3Q6VA

Crystal structure of serratia fonticola sfh-i: glycerol complex
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
228
structure length
228
Chain Sequence
NLTLTHFKGPLYIVEDKEYVQENSMVYIGTDGITIIGATWTPETAETLYKEIRKVSPLPINEVINTNYHTDRAGGNAYWKTLGAKIVATQMTYDLQKSQWGSIVNFTRQGNNKYPNLEKSLPDTVFPGDFNLQNGSIRAMYLGEAHTKDGIFVYFPAERVLYGNCILKENLGNMSFANRTEYPKTLEKLKGLIEQGELKVDSIIAGHDTPIHDVGLIDHYLTLLEKAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Crystal Structure of Serratia fonticola Sfh-I: Activation of the Nucleophile in Mono-Zinc Metallo-beta-Lactamases
rcsb
source organism Serratia fonticola
total genus 80
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3q6vA00
4C1GA 2QEDA 1XM8A 4AWZA 2Q42A 4HKYA 2BG6A 5DPXA 1ZTCA 2BFLA 1QH3A 4FEKA 5IQKA 5LM6A 2YCBA 4NQ2A 4D1UA 2Y8BA 3IELA 3IOGA 2YNWA 4F6HA 1WRAA 2FU8A 5A87A 4TZFA 4U4LA 1JT1A 1ZKPA 5EV8A 5ACPA 2Y87A 2DKFA 3SBLA 5EHTA 2P1EA 4V0HA 2FK6A 3BC2A 4RM5A 2QDTA 3IDZA 2Q0JA 5EVDA 5A0TA 3VQZA 4ZEJA 2NYPA 1BC2A 4Z6XA 1VMEA 4BZ3A 4WD6A 3DHAA 2BFZB 4ZNBA 5K4NA 5KIKA 2GMNA 1KO2A 4EYBA 3QH8A 1JJTA 4RL0A 1L9YA 3S0ZA 2P18A 3AF6A 1BMCA 4YSLA 4JO0A 2ZZIA 2A7MA 4B87A 4NQ4A 2ZWRA 2BGAA 5HIPA 4RL2A 4TZBA 4D1VA 2WRSA 3IOFA 2NZFA 2BG8A 3A4YA 3IEMA 2I7VA 3X2XA 5HH6A 3IE1A 3VPEA 3BV6A 4RBSA 3I13A 2GFJA 4AWYB 2OHHA 4J5HA 1KO3A 2BTNA 2I7XA 4PVTA 3PG4A 5LCAA 4ZO2A 3DHBA 5ACTA 2OHIA 5ACXA 5ACWA 2AZ4A 3ZQ4A 2M5DA 2YZ3A 4UWPB 1DD6A 2WYMA 2GCUA 2VW8A 4C1EA 2BG2A 2Y8AA 3F9OA 5EH9A 3SFPA 4AX1B 4XUKA 1X8IA 1SMLA 2QINA 3WXCA 4RAMA 3KNSA 3ZWFA 4H0DA 3ADRA 5B15A 2Q9UA 3BK1A 5ACQA 5LE1A 4TYFA 5B1UA 4EYLA 3P2UA 1HLKA 2FM6A 1WUPA 4UAMA 4HL2A 1MQOA 4NQ5A 5FQCA 1DXKA 2BFKA 3RKJA 2BR6A 5AHRA 4UWSB 2BG8B 5AHOA 5EV6A 2P97A 2FU7A 3SPUA 3SD9A 2YNVA 2XF4A 5ACVA 5LMCA 3KNRA 3AF5A 4D1TA 5ACUA 4CHLA 2NZEA 5AXOA 3L6NA 5HISA 4FR7A 3X30A 2FHXA 3TP9A 5K0WA 4Z60A 3RKKA 2M5CA 1A8TA 5B3RA 2QJSA 1E5DA 4DIKA 4KEPA 2YNTA 3ZNBA 2H6AA 1QH5A 5LLDA 4YSKA 4O98A 4EXSA 1ZNBA 3FAIA 3SW3A 3R2UA 5HH4A 2P4ZA 1BVTA 3I15A 3IE0A 2R2DA 4AD9A 1YCHA 4Z5ZA 4FSBA 3T9MA 5ACRA 1JJEA 4PVOA 2Q0IA 2AIOA 4D1WA 5LSCA 2YNVB 1A7TA 5HIQA 3PY5A 2E7YA 2YNUA 4TZ9A 4AX0B 5AEBA 2GFKA 2HB9A 4EYFA 4UWOB 5A0VA 3KL7A 4RAWA 2DOOA 4XWWA 2WHGA 5A5ZA 4TYTA 3BK2A 5ACSA 3PY6A 1DDKA 5EWAA 4EFZA 3FCZA 1YCFA 1KR3A 2GKLA 5AXRA 3X2ZA 2YNTB 1XTOA 2BIBA 4F6ZA 5KILA 1K07A 5EVBA 5EVKA 1VGNA 4UA4A 4GCWA 1X8HA 2I7TA 2WYMC 5K4MA 2NXAA 4C1FA 5FQAA 1Y44A 3I0VA 1VJNA 2CBNA 3SRXA 5HH5A 3ZR9A 5LCHA 3I11A 1YCGA 4GYQA 4Z5YA 5K4KA 2BG7A 3DHCA 3T3OA 4HL1A 1M2XA 3RPCA 3IE2A 2BC2A 3LVZA 4EY2A 5HIOA 4C09A 4D02A 2UYXA 4DILA 4C1DA 4NQ6A 3ESHA 3AJ3A 4Z67A 4YSBA 3DH8A 4EXYA 3IEKA 4BP0A 2ZO4A 1P9EA 4GYUA 4KEQA 4C1CA 4LE6A 2XR1A 4TZEA 3T3NA 2ZNBA 3G1PA 5LCFA 3JXPA 3MD7A 4C1HA 1X8GA 2FU6A 4UBQA 2BFZA 5EW0A 5FQBA 1WUOA 3Q6VA 3H3EA 3X2YA 4UWRB 4Z7RA 5AYAA 4XWTA 2BMIA 2QDSA 2WYLA 3I14A 5LS3A 2FHXB 4ZO3A 2OHJA 4J5FA 1WW1A 4P62A 2FU9A
chains in the Genus database with same CATH superfamily
4C1GA 2QEDA 1XM8A 4AWZA 2Q42A 4HKYA 2BG6A 5DPXA 1ZTCA 2BFLA 1QH3A 4FEKA 5IQKA 5LM6A 2YCBA 4NQ2A 4D1UA 2Y8BA 3IELA 3IOGA 2YNWA 4F6HA 1WRAA 2FU8A 5A87A 4TZFA 4U4LA 1JT1A 1ZKPA 5EV8A 5ACPA 2Y87A 2DKFA 3SBLA 5EHTA 2P1EA 4V0HA 2FK6A 3BC2A 4RM5A 2QDTA 3IDZA 2Q0JA 5EVDA 5A0TA 3VQZA 4ZEJA 2NYPA 1BC2A 4Z6XA 1VMEA 4BZ3A 4WD6A 3DHAA 2BFZB 4ZNBA 5K4NA 5KIKA 2GMNA 1KO2A 4EYBA 3QH8A 1JJTA 4RL0A 1L9YA 3S0ZA 2P18A 3AF6A 1BMCA 4YSLA 4JO0A 2ZZIA 2A7MA 4B87A 4NQ4A 2ZWRA 2BGAA 5AJLA 5HIPA 4RL2A 4TZBA 4D1VA 4PDXA 2WRSA 3IOFA 2NZFA 2BG8A 3A4YA 3IEMA 4AV7A 2I7VA 3X2XA 5HH6A 3IE1A 3VPEA 3BV6A 2CFZA 4RBSA 3I13A 2GFJA 4AWYB 2OHHA 4J5HA 1KO3A 2BTNA 2I7XA 4PVTA 3PG4A 5LCAA 4ZO2A 3DHBA 5ACTA 2OHIA 5ACXA 5ACWA 2AZ4A 3ZQ4A 2M5DA 2YZ3A 4UWPB 1DD6A 2WYMA 2GCUA 2VW8A 4C1EA 2BG2A 2Y8AA 3F9OA 5EH9A 3SFPA 4AX1B 4XUKA 1X8IA 1SMLA 2QINA 3WXCA 4RAMA 3KNSA 3ZWFA 4H0DA 3ADRA 5B15A 2Q9UA 3BK1A 5ACQA 5LE1A 4TYFA 5B1UA 4EYLA 3P2UA 1HLKA 2FM6A 1WUPA 4UAMA 4HL2A 1MQOA 4NQ5A 5FQCA 1DXKA 2BFKA 3RKJA 2BR6A 5AHRA 4AXHA 4UWSB 2BG8B 5AHOA 5EV6A 2P97A 2FU7A 3SPUA 2CG2A 3SD9A 2YNVA 2XF4A 5ACVA 5LMCA 3KNRA 3AF5A 4D1TA 5ACUA 4CHLA 2NZEA 5AXOA 3L6NA 5HISA 4FR7A 3X30A 2FHXA 4NURA 3TP9A 5K0WA 4Z60A 3RKKA 2M5CA 1A8TA 5B3RA 2QJSA 1E5DA 4DIKA 4KEPA 2YNTA 3ZNBA 2H6AA 1QH5A 5LLDA 4YSKA 4O98A 4EXSA 1ZNBA 3FAIA 3SW3A 3R2UA 5HH4A 2P4ZA 2CFUA 1BVTA 3I15A 3IE0A 2R2DA 4AD9A 1YCHA 4Z5ZA 4FSBA 3T9MA 5ACRA 1JJEA 4PVOA 2Q0IA 2AIOA 4D1WA 5AIJA 5LSCA 2YNVB 1A7TA 5HIQA 3PY5A 2E7YA 2YNUA 4TZ9A 4AX0B 5AEBA 2GFKA 2HB9A 4EYFA 4UWOB 5A0VA 3KL7A 4RAWA 2DOOA 4XWWA 2WHGA 5A5ZA 4TYTA 3BK2A 5ACSA 2CG3A 3PY6A 1DDKA 5EWAA 4EFZA 2YHEA 3FCZA 1YCFA 1KR3A 2GKLA 5AXRA 3X2ZA 2YNTB 1XTOA 2BIBA 4F6ZA 5KILA 1K07A 5EVBA 5EVKA 1VGNA 4UA4A 4GCWA 1X8HA 2I7TA 2WYMC 5K4MA 2NXAA 4C1FA 5FQAA 1Y44A 3I0VA 1VJNA 2CBNA 3SRXA 5HH5A 3ZR9A 5LCHA 3I11A 1YCGA 4GYQA 4Z5YA 5K4KA 2BG7A 3DHCA 3T3OA 4HL1A 1M2XA 3RPCA 3IE2A 5A23A 2BC2A 3LVZA 4EY2A 5HIOA 4C09A 4D02A 2UYXA 4DILA 4C1DA 4NQ6A 3ESHA 3AJ3A 4Z67A 4YSBA 3DH8A 4EXYA 3IEKA 4BP0A 2ZO4A 1P9EA 4GYUA 4KEQA 4C1CA 4LE6A 2XR1A 4TZEA 3T3NA 2ZNBA 3G1PA 5LCFA 3JXPA 3MD7A 4C1HA 1X8GA 2FU6A 4UBQA 2BFZA 5EW0A 5FQBA 1WUOA 3Q6VA 3H3EA 3X2YA 4UWRB 4Z7RA 5AYAA 4XWTA 2BMIA 2QDSA 2WYLA 3I14A 5LS3A 2FHXB 4ZO3A 2OHJA 4J5FA 1WW1A 4P62A 2FU9A
chains in the Genus database with same CATH topology
4C1GA 2QEDA 1XM8A 4AWZA 2Q42A 4HKYA 2BG6A 5DPXA 1ZTCA 2BFLA 1QH3A 4FEKA 5IQKA 5LM6A 2YCBA 4NQ2A 4D1UA 2Y8BA 3IELA 3IOGA 2YNWA 4F6HA 1WRAA 2FU8A 5A87A 4TZFA 4U4LA 1JT1A 1ZKPA 5EV8A 5ACPA 2Y87A 2DKFA 3SBLA 5EHTA 2P1EA 4V0HA 2FK6A 3BC2A 4RM5A 2QDTA 3IDZA 2Q0JA 5EVDA 5A0TA 3VQZA 4ZEJA 2NYPA 1BC2A 4Z6XA 1VMEA 4BZ3A 4WD6A 3DHAA 2BFZB 4ZNBA 5K4NA 5KIKA 2GMNA 1KO2A 4EYBA 3QH8A 1JJTA 4RL0A 1L9YA 3S0ZA 2P18A 3AF6A 1BMCA 4YSLA 4JO0A 2ZZIA 2A7MA 4B87A 4NQ4A 2ZWRA 2BGAA 5HIPA 4RL2A 4TZBA 4D1VA 2WRSA 3IOFA 2NZFA 2BG8A 3A4YA 3IEMA 2I7VA 3X2XA 5HH6A 3IE1A 3VPEA 3BV6A 4RBSA 3I13A 2GFJA 4AWYB 2OHHA 4J5HA 1KO3A 2BTNA 2I7XA 4PVTA 3PG4A 5LCAA 4ZO2A 3DHBA 5ACTA 2OHIA 5ACXA 5ACWA 2AZ4A 3ZQ4A 2M5DA 2YZ3A 4UWPB 1DD6A 2WYMA 2GCUA 2VW8A 4C1EA 2BG2A 2Y8AA 3F9OA 5EH9A 3SFPA 4AX1B 4XUKA 1X8IA 1SMLA 2QINA 3WXCA 4RAMA 3KNSA 3ZWFA 4H0DA 3ADRA 5B15A 2Q9UA 3BK1A 5ACQA 5LE1A 4TYFA 5B1UA 4EYLA 3P2UA 1HLKA 2FM6A 1WUPA 4UAMA 4HL2A 1MQOA 4NQ5A 5FQCA 1DXKA 2BFKA 3RKJA 2BR6A 5AHRA 4UWSB 2BG8B 5AHOA 5EV6A 2P97A 2FU7A 3SPUA 3SD9A 2YNVA 2XF4A 5ACVA 5LMCA 3KNRA 3AF5A 4D1TA 5ACUA 4CHLA 2NZEA 5AXOA 3L6NA 5HISA 4FR7A 3X30A 2FHXA 3TP9A 5K0WA 4Z60A 3RKKA 2M5CA 1A8TA 5B3RA 2QJSA 1E5DA 4DIKA 4KEPA 2YNTA 3ZNBA 2H6AA 1QH5A 5LLDA 4YSKA 4O98A 4EXSA 1ZNBA 3FAIA 3SW3A 3R2UA 5HH4A 2P4ZA 1BVTA 3I15A 3IE0A 2R2DA 4AD9A 1YCHA 4Z5ZA 4FSBA 3T9MA 5ACRA 1JJEA 4PVOA 2Q0IA 2AIOA 4D1WA 5LSCA 2YNVB 1A7TA 5HIQA 3PY5A 2E7YA 2YNUA 4TZ9A 4AX0B 5AEBA 2GFKA 2HB9A 4EYFA 4UWOB 5A0VA 3KL7A 4RAWA 2DOOA 4XWWA 2WHGA 5A5ZA 4TYTA 3BK2A 5ACSA 3PY6A 1DDKA 5EWAA 4EFZA 3FCZA 1YCFA 1KR3A 2GKLA 5AXRA 3X2ZA 2YNTB 1XTOA 2BIBA 4F6ZA 5KILA 1K07A 5EVBA 5EVKA 1VGNA 4UA4A 4GCWA 1X8HA 2I7TA 2WYMC 5K4MA 2NXAA 4C1FA 5FQAA 1Y44A 3I0VA 1VJNA 2CBNA 3SRXA 5HH5A 3ZR9A 5LCHA 3I11A 1YCGA 4GYQA 4Z5YA 5K4KA 2BG7A 3DHCA 3T3OA 4HL1A 1M2XA 3RPCA 3IE2A 2BC2A 3LVZA 4EY2A 5HIOA 4C09A 4D02A 2UYXA 4DILA 4C1DA 4NQ6A 3ESHA 3AJ3A 4Z67A 4YSBA 3DH8A 4EXYA 3IEKA 4BP0A 2ZO4A 1P9EA 4GYUA 4KEQA 4C1CA 4LE6A 2XR1A 4TZEA 3T3NA 2ZNBA 3G1PA 5LCFA 3JXPA 3MD7A 4C1HA 1X8GA 2FU6A 4UBQA 2BFZA 5EW0A 5FQBA 1WUOA 3Q6VA 3H3EA 3X2YA 4UWRB 4Z7RA 5AYAA 4XWTA 2BMIA 2QDSA 2WYLA 3I14A 5LS3A 2FHXB 4ZO3A 2OHJA 4J5FA 1WW1A 4P62A 2FU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C1G A;  2QED A;  1XM8 A;  4AWZ A;  2Q42 A;  4HKY A;  2BG6 A;  5DPX A;  1ZTC A;  2BFL A;  1QH3 A;  4FEK A;  5IQK A;  5LM6 A;  2YCB A;  4NQ2 A;  4D1U A;  2Y8B A;  3IEL A;  3IOG A;  2YNW A;  4F6H A;  1WRA A;  2FU8 A;  5A87 A;  4TZF A;  4U4L A;  1JT1 A;  1ZKP A;  5EV8 A;  5ACP A;  2Y87 A;  2DKF A;  3SBL A;  5EHT A;  2P1E A;  4V0H A;  2FK6 A;  3BC2 A;  4RM5 A;  2QDT A;  3IDZ A;  2Q0J A;  5EVD A;  5A0T A;  3VQZ A;  4ZEJ A;  2NYP A;  1BC2 A;  4Z6X A;  1VME A;  4BZ3 A;  4WD6 A;  3DHA A;  2BFZ B;  4ZNB A;  5K4N A;  5KIK A;  2GMN A;  1KO2 A;  4EYB A;  3QH8 A;  1JJT A;  4RL0 A;  1L9Y A;  3S0Z A;  2P18 A;  3AF6 A;  1BMC A;  4YSL A;  4JO0 A;  2ZZI A;  2A7M A;  4B87 A;  4NQ4 A;  2ZWR A;  2BGA A;  5HIP A;  4RL2 A;  4TZB A;  4D1V A;  2WRS A;  3IOF A;  2NZF A;  2BG8 A;  3A4Y A;  3IEM A;  2I7V A;  3X2X A;  5HH6 A;  3IE1 A;  3VPE A;  3BV6 A;  4RBS A;  3I13 A;  2GFJ A;  4AWY B;  2OHH A;  4J5H A;  1KO3 A;  2BTN A;  2I7X A;  4PVT A;  3PG4 A;  5LCA A;  4ZO2 A;  3DHB A;  5ACT A;  2OHI A;  5ACX A;  5ACW A;  2AZ4 A;  3ZQ4 A;  2M5D A;  2YZ3 A;  4UWP B;  1DD6 A;  2WYM A;  2GCU A;  2VW8 A;  4C1E A;  2BG2 A;  2Y8A A;  3F9O A;  5EH9 A;  3SFP A;  4AX1 B;  4XUK A;  1X8I A;  1SML A;  2QIN A;  3WXC A;  4RAM A;  3KNS A;  3ZWF A;  4H0D A;  3ADR A;  5B15 A;  2Q9U A;  3BK1 A;  5ACQ A;  5LE1 A;  4TYF A;  5B1U A;  4EYL A;  3P2U A;  1HLK A;  2FM6 A;  1WUP A;  4UAM A;  4HL2 A;  1MQO A;  4NQ5 A;  5FQC A;  1DXK A;  2BFK A;  3RKJ A;  2BR6 A;  5AHR A;  4UWS B;  2BG8 B;  5AHO A;  5EV6 A;  2P97 A;  2FU7 A;  3SPU A;  3SD9 A;  2YNV A;  2XF4 A;  5ACV A;  5LMC A;  3KNR A;  3AF5 A;  4D1T A;  5ACU A;  4CHL A;  2NZE A;  5AXO A;  3L6N A;  5HIS A;  4FR7 A;  3X30 A;  2FHX A;  3TP9 A;  5K0W A;  4Z60 A;  3RKK A;  2M5C A;  1A8T A;  5B3R A;  2QJS A;  1E5D A;  4DIK A;  4KEP A;  2YNT A;  3ZNB A;  2H6A A;  1QH5 A;  5LLD A;  4YSK A;  4O98 A;  4EXS A;  1ZNB A;  3FAI A;  3SW3 A;  3R2U A;  5HH4 A;  2P4Z A;  1BVT A;  3I15 A;  3IE0 A;  2R2D A;  4AD9 A;  1YCH A;  4Z5Z A;  4FSB A;  3T9M A;  5ACR A;  1JJE A;  4PVO A;  2Q0I A;  2AIO A;  4D1W A;  5LSC A;  2YNV B;  1A7T A;  5HIQ A;  3PY5 A;  2E7Y A;  2YNU A;  4TZ9 A;  4AX0 B;  5AEB A;  2GFK A;  2HB9 A;  4EYF A;  4UWO B;  5A0V A;  3KL7 A;  4RAW A;  2DOO A;  4XWW A;  2WHG A;  5A5Z A;  4TYT A;  3BK2 A;  5ACS A;  3PY6 A;  1DDK A;  5EWA A;  4EFZ A;  3FCZ A;  1YCF A;  1KR3 A;  2GKL A;  5AXR A;  3X2Z A;  2YNT B;  1XTO A;  2BIB A;  4F6Z A;  5KIL A;  1K07 A;  5EVB A;  5EVK A;  1VGN A;  4UA4 A;  4GCW A;  1X8H A;  2I7T A;  2WYM C;  5K4M A;  2NXA A;  4C1F A;  5FQA A;  1Y44 A;  3I0V A;  1VJN A;  2CBN A;  3SRX A;  5HH5 A;  3ZR9 A;  5LCH A;  3I11 A;  1YCG A;  4GYQ A;  4Z5Y A;  5K4K A;  2BG7 A;  3DHC A;  3T3O A;  4HL1 A;  1M2X A;  3RPC A;  3IE2 A;  2BC2 A;  3LVZ A;  4EY2 A;  5HIO A;  4C09 A;  4D02 A;  2UYX A;  4DIL A;  4C1D A;  4NQ6 A;  3ESH A;  3AJ3 A;  4Z67 A;  4YSB A;  3DH8 A;  4EXY A;  3IEK A;  4BP0 A;  2ZO4 A;  1P9E A;  4GYU A;  4KEQ A;  4C1C A;  4LE6 A;  2XR1 A;  4TZE A;  3T3N A;  2ZNB A;  3G1P A;  5LCF A;  3JXP A;  3MD7 A;  4C1H A;  1X8G A;  2FU6 A;  4UBQ A;  2BFZ A;  5EW0 A;  5FQB A;  1WUO A;  3Q6V A;  3H3E A;  3X2Y A;  4UWR B;  4Z7R A;  5AYA A;  4XWT A;  2BMI A;  2QDS A;  2WYL A;  3I14 A;  5LS3 A;  2FHX B;  4ZO3 A;  2OHJ A;  4J5F A;  1WW1 A;  4P62 A;  2FU9 A; 
#chains in the Genus database with same CATH topology
 4C1G A;  2QED A;  1XM8 A;  4AWZ A;  2Q42 A;  4HKY A;  2BG6 A;  5DPX A;  1ZTC A;  2BFL A;  1QH3 A;  4FEK A;  5IQK A;  5LM6 A;  2YCB A;  4NQ2 A;  4D1U A;  2Y8B A;  3IEL A;  3IOG A;  2YNW A;  4F6H A;  1WRA A;  2FU8 A;  5A87 A;  4TZF A;  4U4L A;  1JT1 A;  1ZKP A;  5EV8 A;  5ACP A;  2Y87 A;  2DKF A;  3SBL A;  5EHT A;  2P1E A;  4V0H A;  2FK6 A;  3BC2 A;  4RM5 A;  2QDT A;  3IDZ A;  2Q0J A;  5EVD A;  5A0T A;  3VQZ A;  4ZEJ A;  2NYP A;  1BC2 A;  4Z6X A;  1VME A;  4BZ3 A;  4WD6 A;  3DHA A;  2BFZ B;  4ZNB A;  5K4N A;  5KIK A;  2GMN A;  1KO2 A;  4EYB A;  3QH8 A;  1JJT A;  4RL0 A;  1L9Y A;  3S0Z A;  2P18 A;  3AF6 A;  1BMC A;  4YSL A;  4JO0 A;  2ZZI A;  2A7M A;  4B87 A;  4NQ4 A;  2ZWR A;  2BGA A;  5AJL A;  5HIP A;  4RL2 A;  4TZB A;  4D1V A;  4PDX A;  2WRS A;  3IOF A;  2NZF A;  2BG8 A;  3A4Y A;  3IEM A;  4AV7 A;  2I7V A;  3X2X A;  5HH6 A;  3IE1 A;  3VPE A;  3BV6 A;  2CFZ A;  4RBS A;  3I13 A;  2GFJ A;  4AWY B;  2OHH A;  4J5H A;  1KO3 A;  2BTN A;  2I7X A;  4PVT A;  3PG4 A;  5LCA A;  4ZO2 A;  3DHB A;  5ACT A;  2OHI A;  5ACX A;  5ACW A;  2AZ4 A;  3ZQ4 A;  2M5D A;  2YZ3 A;  4UWP B;  1DD6 A;  2WYM A;  2GCU A;  2VW8 A;  4C1E A;  2BG2 A;  2Y8A A;  3F9O A;  5EH9 A;  3SFP A;  4AX1 B;  4XUK A;  1X8I A;  1SML A;  2QIN A;  3WXC A;  4RAM A;  3KNS A;  3ZWF A;  4H0D A;  3ADR A;  5B15 A;  2Q9U A;  3BK1 A;  5ACQ A;  5LE1 A;  4TYF A;  5B1U A;  4EYL A;  3P2U A;  1HLK A;  2FM6 A;  1WUP A;  4UAM A;  4HL2 A;  1MQO A;  4NQ5 A;  5FQC A;  1DXK A;  2BFK A;  3RKJ A;  2BR6 A;  5AHR A;  4AXH A;  4UWS B;  2BG8 B;  5AHO A;  5EV6 A;  2P97 A;  2FU7 A;  3SPU A;  2CG2 A;  3SD9 A;  2YNV A;  2XF4 A;  5ACV A;  5LMC A;  3KNR A;  3AF5 A;  4D1T A;  5ACU A;  4CHL A;  2NZE A;  5AXO A;  3L6N A;  5HIS A;  4FR7 A;  3X30 A;  2FHX A;  4NUR A;  3TP9 A;  5K0W A;  4Z60 A;  3RKK A;  2M5C A;  1A8T A;  5B3R A;  2QJS A;  1E5D A;  4DIK A;  4KEP A;  2YNT A;  3ZNB A;  2H6A A;  1QH5 A;  5LLD A;  4YSK A;  4O98 A;  4EXS A;  1ZNB A;  3FAI A;  3SW3 A;  3R2U A;  5HH4 A;  2P4Z A;  2CFU A;  1BVT A;  3I15 A;  3IE0 A;  2R2D A;  4AD9 A;  1YCH A;  4Z5Z A;  4FSB A;  3T9M A;  5ACR A;  1JJE A;  4PVO A;  2Q0I A;  2AIO A;  4D1W A;  5AIJ A;  5LSC A;  2YNV B;  1A7T A;  5HIQ A;  3PY5 A;  2E7Y A;  2YNU A;  4TZ9 A;  4AX0 B;  5AEB A;  2GFK A;  2HB9 A;  4EYF A;  4UWO B;  5A0V A;  3KL7 A;  4RAW A;  2DOO A;  4XWW A;  2WHG A;  5A5Z A;  4TYT A;  3BK2 A;  5ACS A;  2CG3 A;  3PY6 A;  1DDK A;  5EWA A;  4EFZ A;  2YHE A;  3FCZ A;  1YCF A;  1KR3 A;  2GKL A;  5AXR A;  3X2Z A;  2YNT B;  1XTO A;  2BIB A;  4F6Z A;  5KIL A;  1K07 A;  5EVB A;  5EVK A;  1VGN A;  4UA4 A;  4GCW A;  1X8H A;  2I7T A;  2WYM C;  5K4M A;  2NXA A;  4C1F A;  5FQA A;  1Y44 A;  3I0V A;  1VJN A;  2CBN A;  3SRX A;  5HH5 A;  3ZR9 A;  5LCH A;  3I11 A;  1YCG A;  4GYQ A;  4Z5Y A;  5K4K A;  2BG7 A;  3DHC A;  3T3O A;  4HL1 A;  1M2X A;  3RPC A;  3IE2 A;  5A23 A;  2BC2 A;  3LVZ A;  4EY2 A;  5HIO A;  4C09 A;  4D02 A;  2UYX A;  4DIL A;  4C1D A;  4NQ6 A;  3ESH A;  3AJ3 A;  4Z67 A;  4YSB A;  3DH8 A;  4EXY A;  3IEK A;  4BP0 A;  2ZO4 A;  1P9E A;  4GYU A;  4KEQ A;  4C1C A;  4LE6 A;  2XR1 A;  4TZE A;  3T3N A;  2ZNB A;  3G1P A;  5LCF A;  3JXP A;  3MD7 A;  4C1H A;  1X8G A;  2FU6 A;  4UBQ A;  2BFZ A;  5EW0 A;  5FQB A;  1WUO A;  3Q6V A;  3H3E A;  3X2Y A;  4UWR B;  4Z7R A;  5AYA A;  4XWT A;  2BMI A;  2QDS A;  2WYL A;  3I14 A;  5LS3 A;  2FHX B;  4ZO3 A;  2OHJ A;  4J5F A;  1WW1 A;  4P62 A;  2FU9 A; 
#chains in the Genus database with same CATH homology
 4C1G A;  2QED A;  1XM8 A;  4AWZ A;  2Q42 A;  4HKY A;  2BG6 A;  5DPX A;  1ZTC A;  2BFL A;  1QH3 A;  4FEK A;  5IQK A;  5LM6 A;  2YCB A;  4NQ2 A;  4D1U A;  2Y8B A;  3IEL A;  3IOG A;  2YNW A;  4F6H A;  1WRA A;  2FU8 A;  5A87 A;  4TZF A;  4U4L A;  1JT1 A;  1ZKP A;  5EV8 A;  5ACP A;  2Y87 A;  2DKF A;  3SBL A;  5EHT A;  2P1E A;  4V0H A;  2FK6 A;  3BC2 A;  4RM5 A;  2QDT A;  3IDZ A;  2Q0J A;  5EVD A;  5A0T A;  3VQZ A;  4ZEJ A;  2NYP A;  1BC2 A;  4Z6X A;  1VME A;  4BZ3 A;  4WD6 A;  3DHA A;  2BFZ B;  4ZNB A;  5K4N A;  5KIK A;  2GMN A;  1KO2 A;  4EYB A;  3QH8 A;  1JJT A;  4RL0 A;  1L9Y A;  3S0Z A;  2P18 A;  3AF6 A;  1BMC A;  4YSL A;  4JO0 A;  2ZZI A;  2A7M A;  4B87 A;  4NQ4 A;  2ZWR A;  2BGA A;  5HIP A;  4RL2 A;  4TZB A;  4D1V A;  2WRS A;  3IOF A;  2NZF A;  2BG8 A;  3A4Y A;  3IEM A;  2I7V A;  3X2X A;  5HH6 A;  3IE1 A;  3VPE A;  3BV6 A;  4RBS A;  3I13 A;  2GFJ A;  4AWY B;  2OHH A;  4J5H A;  1KO3 A;  2BTN A;  2I7X A;  4PVT A;  3PG4 A;  5LCA A;  4ZO2 A;  3DHB A;  5ACT A;  2OHI A;  5ACX A;  5ACW A;  2AZ4 A;  3ZQ4 A;  2M5D A;  2YZ3 A;  4UWP B;  1DD6 A;  2WYM A;  2GCU A;  2VW8 A;  4C1E A;  2BG2 A;  2Y8A A;  3F9O A;  5EH9 A;  3SFP A;  4AX1 B;  4XUK A;  1X8I A;  1SML A;  2QIN A;  3WXC A;  4RAM A;  3KNS A;  3ZWF A;  4H0D A;  3ADR A;  5B15 A;  2Q9U A;  3BK1 A;  5ACQ A;  5LE1 A;  4TYF A;  5B1U A;  4EYL A;  3P2U A;  1HLK A;  2FM6 A;  1WUP A;  4UAM A;  4HL2 A;  1MQO A;  4NQ5 A;  5FQC A;  1DXK A;  2BFK A;  3RKJ A;  2BR6 A;  5AHR A;  4UWS B;  2BG8 B;  5AHO A;  5EV6 A;  2P97 A;  2FU7 A;  3SPU A;  3SD9 A;  2YNV A;  2XF4 A;  5ACV A;  5LMC A;  3KNR A;  3AF5 A;  4D1T A;  5ACU A;  4CHL A;  2NZE A;  5AXO A;  3L6N A;  5HIS A;  4FR7 A;  3X30 A;  2FHX A;  3TP9 A;  5K0W A;  4Z60 A;  3RKK A;  2M5C A;  1A8T A;  5B3R A;  2QJS A;  1E5D A;  4DIK A;  4KEP A;  2YNT A;  3ZNB A;  2H6A A;  1QH5 A;  5LLD A;  4YSK A;  4O98 A;  4EXS A;  1ZNB A;  3FAI A;  3SW3 A;  3R2U A;  5HH4 A;  2P4Z A;  1BVT A;  3I15 A;  3IE0 A;  2R2D A;  4AD9 A;  1YCH A;  4Z5Z A;  4FSB A;  3T9M A;  5ACR A;  1JJE A;  4PVO A;  2Q0I A;  2AIO A;  4D1W A;  5LSC A;  2YNV B;  1A7T A;  5HIQ A;  3PY5 A;  2E7Y A;  2YNU A;  4TZ9 A;  4AX0 B;  5AEB A;  2GFK A;  2HB9 A;  4EYF A;  4UWO B;  5A0V A;  3KL7 A;  4RAW A;  2DOO A;  4XWW A;  2WHG A;  5A5Z A;  4TYT A;  3BK2 A;  5ACS A;  3PY6 A;  1DDK A;  5EWA A;  4EFZ A;  3FCZ A;  1YCF A;  1KR3 A;  2GKL A;  5AXR A;  3X2Z A;  2YNT B;  1XTO A;  2BIB A;  4F6Z A;  5KIL A;  1K07 A;  5EVB A;  5EVK A;  1VGN A;  4UA4 A;  4GCW A;  1X8H A;  2I7T A;  2WYM C;  5K4M A;  2NXA A;  4C1F A;  5FQA A;  1Y44 A;  3I0V A;  1VJN A;  2CBN A;  3SRX A;  5HH5 A;  3ZR9 A;  5LCH A;  3I11 A;  1YCG A;  4GYQ A;  4Z5Y A;  5K4K A;  2BG7 A;  3DHC A;  3T3O A;  4HL1 A;  1M2X A;  3RPC A;  3IE2 A;  2BC2 A;  3LVZ A;  4EY2 A;  5HIO A;  4C09 A;  4D02 A;  2UYX A;  4DIL A;  4C1D A;  4NQ6 A;  3ESH A;  3AJ3 A;  4Z67 A;  4YSB A;  3DH8 A;  4EXY A;  3IEK A;  4BP0 A;  2ZO4 A;  1P9E A;  4GYU A;  4KEQ A;  4C1C A;  4LE6 A;  2XR1 A;  4TZE A;  3T3N A;  2ZNB A;  3G1P A;  5LCF A;  3JXP A;  3MD7 A;  4C1H A;  1X8G A;  2FU6 A;  4UBQ A;  2BFZ A;  5EW0 A;  5FQB A;  1WUO A;  3Q6V A;  3H3E A;  3X2Y A;  4UWR B;  4Z7R A;  5AYA A;  4XWT A;  2BMI A;  2QDS A;  2WYL A;  3I14 A;  5LS3 A;  2FHX B;  4ZO3 A;  2OHJ A;  4J5F A;  1WW1 A;  4P62 A;  2FU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...