G A;  4LE6 A;  4ZEJ A;  4ZO2 A;  5HH4 A;  3SFP A;  3BK2 A;  2DKF A;  2FHX B;  3LVZ A;  2H6A A;  3ESH A;  2NXA A;  4D1T A;  4YSK A;  5LMC A;  1ZTC A;  3R2U A;  2BMI A;  2WYM C;  3FAI A;  4KEQ A;  5LCA A;  1K07 A;  2QJS A;  2DOO A;  4ZO3 A;  4HL2 A;  5HIS A;  3KL7 A;  2R2D A;  3AJ3 A;  2Y8B A;  3IE2 A;  1JJT A;  2YCB A;  4RL2 A;  3X2Y A;  5LS3 A;  2YNV A;  2BG2 A;  2XF4 A;  3IDZ A;  3AF5 A;  3I15 A;  3BC2 A;  4BZ3 A;  2BFL A;  4FR7 A;  4HL1 A;  5HIO A;  1VJN A;  3DHB A;  4XWT A;  5LLD A;  4UBQ A;  5LCH A;  3T3O A;  2CBN A;  5EV8 A;  2UYX A;  1KR3 A;  5K4N A;  5LSC A;  5EW0 A;  2GFJ A;  2M5D A;  3A4Y A;  4J5H A;  1DDK A;  2BG6 A;  5AEB A;  2WYM A;  4TZ9 A;  4UA4 A;  4D1W A;  4EYL A;  3IOG A;  4NQ2 A;  4RM5 A;  4AD9 A;  2HB9 A;  4P62 A;  3ZQ4 A;  2FU9 A;  4TYT A;  4UWS B;  5ACT A;  5K4K A;  3I13 A;  1HLK A;  2Y8A A;  1JT1 A;  1X8I A;  1KO2 A;  2WYL A;  1XM8 A;  2WHG A;  2I7X A;  1E5D A;  3P2U A;  5A0T A;  3T9M A;  3JXP A;  2BG7 A;  3WXC A;  2ZZI A;  2FU6 A;  5LCF A;  4F6H A;  2ZWR A;  5EWA A;  4H0D A;  4YSB A;  3ZWF A;  4CHL A;  5HH5 A;  4XWW A;  1DXK A;  2FM6 A;  4PVT A;  4EXY A;  2BFZ A;  4DIK A;  2QIN A;  2I7V A;  4EY2 A;  1Y44 A;  2OHH A;  4XUK A;  1WW1 A;  1L9Y A;  4AWZ A;  2FK6 A;  4Z60 A;  2Y87 A;  3DH8 A;  4TZB A;  1BMC A;  3IEM A;  2GMN A;  2BC2 A;  5HIQ A;  4Z6X A;  3I11 A;  1XTO A;  4TZF A;  2BR6 A;  1WRA A;  2E7Y A;  3X2X A;  3DHA A;  3SD9 A;  4D02 A;  2BG8 A;  5K0W A;  2GKL A;  1MQO A;  2NYP A;  5A5Z A;  3QH8 A;  4NQ4 A;  4D1U A;  4C1D A;  2YNT B;  3KNS A;  4B87 A;  4HKY A;  2YNU A;  2I7T A;  2Q0J A;  5ACR A;  4EXS A;  4AX1 B;  2P18 A;  3X30 A;  4C1H A;  4RAW A;  3SPU A;  4NQ5 A;  3IE1 A;  5B1U A;  1BC2 A;  5LM6 A;  4Z7R A;  3G1P A;  4RL0 A;  1YCH A;  4C09 A;  2OHJ A;  4GYU A;  5EV6 A;  5ACV A;  3BV6 A;  4Z5Z A;  2ZO4 A;  2BGA A;  2QDS A;  3H3E A;  4GCW A;  2WRS A;  2NZF A;  3PY5 A;  3RKJ A;  3I0V A;  5A0V A;  4KEP A;  5AHR A;  5AXR A;  1A8T A;  1JJE A;  5AXO A;  4O98 A;  5AYA A;  3VPE A;  5FQC A;  4U4L A;  3SBL A;  2BIB A;  4EFZ A;  1QH5 A;  3ADR A;  3SW3 A;  5AHO A;  5ACU A;  2AIO A;  2Q9U A;  3AF6 A;  3RKK A;  1M2X A;  2XR1 A;  4C1F A;  2M5C A;  4YSL A;  2A7M A;  1VME A;  2YZ3 A;  2YNT A;  4AWY B;  2FU8 A;  1YCG A;  5K4M A;  2BTN A;  3ZNB A;  3SRX A;  2NZE A;  2FU7 A;  4UWR B;  3T3N A;  4J5F A;  1WUO A;  4UWO B;  4NQ6 A;  1ZKP A;  3BK1 A;  5FQB A;  2VW8 A;  3ZR9 A;  2BG8 B;  5EVB A;  1VGN A;  2FHX A;  2YNW A;  2P1E A;  3Q6V A;  1QH3 A;  5ACX A;  3F9O A; 
#chains in the Genus database with same CATH topology
 1X8H A;  1WUP A;  3RPC A;  2GFK A;  4JO0 A;  4D1V A;  3S0Z A;  5EHT A;  4DIL A;  4TZE A;  2BFZ B;  4EYF A;  4V0H A;  5EVK A;  2GCU A;  4Z67 A;  4GYQ A;  4AX0 B;  2P97 A;  3PG4 A;  4UAM A;  5IQK A;  5DPX A;  3FCZ A;  3IEK A;  1A7T A;  1SML A;  4RBS A;  5HH6 A;  2QED A;  2CFU A;  4TYF A;  4BP0 A;  2Q0I A;  1BVT A;  5KIL A;  1ZNB A;  4FEK A;  2YNV B;  3TP9 A;  5EH9 A;  2P4Z A;  4C1C A;  5B15 A;  5HIP A;  4EYB A;  3L6N A;  5B3R A;  3X2Z A;  2AZ4 A;  5EVD A;  2QDT A;  1YCF A;  3PY6 A;  3KNR A;  5LE1 A;  4RAM A;  4ZNB A;  5ACQ A;  1DD6 A;  3I14 A;  3DHC A;  5FQA A;  5A87 A;  3VQZ A;  4PVO A;  4WD6 A;  4F6Z A;  3IOF A;  2ZNB A;  4C1G A;  4FSB A;  5ACS A;  4NUR A;  2BFK A;  4C1E A;  4UWP B;  2Q42 A;  3MD7 A;  5ACP A;  1P9E A;  5ACW A;  3IE0 A;  1KO3 A;  4AXH A;  5KIK A;  3IEL A;  4Z5Y A;  2OHI A;  1X8G A;  4LE6 A;  4ZEJ A;  4ZO2 A;  5HH4 A;  3SFP A;  3BK2 A;  2DKF A;  2FHX B;  3LVZ A;  2H6A A;  3ESH A;  2NXA A;  4D1T A;  4YSK A;  5LMC A;  1ZTC A;  3R2U A;  5A23 A;  2BMI A;  2WYM C;  3FAI A;  4KEQ A;  5LCA A;  1K07 A;  2QJS A;  2DOO A;  4ZO3 A;  5AIJ A;  4HL2 A;  5HIS A;  3KL7 A;  2R2D A;  3AJ3 A;  2Y8B A;  3IE2 A;  1JJT A;  2YCB A;  4RL2 A;  3X2Y A;  5LS3 A;  2YNV A;  2BG2 A;  2XF4 A;  3IDZ A;  3AF5 A;  3I15 A;  3BC2 A;  4BZ3 A;  2BFL A;  4FR7 A;  4HL1 A;  5HIO A;  1VJN A;  3DHB A;  4XWT A;  5LLD A;  4UBQ A;  5LCH A;  3T3O A;  2CBN A;  5EV8 A;  2UYX A;  1KR3 A;  5K4N A;  5LSC A;  5EW0 A;  2GFJ A;  2M5D A;  3A4Y A;  4J5H A;  1DDK A;  2BG6 A;  5AEB A;  2WYM A;  4TZ9 A;  4UA4 A;  4D1W A;  4EYL A;  3IOG A;  4NQ2 A;  4RM5 A;  4AD9 A;  2HB9 A;  4P62 A;  3ZQ4 A;  2FU9 A;  4TYT A;  4UWS B;  5ACT A;  5K4K A;  3I13 A;  1HLK A;  2Y8A A;  1JT1 A;  1X8I A;  1KO2 A;  2WYL A;  1XM8 A;  2WHG A;  1E5D A;  2CFZ A;  2I7X A;  3P2U A;  5A0T A;  3T9M A;  3JXP A;  2BG7 A;  4AV7 A;  3WXC A;  2ZZI A;  2FU6 A;  5LCF A;  4F6H A;  2ZWR A;  5EWA A;  4H0D A;  5AJL A;  4YSB A;  3ZWF A;  4CHL A;  5HH5 A;  4XWW A;  1DXK A;  2FM6 A;  4PVT A;  4EXY A;  2BFZ A;  4DIK A;  2QIN A;  2I7V A;  4EY2 A;  1Y44 A;  2OHH A;  4XUK A;  1WW1 A;  1L9Y A;  4AWZ A;  2FK6 A;  4Z60 A;  2Y87 A;  3DH8 A;  4TZB A;  1BMC A;  3IEM A;  2GMN A;  2BC2 A;  5HIQ A;  4Z6X A;  4PDX A;  3I11 A;  1XTO A;  4TZF A;  2BR6 A;  1WRA A;  2E7Y A;  3X2X A;  3DHA A;  3SD9 A;  4D02 A;  2BG8 A;  2CG3 A;  5K0W A;  2GKL A;  1MQO A;  2NYP A;  5A5Z A;  3QH8 A;  4NQ4 A;  4D1U A;  4C1D A;  2YNT B;  3KNS A;  4B87 A;  4HKY A;  2YNU A;  2I7T A;  2Q0J A;  5ACR A;  4EXS A;  4AX1 B;  2P18 A;  3X30 A;  4C1H A;  4RAW A;  3SPU A;  4NQ5 A;  3IE1 A;  5B1U A;  2YHE A;  1BC2 A;  5LM6 A;  4Z7R A;  3G1P A;  4RL0 A;  1YCH A;  4C09 A;  2OHJ A;  4GYU A;  5EV6 A;  5ACV A;  3BV6 A;  4Z5Z A;  2ZO4 A;  2BGA A;  2QDS A;  3H3E A;  4GCW A;  2WRS A;  2NZF A;  3PY5 A;  3RKJ A;  3I0V A;  5A0V A;  4KEP A;  5AHR A;  5AXR A;  1A8T A;  1JJE A;  5AXO A;  4O98 A;  5AYA A;  3VPE A;  5FQC A;  4U4L A;  3SBL A;  2BIB A;  4EFZ A;  1QH5 A;  3ADR A;  3SW3 A;  5AHO A;  5ACU A;  2AIO A;  2Q9U A;  3AF6 A;  3RKK A;  1M2X A;  2XR1 A;  4C1F A;  2M5C A;  4YSL A;  2A7M A;  1VME A;  2YZ3 A;  2YNT A;  4AWY B;  2FU8 A;  1YCG A;  5K4M A;  2BTN A;  3ZNB A;  3SRX A;  2NZE A;  2FU7 A;  4UWR B;  3T3N A;  4J5F A;  1WUO A;  4UWO B;  4NQ6 A;  1ZKP A;  3BK1 A;  5FQB A;  2VW8 A;  3ZR9 A;  2BG8 B;  5EVB A;  2CG2 A;  1VGN A;  2FHX A;  2YNW A;  2P1E A;  3Q6V A;  1QH3 A;  5ACX A;  3F9O A; 
#chains in the Genus database with same CATH homology
 1X8H A;  1WUP A;  3RPC A;  2GFK A;  4JO0 A;  4D1V A;  3S0Z A;  5EHT A;  4DIL A;  4TZE A;  2BFZ B;  4EYF A;  4V0H A;  5EVK A;  2GCU A;  4Z67 A;  4GYQ A;  4AX0 B;  2P97 A;  3PG4 A;  4UAM A;  5IQK A;  5DPX A;  3FCZ A;  3IEK A;  1A7T A;  1SML A;  4RBS A;  5HH6 A;  2QED A;  4TYF A;  4BP0 A;  2Q0I A;  1BVT A;  5KIL A;  1ZNB A;  4FEK A;  2YNV B;  3TP9 A;  5EH9 A;  2P4Z A;  4C1C A;  5B15 A;  5HIP A;  4EYB A;  3L6N A;  5B3R A;  3X2Z A;  2AZ4 A;  5EVD A;  2QDT A;  1YCF A;  3PY6 A;  3KNR A;  5LE1 A;  4RAM A;  4ZNB A;  5ACQ A;  1DD6 A;  3I14 A;  3DHC A;  5FQA A;  5A87 A;  3VQZ A;  4PVO A;  4WD6 A;  4F6Z A;  3IOF A;  2ZNB A;  4C1G A;  4FSB A;  5ACS A;  2BFK A;  4C1E A;  4UWP B;  2Q42 A;  3MD7 A;  5ACP A;  1P9E A;  5ACW A;  3IE0 A;  1KO3 A;  5KIK A;  3IEL A;  4Z5Y A;  2OHI A;  1X8G A;  4LE6 A;  4ZEJ A;  4ZO2 A;  5HH4 A;  3SFP A;  3BK2 A;  2DKF A;  2FHX B;  3LVZ A;  2H6A A;  3ESH A;  2NXA A;  4D1T A;  4YSK A;  5LMC A;  1ZTC A;  3R2U A;  2BMI A;  2WYM C;  3FAI A;  4KEQ A;  5LCA A;  1K07 A;  2QJS A;  2DOO A;  4ZO3 A;  4HL2 A;  5HIS A;  3KL7 A;  2R2D A;  3AJ3 A;  2Y8B A;  3IE2 A;  1JJT A;  2YCB A;  4RL2 A;  3X2Y A;  5LS3 A;  2YNV A;  2BG2 A;  2XF4 A;  3IDZ A;  3AF5 A;  3I15 A;  3BC2 A;  4BZ3 A;  2BFL A;  4FR7 A;  4HL1 A;  5HIO A;  1VJN A;  3DHB A;  4XWT A;  5LLD A;  4UBQ A;  5LCH A;  3T3O A;  2CBN A;  5EV8 A;  2UYX A;  1KR3 A;  5K4N A;  5LSC A;  5EW0 A;  2GFJ A;  2M5D A;  3A4Y A;  4J5H A;  1DDK A;  2BG6 A;  5AEB A;  2WYM A;  4TZ9 A;  4UA4 A;  4D1W A;  4EYL A;  3IOG A;  4NQ2 A;  4RM5 A;  4AD9 A;  2HB9 A;  4P62 A;  3ZQ4 A;  2FU9 A;  4TYT A;  4UWS B;  5ACT A;  5K4K A;  3I13 A;  1HLK A;  2Y8A A;  1JT1 A;  1X8I A;  1KO2 A;  2WYL A;  1XM8 A;  2WHG A;  2I7X A;  1E5D A;  3P2U A;  5A0T A;  3T9M A;  3JXP A;  2BG7 A;  3WXC A;  2ZZI A;  2FU6 A;  5LCF A;  4F6H A;  2ZWR A;  5EWA A;  4H0D A;  4YSB A;  3ZWF A;  4CHL A;  5HH5 A;  4XWW A;  1DXK A;  2FM6 A;  4PVT A;  4EXY A;  2BFZ A;  4DIK A;  2QIN A;  2I7V A;  4EY2 A;  1Y44 A;  2OHH A;  4XUK A;  1WW1 A;  1L9Y A;  4AWZ A;  2FK6 A;  4Z60 A;  2Y87 A;  3DH8 A;  4TZB A;  1BMC A;  3IEM A;  2GMN A;  2BC2 A;  5HIQ A;  4Z6X A;  3I11 A;  1XTO A;  4TZF A;  2BR6 A;  1WRA A;  2E7Y A;  3X2X A;  3DHA A;  3SD9 A;  4D02 A;  2BG8 A;  5K0W A;  2GKL A;  1MQO A;  2NYP A;  5A5Z A;  3QH8 A;  4NQ4 A;  4D1U A;  4C1D A;  2YNT B;  3KNS A;  4B87 A;  4HKY A;  2YNU A;  2I7T A;  2Q0J A;  5ACR A;  4EXS A;  4AX1 B;  2P18 A;  3X30 A;  4C1H A;  4RAW A;  3SPU A;  4NQ5 A;  3IE1 A;  5B1U A;  1BC2 A;  5LM6 A;  4Z7R A;  3G1P A;  4RL0 A;  1YCH A;  4C09 A;  2OHJ A;  4GYU A;  5EV6 A;  5ACV A;  3BV6 A;  4Z5Z A;  2ZO4 A;  2BGA A;  2QDS A;  3H3E A;  4GCW A;  2WRS A;  2NZF A;  3PY5 A;  3RKJ A;  3I0V A;  5A0V A;  4KEP A;  5AHR A;  5AXR A;  1A8T A;  1JJE A;  5AXO A;  4O98 A;  5AYA A;  3VPE A;  5FQC A;  4U4L A;  3SBL A;  2BIB A;  4EFZ A;  1QH5 A;  3ADR A;  3SW3 A;  5AHO A;  5ACU A;  2AIO A;  2Q9U A;  3AF6 A;  3RKK A;  1M2X A;  2XR1 A;  4C1F A;  2M5C A;  4YSL A;  2A7M A;  1VME A;  2YZ3 A;  2YNT A;  4AWY B;  2FU8 A;  1YCG A;  5K4M A;  2BTN A;  3ZNB A;  3SRX A;  2NZE A;  2FU7 A;  4UWR B;  3T3N A;  4J5F A;  1WUO A;  4UWO B;  4NQ6 A;  1ZKP A;  3BK1 A;  5FQB A;  2VW8 A;  3ZR9 A;  2BG8 B;  5EVB A;  1VGN A;  2FHX A;  2YNW A;  2P1E A;  3Q6V A;  1QH3 A;  5ACX A;  3F9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...