3Q6VA

Crystal structure of serratia fonticola sfh-i: glycerol complex
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
228
structure length
228
Chain Sequence
b'NLTLTHFKGPLYIVEDKEYVQENSMVYIGTDGITIIGATWTPETAETLYKEIRKVSPLPINEVINTNYHTDRAGGNAYWKTLGAKIVATQMTYDLQKSQWGSIVNFTRQGNNKYPNLEKSLPDTVFPGDFNLQNGSIRAMYLGEAHTKDGIFVYFPAERVLYGNCILKENLGNMSFANRTEYPKTLEKLKGLIEQGELKVDSIIAGHDTPIHDVGLIDHYLTLLEKAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Crystal Structure of Serratia fonticola Sfh-I: Activation of the Nucleophile in Mono-Zinc Metallo-beta-Lactamases
rcsb
source organism Serratia fonticola
molecule tags Hydrolase
total genus 80
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3q6vA00
5EVBA 2BFZB 3ADRA 2WYLA 3SD9A 4FR7A 3DHAA 2YNTB 5K4NA 4H0DA 2P1EA 4C1CA 4XUKA 4UWSB 2QDTA 3DHBA 5ACRA 4GYQA 2Q0IA 2OHIA 4EXSA 2NYPA 1DD6A 1MQOA 2QJSA 2E7YA 3IOFA 5ACUA 4AWYB 4YSKA 5IQKA 3DHCA 4UWOB 4F6ZA 4GCWA 4KEQA 5LS3A 2BG8B 1X8IA 1JJTA 1YCFA 2DKFA 5A0TA 2GFJA 2I7VA 2YNWA 4UWPB 1M2XA 3FAIA 5HIOA 5K4MA 4EXYA 4Z60A 5ACQA 4BZ3A 1DDKA 2FHXB 5DPXA 4LE6A 2BGAA 4C1DA 4Z7RA 4PVTA 2VW8A 3ZNBA 5EHTA 3BV6A 4TYFA 1VMEA 5AHOA 5HIPA 2I7TA 5EVDA 2H6AA 5ACTA 2ZWRA 4EYFA 4RL0A 1Y44A 1E5DA 3TP9A 3X2XA 2WYMA 4AX1B 4ZEJA 4TZ9A 4AD9A 5ACPA 2QINA 4ZO3A 2BFLA 2ZNBA 2YZ3A 1VGNA 4CHLA 4NQ5A 2AIOA 3QH8A 3ZWFA 5EV6A 3ZQ4A 4EYBA 2P4ZA 1KO2A 2A7MA 5A0VA 4RM5A 4C09A 2NZFA 4UA4A 3BC2A 2OHJA 4ZNBA 2BG7A 3L6NA 5AXOA 5EV8A 1ZNBA 5ACVA 1L9YA 5K0WA 5LCAA 3BK1A 5AHRA 2GKLA 3IE0A 3SPUA 4HL1A 1K07A 2ZZIA 2QEDA 3I11A 4YSBA 2FU9A 5B1UA 2Y8BA 2YNVB 3T3NA 2WHGA 5EWAA 4V0HA 4TZBA 4BP0A 3R2UA 3I14A 4UWRB 4TZEA 3IEMA 4KEPA 1A8TA 4YSLA 4F6HA 4UAMA 4RAMA 3T3OA 4J5HA 5HH4A 4D02A 3MD7A 2GCUA 2ZO4A 1ZKPA 2Q0JA 3IE2A 4NQ6A 1KO3A 4HKYA 2QDSA 4Z5ZA 4D1VA 2WYMC 1YCHA 2FM6A 4U4LA 3SFPA 4C1GA 3KL7A 5HISA 1DXKA 4C1FA 2BFZA 3IEKA 1X8GA 5LMCA 1WUOA 3F9OA 3VPEA 5KIKA 1YCGA 4RL2A 5LM6A 2BTNA 2YCBA 2NXAA 4DILA 3PG4A 3BK2A 2FU6A 2Y8AA 1QH3A 2BC2A 2UYXA 3A4YA 4ZO2A 5B3RA 1JJEA 4C1EA 4J5FA 3LVZA 2DOOA 3I13A 3S0ZA 3AF6A 3H3EA 4EY2A 3IELA 2GMNA 2BG8A 2CBNA 5LSCA 3ZR9A 4RBSA 2M5DA 2BG6A 1P9EA 4GYUA 5A87A 3PY5A 3VQZA 4B87A 5K4KA 3AF5A 1WRAA 3RKKA 5FQCA 5FQBA 5B15A 4Z67A 4FSBA 3JXPA 1XM8A 4C1HA 1BMCA 4D1TA 2FHXA 4O98A 3I0VA 4RAWA 4TZFA 2GFKA 2FU7A 3I15A 4AWZA 1KR3A 3G1PA 4DIKA 4NQ4A 1X8HA 4XWWA 2XF4A 1ZTCA 5EH9A 5AYAA 5A5ZA 5LCFA 3X30A 5LCHA 1A7TA 5HIQA 3SRXA 4EYLA 2FU8A 2P18A 2Q42A 3KNSA 3RKJA 2P97A 5AEBA 2HB9A 2BR6A 1XTOA 5AXRA 1HLKA 3AJ3A 2OHHA 4Z6XA 2NZEA 4FEKA 4HL2A 4AX0B 4P62A 2BIBA 1JT1A 1WUPA 2YNUA 4D1UA 2YNTA 5HH6A 3RPCA 2Y87A 4UBQA 2BMIA 2BG2A 5LE1A 4D1WA 5LLDA 3SW3A 3IE1A 1SMLA 2Q9UA 2I7XA 5HH5A 4JO0A 5EW0A 2FK6A 5ACXA 3DH8A 1VJNA 4WD6A 3T9MA 1BC2A 3P2UA 5KILA 1WW1A 2YNVA 4TYTA 3FCZA 4Z5YA 2WRSA 5ACWA 3X2YA 3IDZA 2BFKA 4XWTA 2XR1A 5FQAA 2R2DA 4NQ2A 4PVOA 3SBLA 1BVTA 3KNRA 3IOGA 2M5CA 2AZ4A 3PY6A 3WXCA 4EFZA 3X2ZA 3ESHA 5EVKA 3Q6VA 5ACSA 1QH5A
chains in the Genus database with same CATH superfamily
5EVBA 2BFZB 3ADRA 2WYLA 3SD9A 4FR7A 3DHAA 2YNTB 5K4NA 4H0DA 2P1EA 4C1CA 4XUKA 4UWSB 2QDTA 3DHBA 5ACRA 4GYQA 2Q0IA 2OHIA 4EXSA 2NYPA 1DD6A 1MQOA 2QJSA 2E7YA 3IOFA 5ACUA 4AWYB 4YSKA 5IQKA 3DHCA 4UWOB 4F6ZA 4GCWA 4KEQA 5LS3A 2BG8B 4NURA 1X8IA 1JJTA 1YCFA 2DKFA 5A0TA 2GFJA 2I7VA 2YNWA 4UWPB 1M2XA 3FAIA 5HIOA 5K4MA 4EXYA 4Z60A 5ACQA 4BZ3A 1DDKA 2FHXB 5DPXA 4LE6A 2BGAA 4C1DA 4Z7RA 4PVTA 2VW8A 3ZNBA 5EHTA 3BV6A 4TYFA 1VMEA 5AHOA 5HIPA 2I7TA 5EVDA 2H6AA 5ACTA 2ZWRA 4EYFA 4RL0A 1Y44A 1E5DA 3TP9A 4AXHA 3X2XA 2WYMA 4AX1B 4ZEJA 4TZ9A 4AD9A 5ACPA 2QINA 4ZO3A 2BFLA 2ZNBA 2YZ3A 1VGNA 4CHLA 4NQ5A 2AIOA 3QH8A 3ZWFA 5EV6A 3ZQ4A 4EYBA 2P4ZA 1KO2A 2A7MA 5A0VA 4RM5A 4C09A 2NZFA 4UA4A 3BC2A 2OHJA 4ZNBA 2BG7A 3L6NA 5AXOA 5EV8A 1ZNBA 5ACVA 1L9YA 5K0WA 5LCAA 3BK1A 5AHRA 2GKLA 3IE0A 3SPUA 4HL1A 1K07A 2ZZIA 2QEDA 3I11A 4YSBA 2FU9A 5B1UA 2Y8BA 2YNVB 3T3NA 2WHGA 5EWAA 4V0HA 4TZBA 4BP0A 3R2UA 3I14A 4UWRB 4TZEA 3IEMA 4KEPA 1A8TA 4YSLA 4F6HA 4UAMA 4RAMA 3T3OA 4J5HA 5HH4A 4D02A 3MD7A 2GCUA 2ZO4A 1ZKPA 2Q0JA 3IE2A 4NQ6A 1KO3A 4HKYA 2QDSA 4Z5ZA 4D1VA 2WYMC 1YCHA 4PDXA 2FM6A 4U4LA 3SFPA 4C1GA 3KL7A 5HISA 1DXKA 4C1FA 2BFZA 3IEKA 1X8GA 5LMCA 1WUOA 3F9OA 3VPEA 5KIKA 1YCGA 4RL2A 5LM6A 2BTNA 2YCBA 2NXAA 4DILA 3PG4A 3BK2A 2FU6A 2Y8AA 1QH3A 2BC2A 2UYXA 3A4YA 4ZO2A 5B3RA 1JJEA 4C1EA 4J5FA 3LVZA 2DOOA 3I13A 3S0ZA 3AF6A 3H3EA 4EY2A 3IELA 2GMNA 2BG8A 2CBNA 5LSCA 2YHEA 3ZR9A 4RBSA 2CG2A 2M5DA 2BG6A 1P9EA 2CFUA 4GYUA 5A87A 3PY5A 3VQZA 4B87A 5K4KA 3AF5A 1WRAA 3RKKA 5FQCA 5FQBA 5B15A 4Z67A 4FSBA 3JXPA 1XM8A 4C1HA 1BMCA 4D1TA 2FHXA 4O98A 3I0VA 4RAWA 4TZFA 2GFKA 2FU7A 3I15A 4AWZA 1KR3A 3G1PA 4AV7A 4DIKA 4NQ4A 1X8HA 4XWWA 2XF4A 1ZTCA 5EH9A 5AYAA 5A5ZA 5LCFA 3X30A 5LCHA 1A7TA 5HIQA 3SRXA 4EYLA 2FU8A 2P18A 2Q42A 3KNSA 3RKJA 2P97A 5AEBA 2HB9A 2BR6A 1XTOA 5AXRA 1HLKA 3AJ3A 2OHHA 4Z6XA 2NZEA 4FEKA 4HL2A 4AX0B 4P62A 2BIBA 2CFZA 1JT1A 1WUPA 2YNUA 4D1UA 2YNTA 5HH6A 2CG3A 3RPCA 2Y87A 4UBQA 2BMIA 2BG2A 5LE1A 4D1WA 5LLDA 3SW3A 3IE1A 1SMLA 2Q9UA 2I7XA 5HH5A 4JO0A 5EW0A 2FK6A 5ACXA 3DH8A 1VJNA 4WD6A 3T9MA 1BC2A 3P2UA 5KILA 1WW1A 2YNVA 4TYTA 3FCZA 4Z5YA 2WRSA 5ACWA 3X2YA 3IDZA 2BFKA 4XWTA 5AIJA 5A23A 2XR1A 5FQAA 2R2DA 4NQ2A 4PVOA 3SBLA 1BVTA 3KNRA 3IOGA 2M5CA 5AJLA 2AZ4A 3PY6A 3WXCA 3X2ZA 4EFZA 3ESHA 5EVKA 3Q6VA 5ACSA 1QH5A
chains in the Genus database with same CATH topology
5EVBA 2BFZB 3ADRA 2WYLA 3SD9A 4FR7A 3DHAA 2YNTB 5K4NA 4H0DA 2P1EA 4C1CA 4XUKA 4UWSB 2QDTA 3DHBA 5ACRA 4GYQA 2Q0IA 2OHIA 4EXSA 2NYPA 1DD6A 1MQOA 2QJSA 2E7YA 3IOFA 5ACUA 4AWYB 4YSKA 5IQKA 3DHCA 4UWOB 4F6ZA 4GCWA 4KEQA 5LS3A 2BG8B 1X8IA 1JJTA 1YCFA 2DKFA 5A0TA 2GFJA 2I7VA 2YNWA 4UWPB 1M2XA 3FAIA 5HIOA 5K4MA 4EXYA 4Z60A 5ACQA 4BZ3A 1DDKA 2FHXB 5DPXA 4LE6A 2BGAA 4C1DA 4Z7RA 4PVTA 2VW8A 3ZNBA 5EHTA 3BV6A 4TYFA 1VMEA 5AHOA 5HIPA 2I7TA 5EVDA 2H6AA 5ACTA 2ZWRA 4EYFA 4RL0A 1Y44A 1E5DA 3TP9A 3X2XA 2WYMA 4AX1B 4ZEJA 4TZ9A 4AD9A 5ACPA 2QINA 4ZO3A 2BFLA 2ZNBA 2YZ3A 1VGNA 4CHLA 4NQ5A 2AIOA 3QH8A 3ZWFA 5EV6A 3ZQ4A 4EYBA 2P4ZA 1KO2A 2A7MA 5A0VA 4RM5A 4C09A 2NZFA 4UA4A 3BC2A 2OHJA 4ZNBA 2BG7A 3L6NA 5AXOA 5EV8A 1ZNBA 5ACVA 1L9YA 5K0WA 5LCAA 3BK1A 5AHRA 2GKLA 3IE0A 3SPUA 4HL1A 1K07A 2ZZIA 2QEDA 3I11A 4YSBA 2FU9A 5B1UA 2Y8BA 2YNVB 3T3NA 2WHGA 5EWAA 4V0HA 4TZBA 4BP0A 3R2UA 3I14A 4UWRB 4TZEA 3IEMA 4KEPA 1A8TA 4YSLA 4F6HA 4UAMA 4RAMA 3T3OA 4J5HA 5HH4A 4D02A 3MD7A 2GCUA 2ZO4A 1ZKPA 2Q0JA 3IE2A 4NQ6A 1KO3A 4HKYA 2QDSA 4Z5ZA 4D1VA 2WYMC 1YCHA 2FM6A 4U4LA 3SFPA 4C1GA 3KL7A 5HISA 1DXKA 4C1FA 2BFZA 3IEKA 1X8GA 5LMCA 1WUOA 3F9OA 3VPEA 5KIKA 1YCGA 4RL2A 5LM6A 2BTNA 2YCBA 2NXAA 4DILA 3PG4A 3BK2A 2FU6A 2Y8AA 1QH3A 2BC2A 2UYXA 3A4YA 4ZO2A 5B3RA 1JJEA 4C1EA 4J5FA 3LVZA 2DOOA 3I13A 3S0ZA 3AF6A 3H3EA 4EY2A 3IELA 2GMNA 2BG8A 2CBNA 5LSCA 3ZR9A 4RBSA 2M5DA 2BG6A 1P9EA 4GYUA 5A87A 3PY5A 3VQZA 4B87A 5K4KA 3AF5A 1WRAA 3RKKA 5FQCA 5FQBA 5B15A 4Z67A 4FSBA 3JXPA 1XM8A 4C1HA 1BMCA 4D1TA 2FHXA 4O98A 3I0VA 4RAWA 4TZFA 2GFKA 2FU7A 3I15A 4AWZA 1KR3A 3G1PA 4DIKA 4NQ4A 1X8HA 4XWWA 2XF4A 1ZTCA 5EH9A 5AYAA 5A5ZA 5LCFA 3X30A 5LCHA 1A7TA 5HIQA 3SRXA 4EYLA 2FU8A 2P18A 2Q42A 3KNSA 3RKJA 2P97A 5AEBA 2HB9A 2BR6A 1XTOA 5AXRA 1HLKA 3AJ3A 2OHHA 4Z6XA 2NZEA 4FEKA 4HL2A 4AX0B 4P62A 2BIBA 1JT1A 1WUPA 2YNUA 4D1UA 2YNTA 5HH6A 3RPCA 2Y87A 4UBQA 2BMIA 2BG2A 5LE1A 4D1WA 5LLDA 3SW3A 3IE1A 1SMLA 2Q9UA 2I7XA 5HH5A 4JO0A 5EW0A 2FK6A 5ACXA 3DH8A 1VJNA 4WD6A 3T9MA 1BC2A 3P2UA 5KILA 1WW1A 2YNVA 4TYTA 3FCZA 4Z5YA 2WRSA 5ACWA 3X2YA 3IDZA 2BFKA 4XWTA 2XR1A 5FQAA 2R2DA 4NQ2A 4PVOA 3SBLA 1BVTA 3KNRA 3IOGA 2M5CA 2AZ4A 3PY6A 3WXCA 4EFZA 3X2ZA 3ESHA 5EVKA 3Q6VA 5ACSA 1QH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EVB A;  2BFZ B;  3ADR A;  2WYL A;  3SD9 A;  4FR7 A;  3DHA A;  2YNT B;  5K4N A;  4H0D A;  2P1E A;  4C1C A;  4XUK A;  4UWS B;  2QDT A;  3DHB A;  5ACR A;  4GYQ A;  2Q0I A;  2OHI A;  4EXS A;  2NYP A;  1DD6 A;  1MQO A;  2QJS A;  2E7Y A;  3IOF A;  5ACU A;  4AWY B;  4YSK A;  5IQK A;  3DHC A;  4UWO B;  4F6Z A;  4GCW A;  4KEQ A;  5LS3 A;  2BG8 B;  1X8I A;  1JJT A;  1YCF A;  2DKF A;  5A0T A;  2GFJ A;  2I7V A;  2YNW A;  4UWP B;  1M2X A;  3FAI A;  5HIO A;  5K4M A;  4EXY A;  4Z60 A;  5ACQ A;  4BZ3 A;  1DDK A;  2FHX B;  5DPX A;  4LE6 A;  2BGA A;  4C1D A;  4Z7R A;  4PVT A;  2VW8 A;  3ZNB A;  5EHT A;  3BV6 A;  4TYF A;  1VME A;  5AHO A;  5HIP A;  2I7T A;  5EVD A;  2H6A A;  5ACT A;  2ZWR A;  4EYF A;  4RL0 A;  1Y44 A;  1E5D A;  3TP9 A;  3X2X A;  2WYM A;  4AX1 B;  4ZEJ A;  4TZ9 A;  4AD9 A;  5ACP A;  2QIN A;  4ZO3 A;  2BFL A;  2ZNB A;  2YZ3 A;  1VGN A;  4CHL A;  4NQ5 A;  2AIO A;  3QH8 A;  3ZWF A;  5EV6 A;  3ZQ4 A;  4EYB A;  2P4Z A;  1KO2 A;  2A7M A;  5A0V A;  4RM5 A;  4C09 A;  2NZF A;  4UA4 A;  3BC2 A;  2OHJ A;  4ZNB A;  2BG7 A;  3L6N A;  5AXO A;  5EV8 A;  1ZNB A;  5ACV A;  1L9Y A;  5K0W A;  5LCA A;  3BK1 A;  5AHR A;  2GKL A;  3IE0 A;  3SPU A;  4HL1 A;  1K07 A;  2ZZI A;  2QED A;  3I11 A;  4YSB A;  2FU9 A;  5B1U A;  2Y8B A;  2YNV B;  3T3N A;  2WHG A;  5EWA A;  4V0H A;  4TZB A;  4BP0 A;  3R2U A;  3I14 A;  4UWR B;  4TZE A;  3IEM A;  4KEP A;  1A8T A;  4YSL A;  4F6H A;  4UAM A;  4RAM A;  3T3O A;  4J5H A;  5HH4 A;  4D02 A;  3MD7 A;  2GCU A;  2ZO4 A;  1ZKP A;  2Q0J A;  3IE2 A;  4NQ6 A;  1KO3 A;  4HKY A;  2QDS A;  4Z5Z A;  4D1V A;  2WYM C;  1YCH A;  2FM6 A;  4U4L A;  3SFP A;  4C1G A;  3KL7 A;  5HIS A;  1DXK A;  4C1F A;  2BFZ A;  3IEK A;  1X8G A;  5LMC A;  1WUO A;  3F9O A;  3VPE A;  5KIK A;  1YCG A;  4RL2 A;  5LM6 A;  2BTN A;  2YCB A;  2NXA A;  4DIL A;  3PG4 A;  3BK2 A;  2FU6 A;  2Y8A A;  1QH3 A;  2BC2 A;  2UYX A;  3A4Y A;  4ZO2 A;  5B3R A;  1JJE A;  4C1E A;  4J5F A;  3LVZ A;  2DOO A;  3I13 A;  3S0Z A;  3AF6 A;  3H3E A;  4EY2 A;  3IEL A;  2GMN A;  2BG8 A;  2CBN A;  5LSC A;  3ZR9 A;  4RBS A;  2M5D A;  2BG6 A;  1P9E A;  4GYU A;  5A87 A;  3PY5 A;  3VQZ A;  4B87 A;  5K4K A;  3AF5 A;  1WRA A;  3RKK A;  5FQC A;  5FQB A;  5B15 A;  4Z67 A;  4FSB A;  3JXP A;  1XM8 A;  4C1H A;  1BMC A;  4D1T A;  2FHX A;  4O98 A;  3I0V A;  4RAW A;  4TZF A;  2GFK A;  2FU7 A;  3I15 A;  4AWZ A;  1KR3 A;  3G1P A;  4DIK A;  4NQ4 A;  1X8H A;  4XWW A;  2XF4 A;  1ZTC A;  5EH9 A;  5AYA A;  5A5Z A;  5LCF A;  3X30 A;  5LCH A;  1A7T A;  5HIQ A;  3SRX A;  4EYL A;  2FU8 A;  2P18 A;  2Q42 A;  3KNS A;  3RKJ A;  2P97 A;  5AEB A;  2HB9 A;  2BR6 A;  1XTO A;  5AXR A;  1HLK A;  3AJ3 A;  2OHH A;  4Z6X A;  2NZE A;  4FEK A;  4HL2 A;  4AX0 B;  4P62 A;  2BIB A;  1JT1 A;  1WUP A;  2YNU A;  4D1U A;  2YNT A;  5HH6 A;  3RPC A;  2Y87 A;  4UBQ A;  2BMI A;  2BG2 A;  5LE1 A;  4D1W A;  5LLD A;  3SW3 A;  3IE1 A;  1SML A;  2Q9U A;  2I7X A;  5HH5 A;  4JO0 A;  5EW0 A;  2FK6 A;  5ACX A;  3DH8 A;  1VJN A;  4WD6 A;  3T9M A;  1BC2 A;  3P2U A;  5KIL A;  1WW1 A;  2YNV A;  4TYT A;  3FCZ A;  4Z5Y A;  2WRS A;  5ACW A;  3X2Y A;  3IDZ A;  2BFK A;  4XWT A;  2XR1 A;  5FQA A;  2R2D A;  4NQ2 A;  4PVO A;  3SBL A;  1BVT A;  3KNR A;  3IOG A;  2M5C A;  2AZ4 A;  3PY6 A;  3WXC A;  4EFZ A;  3X2Z A;  3ESH A;  5EVK A;  3Q6V A;  5ACS A;  1QH5 A; 
#chains in the Genus database with same CATH topology
 5EVB A;  2BFZ B;  3ADR A;  2WYL A;  3SD9 A;  4FR7 A;  3DHA A;  2YNT B;  5K4N A;  4H0D A;  2P1E A;  4C1C A;  4XUK A;  4UWS B;  2QDT A;  3DHB A;  5ACR A;  4GYQ A;  2Q0I A;  2OHI A;  4EXS A;  2NYP A;  1DD6 A;  1MQO A;  2QJS A;  2E7Y A;  3IOF A;  5ACU A;  4AWY B;  4YSK A;  5IQK A;  3DHC A;  4UWO B;  4F6Z A;  4GCW A;  4KEQ A;  5LS3 A;  2BG8 B;  4NUR A;  1X8I A;  1JJT A;  1YCF A;  2DKF A;  5A0T A;  2GFJ A;  2I7V A;  2YNW A;  4UWP B;  1M2X A;  3FAI A;  5HIO A;  5K4M A;  4EXY A;  4Z60 A;  5ACQ A;  4BZ3 A;  1DDK A;  2FHX B;  5DPX A;  4LE6 A;  2BGA A;  4C1D A;  4Z7R A;  4PVT A;  2VW8 A;  3ZNB A;  5EHT A;  3BV6 A;  4TYF A;  1VME A;  5AHO A;  5HIP A;  2I7T A;  5EVD A;  2H6A A;  5ACT A;  2ZWR A;  4EYF A;  4RL0 A;  1Y44 A;  1E5D A;  3TP9 A;  4AXH A;  3X2X A;  2WYM A;  4AX1 B;  4ZEJ A;  4TZ9 A;  4AD9 A;  5ACP A;  2QIN A;  4ZO3 A;  2BFL A;  2ZNB A;  2YZ3 A;  1VGN A;  4CHL A;  4NQ5 A;  2AIO A;  3QH8 A;  3ZWF A;  5EV6 A;  3ZQ4 A;  4EYB A;  2P4Z A;  1KO2 A;  2A7M A;  5A0V A;  4RM5 A;  4C09 A;  2NZF A;  4UA4 A;  3BC2 A;  2OHJ A;  4ZNB A;  2BG7 A;  3L6N A;  5AXO A;  5EV8 A;  1ZNB A;  5ACV A;  1L9Y A;  5K0W A;  5LCA A;  3BK1 A;  5AHR A;  2GKL A;  3IE0 A;  3SPU A;  4HL1 A;  1K07 A;  2ZZI A;  2QED A;  3I11 A;  4YSB A;  2FU9 A;  5B1U A;  2Y8B A;  2YNV B;  3T3N A;  2WHG A;  5EWA A;  4V0H A;  4TZB A;  4BP0 A;  3R2U A;  3I14 A;  4UWR B;  4TZE A;  3IEM A;  4KEP A;  1A8T A;  4YSL A;  4F6H A;  4UAM A;  4RAM A;  3T3O A;  4J5H A;  5HH4 A;  4D02 A;  3MD7 A;  2GCU A;  2ZO4 A;  1ZKP A;  2Q0J A;  3IE2 A;  4NQ6 A;  1KO3 A;  4HKY A;  2QDS A;  4Z5Z A;  4D1V A;  2WYM C;  1YCH A;  4PDX A;  2FM6 A;  4U4L A;  3SFP A;  4C1G A;  3KL7 A;  5HIS A;  1DXK A;  4C1F A;  2BFZ A;  3IEK A;  1X8G A;  5LMC A;  1WUO A;  3F9O A;  3VPE A;  5KIK A;  1YCG A;  4RL2 A;  5LM6 A;  2BTN A;  2YCB A;  2NXA A;  4DIL A;  3PG4 A;  3BK2 A;  2FU6 A;  2Y8A A;  1QH3 A;  2BC2 A;  2UYX A;  3A4Y A;  4ZO2 A;  5B3R A;  1JJE A;  4C1E A;  4J5F A;  3LVZ A;  2DOO A;  3I13 A;  3S0Z A;  3AF6 A;  3H3E A;  4EY2 A;  3IEL A;  2GMN A;  2BG8 A;  2CBN A;  5LSC A;  2YHE A;  3ZR9 A;  4RBS A;  2CG2 A;  2M5D A;  2BG6 A;  1P9E A;  2CFU A;  4GYU A;  5A87 A;  3PY5 A;  3VQZ A;  4B87 A;  5K4K A;  3AF5 A;  1WRA A;  3RKK A;  5FQC A;  5FQB A;  5B15 A;  4Z67 A;  4FSB A;  3JXP A;  1XM8 A;  4C1H A;  1BMC A;  4D1T A;  2FHX A;  4O98 A;  3I0V A;  4RAW A;  4TZF A;  2GFK A;  2FU7 A;  3I15 A;  4AWZ A;  1KR3 A;  3G1P A;  4AV7 A;  4DIK A;  4NQ4 A;  1X8H A;  4XWW A;  2XF4 A;  1ZTC A;  5EH9 A;  5AYA A;  5A5Z A;  5LCF A;  3X30 A;  5LCH A;  1A7T A;  5HIQ A;  3SRX A;  4EYL A;  2FU8 A;  2P18 A;  2Q42 A;  3KNS A;  3RKJ A;  2P97 A;  5AEB A;  2HB9 A;  2BR6 A;  1XTO A;  5AXR A;  1HLK A;  3AJ3 A;  2OHH A;  4Z6X A;  2NZE A;  4FEK A;  4HL2 A;  4AX0 B;  4P62 A;  2BIB A;  2CFZ A;  1JT1 A;  1WUP A;  2YNU A;  4D1U A;  2YNT A;  5HH6 A;  2CG3 A;  3RPC A;  2Y87 A;  4UBQ A;  2BMI A;  2BG2 A;  5LE1 A;  4D1W A;  5LLD A;  3SW3 A;  3IE1 A;  1SML A;  2Q9U A;  2I7X A;  5HH5 A;  4JO0 A;  5EW0 A;  2FK6 A;  5ACX A;  3DH8 A;  1VJN A;  4WD6 A;  3T9M A;  1BC2 A;  3P2U A;  5KIL A;  1WW1 A;  2YNV A;  4TYT A;  3FCZ A;  4Z5Y A;  2WRS A;  5ACW A;  3X2Y A;  3IDZ A;  2BFK A;  4XWT A;  5AIJ A;  5A23 A;  2XR1 A;  5FQA A;  2R2D A;  4NQ2 A;  4PVO A;  3SBL A;  1BVT A;  3KNR A;  3IOG A;  2M5C A;  5AJL A;  2AZ4 A;  3PY6 A;  3WXC A;  3X2Z A;  4EFZ A;  3ESH A;  5EVK A;  3Q6V A;  5ACS A;  1QH5 A; 
#chains in the Genus database with same CATH homology
 5EVB A;  2BFZ B;  3ADR A;  2WYL A;  3SD9 A;  4FR7 A;  3DHA A;  2YNT B;  5K4N A;  4H0D A;  2P1E A;  4C1C A;  4XUK A;  4UWS B;  2QDT A;  3DHB A;  5ACR A;  4GYQ A;  2Q0I A;  2OHI A;  4EXS A;  2NYP A;  1DD6 A;  1MQO A;  2QJS A;  2E7Y A;  3IOF A;  5ACU A;  4AWY B;  4YSK A;  5IQK A;  3DHC A;  4UWO B;  4F6Z A;  4GCW A;  4KEQ A;  5LS3 A;  2BG8 B;  1X8I A;  1JJT A;  1YCF A;  2DKF A;  5A0T A;  2GFJ A;  2I7V A;  2YNW A;  4UWP B;  1M2X A;  3FAI A;  5HIO A;  5K4M A;  4EXY A;  4Z60 A;  5ACQ A;  4BZ3 A;  1DDK A;  2FHX B;  5DPX A;  4LE6 A;  2BGA A;  4C1D A;  4Z7R A;  4PVT A;  2VW8 A;  3ZNB A;  5EHT A;  3BV6 A;  4TYF A;  1VME A;  5AHO A;  5HIP A;  2I7T A;  5EVD A;  2H6A A;  5ACT A;  2ZWR A;  4EYF A;  4RL0 A;  1Y44 A;  1E5D A;  3TP9 A;  3X2X A;  2WYM A;  4AX1 B;  4ZEJ A;  4TZ9 A;  4AD9 A;  5ACP A;  2QIN A;  4ZO3 A;  2BFL A;  2ZNB A;  2YZ3 A;  1VGN A;  4CHL A;  4NQ5 A;  2AIO A;  3QH8 A;  3ZWF A;  5EV6 A;  3ZQ4 A;  4EYB A;  2P4Z A;  1KO2 A;  2A7M A;  5A0V A;  4RM5 A;  4C09 A;  2NZF A;  4UA4 A;  3BC2 A;  2OHJ A;  4ZNB A;  2BG7 A;  3L6N A;  5AXO A;  5EV8 A;  1ZNB A;  5ACV A;  1L9Y A;  5K0W A;  5LCA A;  3BK1 A;  5AHR A;  2GKL A;  3IE0 A;  3SPU A;  4HL1 A;  1K07 A;  2ZZI A;  2QED A;  3I11 A;  4YSB A;  2FU9 A;  5B1U A;  2Y8B A;  2YNV B;  3T3N A;  2WHG A;  5EWA A;  4V0H A;  4TZB A;  4BP0 A;  3R2U A;  3I14 A;  4UWR B;  4TZE A;  3IEM A;  4KEP A;  1A8T A;  4YSL A;  4F6H A;  4UAM A;  4RAM A;  3T3O A;  4J5H A;  5HH4 A;  4D02 A;  3MD7 A;  2GCU A;  2ZO4 A;  1ZKP A;  2Q0J A;  3IE2 A;  4NQ6 A;  1KO3 A;  4HKY A;  2QDS A;  4Z5Z A;  4D1V A;  2WYM C;  1YCH A;  2FM6 A;  4U4L A;  3SFP A;  4C1G A;  3KL7 A;  5HIS A;  1DXK A;  4C1F A;  2BFZ A;  3IEK A;  1X8G A;  5LMC A;  1WUO A;  3F9O A;  3VPE A;  5KIK A;  1YCG A;  4RL2 A;  5LM6 A;  2BTN A;  2YCB A;  2NXA A;  4DIL A;  3PG4 A;  3BK2 A;  2FU6 A;  2Y8A A;  1QH3 A;  2BC2 A;  2UYX A;  3A4Y A;  4ZO2 A;  5B3R A;  1JJE A;  4C1E A;  4J5F A;  3LVZ A;  2DOO A;  3I13 A;  3S0Z A;  3AF6 A;  3H3E A;  4EY2 A;  3IEL A;  2GMN A;  2BG8 A;  2CBN A;  5LSC A;  3ZR9 A;  4RBS A;  2M5D A;  2BG6 A;  1P9E A;  4GYU A;  5A87 A;  3PY5 A;  3VQZ A;  4B87 A;  5K4K A;  3AF5 A;  1WRA A;  3RKK A;  5FQC A;  5FQB A;  5B15 A;  4Z67 A;  4FSB A;  3JXP A;  1XM8 A;  4C1H A;  1BMC A;  4D1T A;  2FHX A;  4O98 A;  3I0V A;  4RAW A;  4TZF A;  2GFK A;  2FU7 A;  3I15 A;  4AWZ A;  1KR3 A;  3G1P A;  4DIK A;  4NQ4 A;  1X8H A;  4XWW A;  2XF4 A;  1ZTC A;  5EH9 A;  5AYA A;  5A5Z A;  5LCF A;  3X30 A;  5LCH A;  1A7T A;  5HIQ A;  3SRX A;  4EYL A;  2FU8 A;  2P18 A;  2Q42 A;  3KNS A;  3RKJ A;  2P97 A;  5AEB A;  2HB9 A;  2BR6 A;  1XTO A;  5AXR A;  1HLK A;  3AJ3 A;  2OHH A;  4Z6X A;  2NZE A;  4FEK A;  4HL2 A;  4AX0 B;  4P62 A;  2BIB A;  1JT1 A;  1WUP A;  2YNU A;  4D1U A;  2YNT A;  5HH6 A;  3RPC A;  2Y87 A;  4UBQ A;  2BMI A;  2BG2 A;  5LE1 A;  4D1W A;  5LLD A;  3SW3 A;  3IE1 A;  1SML A;  2Q9U A;  2I7X A;  5HH5 A;  4JO0 A;  5EW0 A;  2FK6 A;  5ACX A;  3DH8 A;  1VJN A;  4WD6 A;  3T9M A;  1BC2 A;  3P2U A;  5KIL A;  1WW1 A;  2YNV A;  4TYT A;  3FCZ A;  4Z5Y A;  2WRS A;  5ACW A;  3X2Y A;  3IDZ A;  2BFK A;  4XWT A;  2XR1 A;  5FQA A;  2R2D A;  4NQ2 A;  4PVO A;  3SBL A;  1BVT A;  3KNR A;  3IOG A;  2M5C A;  2AZ4 A;  3PY6 A;  3WXC A;  4EFZ A;  3X2Z A;  3ESH A;  5EVK A;  3Q6V A;  5ACS A;  1QH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...