3Q6VA

Crystal structure of serratia fonticola sfh-i: glycerol complex
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
228
structure length
228
Chain Sequence
NLTLTHFKGPLYIVEDKEYVQENSMVYIGTDGITIIGATWTPETAETLYKEIRKVSPLPINEVINTNYHTDRAGGNAYWKTLGAKIVATQMTYDLQKSQWGSIVNFTRQGNNKYPNLEKSLPDTVFPGDFNLQNGSIRAMYLGEAHTKDGIFVYFPAERVLYGNCILKENLGNMSFANRTEYPKTLEKLKGLIEQGELKVDSIIAGHDTPIHDVGLIDHYLTLLEKAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Serratia fonticola Sfh-I: Activation of the Nucleophile in Mono-Zinc Metallo-beta-Lactamases
rcsb
source organism Serratia fonticola
molecule tags Hydrolase
molecule keywords Beta-lactamase
total genus 80
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3q6vA00
3S0ZA 1YCFA 5EW0A 3KNSA 4J5FA 2DOOA 4D1TA 2I7XA 5AHOA 5EH9A 2FU6A 4NQ6A 3VPEA 3BC2A 5B3RA 5EHTA 5FQCA 5LSCA 2UYXA 4C09A 1HLKA 5AYAA 3JXPA 3SRXA 5ACQA 1M2XA 1VJNA 3DHAA 3MD7A 5KILA 2CBNA 2FU8A 3T3OA 4UWPB 4ZO2A 4EXYA 2ZWRA 1JT1A 2NXAA 5LLDA 4BP0A 5FQAA 2AZ4A 4EXSA 3KNRA 3SFPA 4DIKA 1VMEA 2AIOA 3VQZA 4RAMA 4LE6A 5B15A 2M5CA 1K07A 3G1PA 3ZNBA 1DXKA 5KIKA 3TP9A 4EYLA 3X30A 4TYFA 4ZO3A 5LCAA 4C1HA 2YNTA 4AD9A 1JJEA 5K4MA 4V0HA 3X2XA 2WHGA 1QH5A 2OHHA 3IEKA 5ACVA 4AX1B 3IDZA 1WRAA 5EV6A 5A0VA 3RPCA 4Z60A 4AWYB 3WXCA 4KEPA 4P62A 3RKKA 2QEDA 2YNTB 5LMCA 3ESHA 1E5DA 3L6NA 1XM8A 2OHJA 4PVTA 4C1GA 2YNVB 1WW1A 1YCHA 4UWRB 3T3NA 5EVKA 3PG4A 5EWAA 2FHXB 3H3EA 5ACTA 3F9OA 2YNUA 3LVZA 5ACXA 2FHXA 4NQ5A 4FR7A 4XUKA 2BR6A 4CHLA 5DPXA 4TZFA 5HIPA 4Z7RA 4C1EA 5EVBA 2VW8A 5IQKA 1ZKPA 2BG8A 3IOGA 2A7MA 2HB9A 3ZWFA 4C1DA 5HIQA 4RM5A 1ZNBA 2DKFA 3I14A 2BG7A 2Y8BA 2YNWA 1QH3A 1XTOA 2Q9UA 5EV8A 1BVTA 2ZZIA 3DHBA 5AHRA 4O98A 2BG2A 3I13A 5HH5A 4EY2A 4AWZA 1A7TA 3ZQ4A 2QDSA 3PY5A 5HH6A 4Z67A 2GCUA 5ACPA 4UAMA 2Y8AA 2BG6A 4GYUA 2BC2A 5K4KA 3FCZA 3ZR9A 4Z5YA 3ADRA 1WUOA 2BFZA 4RL0A 2Y87A 3I15A 3X2ZA 2YCBA 3X2YA 1ZTCA 5HIOA 4DILA 5ACSA 4B87A 3BK2A 4UA4A 5LE1A 2BGAA 1X8GA 2GKLA 4D1WA 5B1UA 2WYMC 4RAWA 3PY6A 5ACWA 4XWTA 4BZ3A 1DDKA 4TZBA 2XR1A 5AEBA 5ACRA 1KO2A 3I11A 3AF6A 2NZEA 1KO3A 4TZEA 5LCHA 1A8TA 4UBQA 5K4NA 2Q0JA 5A0TA 3SD9A 5A5ZA 3QH8A 5HISA 4PVOA 2P4ZA 4D1VA 5A87A 2GFJA 3P2UA 2H6AA 3IELA 3DHCA 5HH4A 2WYLA 2BIBA 1Y44A 2BFZB 2QINA 2M5DA 4NQ2A 4D02A 2WRSA 4RBSA 4EFZA 2P18A 1KR3A 2QJSA 3IOFA 4HL1A 2I7VA 1X8IA 3SW3A 3Q6VA 2FM6A 4YSLA 2BMIA 1JJTA 1VGNA 1WUPA 2R2DA 4H0DA 1P9EA 2WYMA 4Z5ZA 2I7TA 4NQ4A 4FSBA 4J5HA 4U4LA 1BC2A 4FEKA 1SMLA 2FK6A 4EYFA 1MQOA 2YNVA 1L9YA 2OHIA 3DH8A 4TZ9A 3I0VA 4F6HA 4XWWA 4Z6XA 1X8HA 4UWSB 3KL7A 5FQBA 4WD6A 2GFKA 2BG8B 1BMCA 1YCGA 3IE1A 2BFKA 2ZO4A 2BTNA 4AX0B 4KEQA 3SBLA 4HL2A 3R2UA 2Q42A 3A4YA 4HKYA 2E7YA 4GCWA 2QDTA 3T9MA 4TYTA 4EYBA 2FU9A 4YSBA 3RKJA 4RL2A 4C1CA 5LM6A 3BV6A 4D1UA 2Q0IA 2BFLA 2NZFA 4ZNBA 5K0WA 5EVDA 4GYQA 5AXRA 4ZEJA 2FU7A 4C1FA 3BK1A 3IEMA 2GMNA 2ZNBA 2P97A 3FAIA 5ACUA 1DD6A 3AJ3A 3AF5A 4UWOB 4F6ZA 3IE2A 5LCFA 2NYPA 4JO0A 4YSKA 2P1EA 5AXOA 3SPUA 5LS3A 2YZ3A 3IE0A 2XF4A
chains in the Genus database with same CATH superfamily
3S0ZA 1YCFA 5EW0A 3KNSA 4J5FA 2DOOA 4D1TA 2I7XA 5AHOA 5EH9A 2FU6A 4NQ6A 3VPEA 3BC2A 5B3RA 5EHTA 5FQCA 5LSCA 2UYXA 4C09A 1HLKA 5AYAA 3JXPA 3SRXA 5ACQA 1M2XA 1VJNA 3DHAA 3MD7A 5KILA 2CBNA 2FU8A 3T3OA 4UWPB 4ZO2A 4EXYA 2ZWRA 1JT1A 2NXAA 5LLDA 4BP0A 5FQAA 2AZ4A 4EXSA 3KNRA 3SFPA 2CFUA 4DIKA 1VMEA 2AIOA 3VQZA 4RAMA 4LE6A 5B15A 2M5CA 1K07A 3G1PA 3ZNBA 1DXKA 5KIKA 3TP9A 4EYLA 3X30A 4TYFA 4ZO3A 5LCAA 4C1HA 2YNTA 4AD9A 1JJEA 5K4MA 4V0HA 3X2XA 2WHGA 1QH5A 2OHHA 3IEKA 5ACVA 4AX1B 3IDZA 1WRAA 5EV6A 5A0VA 3RPCA 4Z60A 4AWYB 3WXCA 4KEPA 4P62A 3RKKA 2QEDA 2YNTB 3ESHA 5LMCA 1E5DA 3L6NA 1XM8A 2OHJA 4PVTA 4C1GA 2YNVB 1WW1A 1YCHA 4UWRB 3T3NA 5EVKA 3PG4A 5EWAA 2FHXB 3H3EA 5ACTA 3F9OA 2YNUA 3LVZA 5ACXA 2FHXA 4NQ5A 5AJLA 4FR7A 4XUKA 2BR6A 4CHLA 5DPXA 4TZFA 5HIPA 4Z7RA 4C1EA 5EVBA 2VW8A 5IQKA 1ZKPA 2BG8A 3IOGA 2A7MA 2HB9A 3ZWFA 4C1DA 5HIQA 4RM5A 1ZNBA 2DKFA 3I14A 2BG7A 2Y8BA 2YNWA 1QH3A 4PDXA 1XTOA 2Q9UA 5EV8A 1BVTA 2ZZIA 3DHBA 5AHRA 4O98A 2BG2A 3I13A 5HH5A 4EY2A 4AWZA 1A7TA 3ZQ4A 2QDSA 3PY5A 5HH6A 5AIJA 4Z67A 2GCUA 5ACPA 4UAMA 2Y8AA 2BG6A 4GYUA 2BC2A 5K4KA 3FCZA 3ZR9A 4Z5YA 3ADRA 1WUOA 2BFZA 4RL0A 2YHEA 2Y87A 3I15A 3X2ZA 2YCBA 3X2YA 1ZTCA 2CG3A 5HIOA 4DILA 5ACSA 4B87A 3BK2A 4UA4A 5LE1A 2BGAA 1X8GA 2GKLA 4D1WA 5B1UA 2WYMC 4RAWA 3PY6A 5ACWA 4XWTA 4BZ3A 1DDKA 4TZBA 2XR1A 5AEBA 5ACRA 1KO2A 3I11A 3AF6A 2NZEA 1KO3A 4TZEA 5LCHA 1A8TA 4UBQA 5K4NA 2Q0JA 5A0TA 3SD9A 5A5ZA 3QH8A 5HISA 4PVOA 2P4ZA 4D1VA 5A87A 2GFJA 3P2UA 2H6AA 3IELA 3DHCA 5HH4A 2WYLA 2BIBA 1Y44A 2BFZB 2QINA 2M5DA 4NQ2A 4D02A 2WRSA 4RBSA 4EFZA 2P18A 1KR3A 2QJSA 4AXHA 2CFZA 3IOFA 4HL1A 2I7VA 1X8IA 3SW3A 3Q6VA 2FM6A 4YSLA 2BMIA 1JJTA 1VGNA 1WUPA 2R2DA 4H0DA 1P9EA 2WYMA 4Z5ZA 2I7TA 4NQ4A 4FSBA 4J5HA 4U4LA 1BC2A 4FEKA 1SMLA 2CG2A 2FK6A 4EYFA 1MQOA 2YNVA 1L9YA 2OHIA 3DH8A 4TZ9A 3I0VA 4F6HA 4XWWA 4Z6XA 4NURA 4AV7A 1X8HA 4UWSB 3KL7A 5FQBA 4WD6A 2GFKA 2BG8B 1BMCA 1YCGA 3IE1A 2BFKA 2ZO4A 2BTNA 4AX0B 4KEQA 3SBLA 4HL2A 3R2UA 2Q42A 3A4YA 4HKYA 2E7YA 4GCWA 2QDTA 3T9MA 4TYTA 4EYBA 2FU9A 4YSBA 5A23A 3RKJA 4RL2A 4C1CA 2BFLA 3BV6A 4D1UA 2Q0IA 5LM6A 2NZFA 4ZNBA 5K0WA 5EVDA 4GYQA 5AXRA 4ZEJA 4C1FA 2FU7A 3BK1A 3IEMA 2GMNA 2ZNBA 2P97A 3FAIA 5ACUA 1DD6A 3AJ3A 3AF5A 4UWOB 4F6ZA 3IE2A 5LCFA 2NYPA 4JO0A 4YSKA 2P1EA 5AXOA 3SPUA 5LS3A 2YZ3A 3IE0A 2XF4A
chains in the Genus database with same CATH topology
3S0ZA 1YCFA 5EW0A 3KNSA 4J5FA 2DOOA 4D1TA 2I7XA 5AHOA 5EH9A 2FU6A 4NQ6A 3VPEA 3BC2A 5B3RA 5EHTA 5FQCA 5LSCA 2UYXA 4C09A 1HLKA 5AYAA 3JXPA 3SRXA 5ACQA 1M2XA 1VJNA 3DHAA 3MD7A 5KILA 2CBNA 2FU8A 3T3OA 4UWPB 4ZO2A 4EXYA 2ZWRA 1JT1A 2NXAA 5LLDA 4BP0A 5FQAA 2AZ4A 4EXSA 3KNRA 3SFPA 4DIKA 1VMEA 2AIOA 3VQZA 4RAMA 4LE6A 5B15A 2M5CA 1K07A 3G1PA 3ZNBA 1DXKA 5KIKA 3TP9A 4EYLA 3X30A 4TYFA 4ZO3A 5LCAA 4C1HA 2YNTA 4AD9A 1JJEA 5K4MA 4V0HA 3X2XA 2WHGA 1QH5A 2OHHA 3IEKA 5ACVA 4AX1B 3IDZA 1WRAA 5EV6A 5A0VA 3RPCA 4Z60A 4AWYB 3WXCA 4KEPA 4P62A 3RKKA 2QEDA 2YNTB 5LMCA 3ESHA 1E5DA 3L6NA 1XM8A 2OHJA 4PVTA 4C1GA 2YNVB 1WW1A 1YCHA 4UWRB 3T3NA 5EVKA 3PG4A 5EWAA 2FHXB 3H3EA 5ACTA 3F9OA 2YNUA 3LVZA 5ACXA 2FHXA 4NQ5A 4FR7A 4XUKA 2BR6A 4CHLA 5DPXA 4TZFA 5HIPA 4Z7RA 4C1EA 5EVBA 2VW8A 5IQKA 1ZKPA 2BG8A 3IOGA 2A7MA 2HB9A 3ZWFA 4C1DA 5HIQA 4RM5A 1ZNBA 2DKFA 3I14A 2BG7A 2Y8BA 2YNWA 1QH3A 1XTOA 2Q9UA 5EV8A 1BVTA 2ZZIA 3DHBA 5AHRA 4O98A 2BG2A 3I13A 5HH5A 4EY2A 4AWZA 1A7TA 3ZQ4A 2QDSA 3PY5A 5HH6A 4Z67A 2GCUA 5ACPA 4UAMA 2Y8AA 2BG6A 4GYUA 2BC2A 5K4KA 3FCZA 3ZR9A 4Z5YA 3ADRA 1WUOA 2BFZA 4RL0A 2Y87A 3I15A 3X2ZA 2YCBA 3X2YA 1ZTCA 5HIOA 4DILA 5ACSA 4B87A 3BK2A 4UA4A 5LE1A 2BGAA 1X8GA 2GKLA 4D1WA 5B1UA 2WYMC 4RAWA 3PY6A 5ACWA 4XWTA 4BZ3A 1DDKA 4TZBA 2XR1A 5AEBA 5ACRA 1KO2A 3I11A 3AF6A 2NZEA 1KO3A 4TZEA 5LCHA 1A8TA 4UBQA 5K4NA 2Q0JA 5A0TA 3SD9A 5A5ZA 3QH8A 5HISA 4PVOA 2P4ZA 4D1VA 5A87A 2GFJA 3P2UA 2H6AA 3IELA 3DHCA 5HH4A 2WYLA 2BIBA 1Y44A 2BFZB 2QINA 2M5DA 4NQ2A 4D02A 2WRSA 4RBSA 4EFZA 2P18A 1KR3A 2QJSA 3IOFA 4HL1A 2I7VA 1X8IA 3SW3A 3Q6VA 2FM6A 4YSLA 2BMIA 1JJTA 1VGNA 1WUPA 2R2DA 4H0DA 1P9EA 2WYMA 4Z5ZA 2I7TA 4NQ4A 4FSBA 4J5HA 4U4LA 1BC2A 4FEKA 1SMLA 2FK6A 4EYFA 1MQOA 2YNVA 1L9YA 2OHIA 3DH8A 4TZ9A 3I0VA 4F6HA 4XWWA 4Z6XA 1X8HA 4UWSB 3KL7A 5FQBA 4WD6A 2GFKA 2BG8B 1BMCA 1YCGA 3IE1A 2BFKA 2ZO4A 2BTNA 4AX0B 4KEQA 3SBLA 4HL2A 3R2UA 2Q42A 3A4YA 4HKYA 2E7YA 4GCWA 2QDTA 3T9MA 4TYTA 4EYBA 2FU9A 4YSBA 3RKJA 4RL2A 4C1CA 5LM6A 3BV6A 4D1UA 2Q0IA 2BFLA 2NZFA 4ZNBA 5K0WA 5EVDA 4GYQA 5AXRA 4ZEJA 2FU7A 4C1FA 3BK1A 3IEMA 2GMNA 2ZNBA 2P97A 3FAIA 5ACUA 1DD6A 3AJ3A 3AF5A 4UWOB 4F6ZA 3IE2A 5LCFA 2NYPA 4JO0A 4YSKA 2P1EA 5AXOA 3SPUA 5LS3A 2YZ3A 3IE0A 2XF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S0Z A;  1YCF A;  5EW0 A;  3KNS A;  4J5F A;  2DOO A;  4D1T A;  2I7X A;  5AHO A;  5EH9 A;  2FU6 A;  4NQ6 A;  3VPE A;  3BC2 A;  5B3R A;  5EHT A;  5FQC A;  5LSC A;  2UYX A;  4C09 A;  1HLK A;  5AYA A;  3JXP A;  3SRX A;  5ACQ A;  1M2X A;  1VJN A;  3DHA A;  3MD7 A;  5KIL A;  2CBN A;  2FU8 A;  3T3O A;  4UWP B;  4ZO2 A;  4EXY A;  2ZWR A;  1JT1 A;  2NXA A;  5LLD A;  4BP0 A;  5FQA A;  2AZ4 A;  4EXS A;  3KNR A;  3SFP A;  4DIK A;  1VME A;  2AIO A;  3VQZ A;  4RAM A;  4LE6 A;  5B15 A;  2M5C A;  1K07 A;  3G1P A;  3ZNB A;  1DXK A;  5KIK A;  3TP9 A;  4EYL A;  3X30 A;  4TYF A;  4ZO3 A;  5LCA A;  4C1H A;  2YNT A;  4AD9 A;  1JJE A;  5K4M A;  4V0H A;  3X2X A;  2WHG A;  1QH5 A;  2OHH A;  3IEK A;  5ACV A;  4AX1 B;  3IDZ A;  1WRA A;  5EV6 A;  5A0V A;  3RPC A;  4Z60 A;  4AWY B;  3WXC A;  4KEP A;  4P62 A;  3RKK A;  2QED A;  2YNT B;  5LMC A;  3ESH A;  1E5D A;  3L6N A;  1XM8 A;  2OHJ A;  4PVT A;  4C1G A;  2YNV B;  1WW1 A;  1YCH A;  4UWR B;  3T3N A;  5EVK A;  3PG4 A;  5EWA A;  2FHX B;  3H3E A;  5ACT A;  3F9O A;  2YNU A;  3LVZ A;  5ACX A;  2FHX A;  4NQ5 A;  4FR7 A;  4XUK A;  2BR6 A;  4CHL A;  5DPX A;  4TZF A;  5HIP A;  4Z7R A;  4C1E A;  5EVB A;  2VW8 A;  5IQK A;  1ZKP A;  2BG8 A;  3IOG A;  2A7M A;  2HB9 A;  3ZWF A;  4C1D A;  5HIQ A;  4RM5 A;  1ZNB A;  2DKF A;  3I14 A;  2BG7 A;  2Y8B A;  2YNW A;  1QH3 A;  1XTO A;  2Q9U A;  5EV8 A;  1BVT A;  2ZZI A;  3DHB A;  5AHR A;  4O98 A;  2BG2 A;  3I13 A;  5HH5 A;  4EY2 A;  4AWZ A;  1A7T A;  3ZQ4 A;  2QDS A;  3PY5 A;  5HH6 A;  4Z67 A;  2GCU A;  5ACP A;  4UAM A;  2Y8A A;  2BG6 A;  4GYU A;  2BC2 A;  5K4K A;  3FCZ A;  3ZR9 A;  4Z5Y A;  3ADR A;  1WUO A;  2BFZ A;  4RL0 A;  2Y87 A;  3I15 A;  3X2Z A;  2YCB A;  3X2Y A;  1ZTC A;  5HIO A;  4DIL A;  5ACS A;  4B87 A;  3BK2 A;  4UA4 A;  5LE1 A;  2BGA A;  1X8G A;  2GKL A;  4D1W A;  5B1U A;  2WYM C;  4RAW A;  3PY6 A;  5ACW A;  4XWT A;  4BZ3 A;  1DDK A;  4TZB A;  2XR1 A;  5AEB A;  5ACR A;  1KO2 A;  3I11 A;  3AF6 A;  2NZE A;  1KO3 A;  4TZE A;  5LCH A;  1A8T A;  4UBQ A;  5K4N A;  2Q0J A;  5A0T A;  3SD9 A;  5A5Z A;  3QH8 A;  5HIS A;  4PVO A;  2P4Z A;  4D1V A;  5A87 A;  2GFJ A;  3P2U A;  2H6A A;  3IEL A;  3DHC A;  5HH4 A;  2WYL A;  2BIB A;  1Y44 A;  2BFZ B;  2QIN A;  2M5D A;  4NQ2 A;  4D02 A;  2WRS A;  4RBS A;  4EFZ A;  2P18 A;  1KR3 A;  2QJS A;  3IOF A;  4HL1 A;  2I7V A;  1X8I A;  3SW3 A;  3Q6V A;  2FM6 A;  4YSL A;  2BMI A;  1JJT A;  1VGN A;  1WUP A;  2R2D A;  4H0D A;  1P9E A;  2WYM A;  4Z5Z A;  2I7T A;  4NQ4 A;  4FSB A;  4J5H A;  4U4L A;  1BC2 A;  4FEK A;  1SML A;  2FK6 A;  4EYF A;  1MQO A;  2YNV A;  1L9Y A;  2OHI A;  3DH8 A;  4TZ9 A;  3I0V A;  4F6H A;  4XWW A;  4Z6X A;  1X8H A;  4UWS B;  3KL7 A;  5FQB A;  4WD6 A;  2GFK A;  2BG8 B;  1BMC A;  1YCG A;  3IE1 A;  2BFK A;  2ZO4 A;  2BTN A;  4AX0 B;  4KEQ A;  3SBL A;  4HL2 A;  3R2U A;  2Q42 A;  3A4Y A;  4HKY A;  2E7Y A;  4GCW A;  2QDT A;  3T9M A;  4TYT A;  4EYB A;  2FU9 A;  4YSB A;  3RKJ A;  4RL2 A;  4C1C A;  5LM6 A;  3BV6 A;  4D1U A;  2Q0I A;  2BFL A;  2NZF A;  4ZNB A;  5K0W A;  5EVD A;  4GYQ A;  5AXR A;  4ZEJ A;  2FU7 A;  4C1F A;  3BK1 A;  3IEM A;  2GMN A;  2ZNB A;  2P97 A;  3FAI A;  5ACU A;  1DD6 A;  3AJ3 A;  3AF5 A;  4UWO B;  4F6Z A;  3IE2 A;  5LCF A;  2NYP A;  4JO0 A;  4YSK A;  2P1E A;  5AXO A;  3SPU A;  5LS3 A;  2YZ3 A;  3IE0 A;  2XF4 A; 
#chains in the Genus database with same CATH topology
 3S0Z A;  1YCF A;  5EW0 A;  3KNS A;  4J5F A;  2DOO A;  4D1T A;  2I7X A;  5AHO A;  5EH9 A;  2FU6 A;  4NQ6 A;  3VPE A;  3BC2 A;  5B3R A;  5EHT A;  5FQC A;  5LSC A;  2UYX A;  4C09 A;  1HLK A;  5AYA A;  3JXP A;  3SRX A;  5ACQ A;  1M2X A;  1VJN A;  3DHA A;  3MD7 A;  5KIL A;  2CBN A;  2FU8 A;  3T3O A;  4UWP B;  4ZO2 A;  4EXY A;  2ZWR A;  1JT1 A;  2NXA A;  5LLD A;  4BP0 A;  5FQA A;  2AZ4 A;  4EXS A;  3KNR A;  3SFP A;  2CFU A;  4DIK A;  1VME A;  2AIO A;  3VQZ A;  4RAM A;  4LE6 A;  5B15 A;  2M5C A;  1K07 A;  3G1P A;  3ZNB A;  1DXK A;  5KIK A;  3TP9 A;  4EYL A;  3X30 A;  4TYF A;  4ZO3 A;  5LCA A;  4C1H A;  2YNT A;  4AD9 A;  1JJE A;  5K4M A;  4V0H A;  3X2X A;  2WHG A;  1QH5 A;  2OHH A;  3IEK A;  5ACV A;  4AX1 B;  3IDZ A;  1WRA A;  5EV6 A;  5A0V A;  3RPC A;  4Z60 A;  4AWY B;  3WXC A;  4KEP A;  4P62 A;  3RKK A;  2QED A;  2YNT B;  3ESH A;  5LMC A;  1E5D A;  3L6N A;  1XM8 A;  2OHJ A;  4PVT A;  4C1G A;  2YNV B;  1WW1 A;  1YCH A;  4UWR B;  3T3N A;  5EVK A;  3PG4 A;  5EWA A;  2FHX B;  3H3E A;  5ACT A;  3F9O A;  2YNU A;  3LVZ A;  5ACX A;  2FHX A;  4NQ5 A;  5AJL A;  4FR7 A;  4XUK A;  2BR6 A;  4CHL A;  5DPX A;  4TZF A;  5HIP A;  4Z7R A;  4C1E A;  5EVB A;  2VW8 A;  5IQK A;  1ZKP A;  2BG8 A;  3IOG A;  2A7M A;  2HB9 A;  3ZWF A;  4C1D A;  5HIQ A;  4RM5 A;  1ZNB A;  2DKF A;  3I14 A;  2BG7 A;  2Y8B A;  2YNW A;  1QH3 A;  4PDX A;  1XTO A;  2Q9U A;  5EV8 A;  1BVT A;  2ZZI A;  3DHB A;  5AHR A;  4O98 A;  2BG2 A;  3I13 A;  5HH5 A;  4EY2 A;  4AWZ A;  1A7T A;  3ZQ4 A;  2QDS A;  3PY5 A;  5HH6 A;  5AIJ A;  4Z67 A;  2GCU A;  5ACP A;  4UAM A;  2Y8A A;  2BG6 A;  4GYU A;  2BC2 A;  5K4K A;  3FCZ A;  3ZR9 A;  4Z5Y A;  3ADR A;  1WUO A;  2BFZ A;  4RL0 A;  2YHE A;  2Y87 A;  3I15 A;  3X2Z A;  2YCB A;  3X2Y A;  1ZTC A;  2CG3 A;  5HIO A;  4DIL A;  5ACS A;  4B87 A;  3BK2 A;  4UA4 A;  5LE1 A;  2BGA A;  1X8G A;  2GKL A;  4D1W A;  5B1U A;  2WYM C;  4RAW A;  3PY6 A;  5ACW A;  4XWT A;  4BZ3 A;  1DDK A;  4TZB A;  2XR1 A;  5AEB A;  5ACR A;  1KO2 A;  3I11 A;  3AF6 A;  2NZE A;  1KO3 A;  4TZE A;  5LCH A;  1A8T A;  4UBQ A;  5K4N A;  2Q0J A;  5A0T A;  3SD9 A;  5A5Z A;  3QH8 A;  5HIS A;  4PVO A;  2P4Z A;  4D1V A;  5A87 A;  2GFJ A;  3P2U A;  2H6A A;  3IEL A;  3DHC A;  5HH4 A;  2WYL A;  2BIB A;  1Y44 A;  2BFZ B;  2QIN A;  2M5D A;  4NQ2 A;  4D02 A;  2WRS A;  4RBS A;  4EFZ A;  2P18 A;  1KR3 A;  2QJS A;  4AXH A;  2CFZ A;  3IOF A;  4HL1 A;  2I7V A;  1X8I A;  3SW3 A;  3Q6V A;  2FM6 A;  4YSL A;  2BMI A;  1JJT A;  1VGN A;  1WUP A;  2R2D A;  4H0D A;  1P9E A;  2WYM A;  4Z5Z A;  2I7T A;  4NQ4 A;  4FSB A;  4J5H A;  4U4L A;  1BC2 A;  4FEK A;  1SML A;  2CG2 A;  2FK6 A;  4EYF A;  1MQO A;  2YNV A;  1L9Y A;  2OHI A;  3DH8 A;  4TZ9 A;  3I0V A;  4F6H A;  4XWW A;  4Z6X A;  4NUR A;  4AV7 A;  1X8H A;  4UWS B;  3KL7 A;  5FQB A;  4WD6 A;  2GFK A;  2BG8 B;  1BMC A;  1YCG A;  3IE1 A;  2BFK A;  2ZO4 A;  2BTN A;  4AX0 B;  4KEQ A;  3SBL A;  4HL2 A;  3R2U A;  2Q42 A;  3A4Y A;  4HKY A;  2E7Y A;  4GCW A;  2QDT A;  3T9M A;  4TYT A;  4EYB A;  2FU9 A;  4YSB A;  5A23 A;  3RKJ A;  4RL2 A;  4C1C A;  2BFL A;  3BV6 A;  4D1U A;  2Q0I A;  5LM6 A;  2NZF A;  4ZNB A;  5K0W A;  5EVD A;  4GYQ A;  5AXR A;  4ZEJ A;  4C1F A;  2FU7 A;  3BK1 A;  3IEM A;  2GMN A;  2ZNB A;  2P97 A;  3FAI A;  5ACU A;  1DD6 A;  3AJ3 A;  3AF5 A;  4UWO B;  4F6Z A;  3IE2 A;  5LCF A;  2NYP A;  4JO0 A;  4YSK A;  2P1E A;  5AXO A;  3SPU A;  5LS3 A;  2YZ3 A;  3IE0 A;  2XF4 A; 
#chains in the Genus database with same CATH homology
 3S0Z A;  1YCF A;  5EW0 A;  3KNS A;  4J5F A;  2DOO A;  4D1T A;  2I7X A;  5AHO A;  5EH9 A;  2FU6 A;  4NQ6 A;  3VPE A;  3BC2 A;  5B3R A;  5EHT A;  5FQC A;  5LSC A;  2UYX A;  4C09 A;  1HLK A;  5AYA A;  3JXP A;  3SRX A;  5ACQ A;  1M2X A;  1VJN A;  3DHA A;  3MD7 A;  5KIL A;  2CBN A;  2FU8 A;  3T3O A;  4UWP B;  4ZO2 A;  4EXY A;  2ZWR A;  1JT1 A;  2NXA A;  5LLD A;  4BP0 A;  5FQA A;  2AZ4 A;  4EXS A;  3KNR A;  3SFP A;  4DIK A;  1VME A;  2AIO A;  3VQZ A;  4RAM A;  4LE6 A;  5B15 A;  2M5C A;  1K07 A;  3G1P A;  3ZNB A;  1DXK A;  5KIK A;  3TP9 A;  4EYL A;  3X30 A;  4TYF A;  4ZO3 A;  5LCA A;  4C1H A;  2YNT A;  4AD9 A;  1JJE A;  5K4M A;  4V0H A;  3X2X A;  2WHG A;  1QH5 A;  2OHH A;  3IEK A;  5ACV A;  4AX1 B;  3IDZ A;  1WRA A;  5EV6 A;  5A0V A;  3RPC A;  4Z60 A;  4AWY B;  3WXC A;  4KEP A;  4P62 A;  3RKK A;  2QED A;  2YNT B;  5LMC A;  3ESH A;  1E5D A;  3L6N A;  1XM8 A;  2OHJ A;  4PVT A;  4C1G A;  2YNV B;  1WW1 A;  1YCH A;  4UWR B;  3T3N A;  5EVK A;  3PG4 A;  5EWA A;  2FHX B;  3H3E A;  5ACT A;  3F9O A;  2YNU A;  3LVZ A;  5ACX A;  2FHX A;  4NQ5 A;  4FR7 A;  4XUK A;  2BR6 A;  4CHL A;  5DPX A;  4TZF A;  5HIP A;  4Z7R A;  4C1E A;  5EVB A;  2VW8 A;  5IQK A;  1ZKP A;  2BG8 A;  3IOG A;  2A7M A;  2HB9 A;  3ZWF A;  4C1D A;  5HIQ A;  4RM5 A;  1ZNB A;  2DKF A;  3I14 A;  2BG7 A;  2Y8B A;  2YNW A;  1QH3 A;  1XTO A;  2Q9U A;  5EV8 A;  1BVT A;  2ZZI A;  3DHB A;  5AHR A;  4O98 A;  2BG2 A;  3I13 A;  5HH5 A;  4EY2 A;  4AWZ A;  1A7T A;  3ZQ4 A;  2QDS A;  3PY5 A;  5HH6 A;  4Z67 A;  2GCU A;  5ACP A;  4UAM A;  2Y8A A;  2BG6 A;  4GYU A;  2BC2 A;  5K4K A;  3FCZ A;  3ZR9 A;  4Z5Y A;  3ADR A;  1WUO A;  2BFZ A;  4RL0 A;  2Y87 A;  3I15 A;  3X2Z A;  2YCB A;  3X2Y A;  1ZTC A;  5HIO A;  4DIL A;  5ACS A;  4B87 A;  3BK2 A;  4UA4 A;  5LE1 A;  2BGA A;  1X8G A;  2GKL A;  4D1W A;  5B1U A;  2WYM C;  4RAW A;  3PY6 A;  5ACW A;  4XWT A;  4BZ3 A;  1DDK A;  4TZB A;  2XR1 A;  5AEB A;  5ACR A;  1KO2 A;  3I11 A;  3AF6 A;  2NZE A;  1KO3 A;  4TZE A;  5LCH A;  1A8T A;  4UBQ A;  5K4N A;  2Q0J A;  5A0T A;  3SD9 A;  5A5Z A;  3QH8 A;  5HIS A;  4PVO A;  2P4Z A;  4D1V A;  5A87 A;  2GFJ A;  3P2U A;  2H6A A;  3IEL A;  3DHC A;  5HH4 A;  2WYL A;  2BIB A;  1Y44 A;  2BFZ B;  2QIN A;  2M5D A;  4NQ2 A;  4D02 A;  2WRS A;  4RBS A;  4EFZ A;  2P18 A;  1KR3 A;  2QJS A;  3IOF A;  4HL1 A;  2I7V A;  1X8I A;  3SW3 A;  3Q6V A;  2FM6 A;  4YSL A;  2BMI A;  1JJT A;  1VGN A;  1WUP A;  2R2D A;  4H0D A;  1P9E A;  2WYM A;  4Z5Z A;  2I7T A;  4NQ4 A;  4FSB A;  4J5H A;  4U4L A;  1BC2 A;  4FEK A;  1SML A;  2FK6 A;  4EYF A;  1MQO A;  2YNV A;  1L9Y A;  2OHI A;  3DH8 A;  4TZ9 A;  3I0V A;  4F6H A;  4XWW A;  4Z6X A;  1X8H A;  4UWS B;  3KL7 A;  5FQB A;  4WD6 A;  2GFK A;  2BG8 B;  1BMC A;  1YCG A;  3IE1 A;  2BFK A;  2ZO4 A;  2BTN A;  4AX0 B;  4KEQ A;  3SBL A;  4HL2 A;  3R2U A;  2Q42 A;  3A4Y A;  4HKY A;  2E7Y A;  4GCW A;  2QDT A;  3T9M A;  4TYT A;  4EYB A;  2FU9 A;  4YSB A;  3RKJ A;  4RL2 A;  4C1C A;  5LM6 A;  3BV6 A;  4D1U A;  2Q0I A;  2BFL A;  2NZF A;  4ZNB A;  5K0W A;  5EVD A;  4GYQ A;  5AXR A;  4ZEJ A;  2FU7 A;  4C1F A;  3BK1 A;  3IEM A;  2GMN A;  2ZNB A;  2P97 A;  3FAI A;  5ACU A;  1DD6 A;  3AJ3 A;  3AF5 A;  4UWO B;  4F6Z A;  3IE2 A;  5LCF A;  2NYP A;  4JO0 A;  4YSK A;  2P1E A;  5AXO A;  3SPU A;  5LS3 A;  2YZ3 A;  3IE0 A;  2XF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...