1VGNA

Structure-based design of the irreversible inhibitors to metallo--lactamase (imp-1)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
217
structure length
217
Chain Sequence
LPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase IMP-1
publication title Irreversible Inhibition of Metallo-beta-lactamase (IMP-1) by 3-(3-Mercaptopropionylsulfanyl)propionic Acid Pentafluorophenyl Ester
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Hydrolase
total genus 65
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2004-04-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1vgnA00
5EW0A 2P1EA 1BVTA 5EVBA 2GMNA 3DHCA 2BFLA 4YSLA 3H3EA 4RM5A 3JXPA 3PY6A 4Z60A 4UWRB 3IE2A 5DPXA 5K4MA 3FAIA 4BP0A 2YNVB 2BG7A 1WUPA 2ZO4A 1VMEA 4EYBA 1X8GA 5ACTA 2DOOA 2H6AA 2Y8BA 2WYMC 3I11A 2BG8A 4V0HA 2YNUA 5A87A 1VJNA 5HH4A 4C1DA 2Q0IA 5A0TA 3Q6VA 4U4LA 2ZNBA 3PY5A 4C1GA 4TYTA 5HISA 5B15A 5ACSA 4AWZA 3IOGA 5AEBA 1ZKPA 2A7MA 2ZZIA 1YCGA 2YCBA 2E7YA 3L6NA 4AWYB 5LS3A 4UBQA 3S0ZA 4C1CA 5FQBA 4UAMA 4Z5YA 4DILA 5LLDA 2QDTA 3QH8A 4EY2A 2R2DA 3X30A 5LE1A 4HL2A 4D1VA 3IEMA 5LMCA 3IE1A 4LE6A 1BMCA 1DD6A 4PVOA 5EHTA 4NQ5A 3RPCA 4XWWA 2XR1A 3IOFA 4AD9A 4HKYA 3SRXA 2I7TA 2QEDA 1KO2A 4B87A 3ZWFA 4KEPA 5EH9A 1KO3A 3IDZA 3VPEA 2YNTB 4D1UA 3TP9A 4RL0A 4F6ZA 5A0VA 2YZ3A 4F6HA 2M5CA 4PVTA 5ACVA 2P97A 4H0DA 5HIPA 3I0VA 1MQOA 4RL2A 2QDSA 1YCFA 4XWTA 2BR6A 3ZR9A 2FU6A 4HL1A 4KEQA 2FU8A 5EVKA 3I13A 3IE0A 3P2UA 5ACRA 3X2YA 5HH6A 4UWSB 1HLKA 3FCZA 2I7VA 5AHOA 3DHAA 3BC2A 5ACPA 2OHIA 2QINA 2NZEA 4Z67A 4GYQA 2BGAA 1WRAA 3X2XA 2XF4A 2BC2A 3AF5A 2Q9UA 5ACQA 3KNRA 2FK6A 2BFZB 4Z7RA 2P18A 1WUOA 2GFJA 2M5DA 2BG2A 4FR7A 3MD7A 3F9OA 4TZBA 2FHXA 5KILA 2FU7A 5A5ZA 4CHLA 4D1TA 5K4NA 2BG8B 3ZNBA 4ZO2A 3SD9A 3KL7A 4P62A 1QH5A 1SMLA 4GYUA 2GCUA 4EYFA 2P4ZA 3A4YA 5FQCA 2HB9A 4EYLA 4DIKA 5K4KA 2Q0JA 2NYPA 2I7XA 1E5DA 4TZ9A 1JT1A 2GFKA 4UWPB 2BTNA 5FQAA 2AIOA 4FEKA 4C1HA 4GCWA 1DXKA 2QJSA 4ZEJA 4O98A 5KIKA 2UYXA 1Y44A 3SPUA 3LVZA 4C09A 5AYAA 1ZNBA 4UA4A 1YCHA 3IELA 4J5FA 3AJ3A 2Y8AA 2BIBA 1DDKA 3ZQ4A 4RBSA 4ZO3A 5LCHA 1QH3A 2Y87A 1XTOA 4JO0A 3I15A 3X2ZA 2YNVA 4YSBA 2ZWRA 4EXSA 3VQZA 3T3NA 3AF6A 3I14A 2BFKA 1ZTCA 4XUKA 4TZEA 2OHHA 2NZFA 4ZNBA 5EV8A 4EXYA 5B1UA 3T3OA 4NQ6A 1M2XA 2FM6A 3SBLA 5LCFA 2BFZA 1A8TA 4RAWA 5HH5A 3BV6A 3PG4A 3R2UA 5HIQA 3ADRA 4C1FA 2CBNA 5HIOA 5EWAA 4D1WA 1P9EA 3RKKA 4J5HA 2BG6A 3G1PA 3WXCA 4EFZA 2WHGA 1XM8A 5AXRA 2WYLA 2FU9A 1JJEA 5AHRA 5EV6A 5ACUA 4UWOB 5EVDA 3ESHA 5ACWA 3IEKA 1KR3A 2FHXB 4Z6XA 4BZ3A 3SFPA 2AZ4A 3RKJA 4Z5ZA 1L9YA 3DH8A 2YNWA 4NQ2A 4TZFA 5B3RA 2GKLA 2BMIA 2NXAA 4NQ4A 4YSKA 4RAMA 5LCAA 2YNTA 2WYMA 4AX0B 1X8IA 5LSCA 3T9MA 1WW1A 5IQKA 2Q42A 3BK2A 1K07A 4WD6A 5LM6A 3DHBA 4C1EA 1BC2A 3SW3A 1X8HA 4D02A 5K0WA 5AXOA 3KNSA 4FSBA 2DKFA 1VGNA 2WRSA 4AX1B 2OHJA 1JJTA 4TYFA 5ACXA 2VW8A 1A7TA 3BK1A
chains in the Genus database with same CATH superfamily
5EW0A 2P1EA 1BVTA 5EVBA 2GMNA 3DHCA 2BFLA 4YSLA 3H3EA 4RM5A 3JXPA 3PY6A 4Z60A 4UWRB 3IE2A 5DPXA 5K4MA 3FAIA 4BP0A 2YNVB 2BG7A 1WUPA 2ZO4A 1VMEA 4EYBA 1X8GA 5ACTA 2DOOA 2H6AA 2Y8BA 2WYMC 3I11A 2BG8A 4V0HA 2YNUA 5A87A 1VJNA 5HH4A 4C1DA 2Q0IA 5A0TA 3Q6VA 4U4LA 2ZNBA 3PY5A 4C1GA 4TYTA 5HISA 5B15A 5ACSA 4AWZA 3IOGA 5AEBA 1ZKPA 2A7MA 2ZZIA 1YCGA 2YCBA 2E7YA 3L6NA 4AWYB 5LS3A 4UBQA 3S0ZA 4C1CA 5FQBA 4UAMA 4Z5YA 4DILA 5LLDA 2QDTA 3QH8A 4EY2A 2R2DA 3X30A 5LE1A 4HL2A 4D1VA 3IEMA 5LMCA 3IE1A 4LE6A 1BMCA 1DD6A 4PVOA 5EHTA 4NQ5A 3RPCA 4XWWA 2XR1A 4PDXA 3IOFA 4AD9A 4HKYA 3SRXA 2I7TA 2QEDA 1KO2A 4B87A 3ZWFA 4KEPA 4AXHA 5EH9A 1KO3A 3IDZA 3VPEA 2YNTB 4D1UA 3TP9A 4RL0A 4F6ZA 5A0VA 2YZ3A 4F6HA 2M5CA 4PVTA 5ACVA 2P97A 4H0DA 5HIPA 3I0VA 1MQOA 4RL2A 2QDSA 4NURA 1YCFA 4XWTA 2BR6A 3ZR9A 2FU6A 4HL1A 4KEQA 2FU8A 5EVKA 3I13A 3IE0A 3P2UA 5ACRA 3X2YA 5HH6A 4UWSB 1HLKA 3FCZA 2I7VA 5AHOA 3DHAA 3BC2A 5ACPA 2OHIA 2QINA 2NZEA 4Z67A 4GYQA 4AV7A 2BGAA 1WRAA 3X2XA 2XF4A 2BC2A 3AF5A 2Q9UA 5ACQA 3KNRA 2FK6A 2BFZB 4Z7RA 2P18A 1WUOA 2GFJA 2M5DA 2BG2A 4FR7A 3MD7A 3F9OA 4TZBA 2FHXA 5KILA 2FU7A 5A5ZA 4CHLA 4D1TA 5K4NA 2BG8B 3ZNBA 4ZO2A 3SD9A 3KL7A 4P62A 1QH5A 1SMLA 4GYUA 2GCUA 4EYFA 2P4ZA 3A4YA 5FQCA 2HB9A 4EYLA 4DIKA 2CG2A 5K4KA 2Q0JA 2NYPA 2I7XA 1E5DA 4TZ9A 1JT1A 2GFKA 4UWPB 2BTNA 5FQAA 2AIOA 4FEKA 4C1HA 4GCWA 1DXKA 2QJSA 4ZEJA 4O98A 5KIKA 2UYXA 1Y44A 3SPUA 3LVZA 4C09A 5AYAA 1ZNBA 4UA4A 1YCHA 3IELA 4J5FA 3AJ3A 2Y8AA 2BIBA 1DDKA 3ZQ4A 4RBSA 4ZO3A 5LCHA 1QH3A 2Y87A 1XTOA 4JO0A 2CFZA 3I15A 3X2ZA 2YNVA 4YSBA 2ZWRA 4EXSA 3VQZA 3T3NA 3AF6A 3I14A 2BFKA 1ZTCA 4XUKA 4TZEA 2OHHA 2NZFA 4ZNBA 5EV8A 4EXYA 5B1UA 3T3OA 4NQ6A 1M2XA 2FM6A 3SBLA 5LCFA 2BFZA 1A8TA 4RAWA 5HH5A 3BV6A 3PG4A 3R2UA 5HIQA 3ADRA 4C1FA 2CBNA 5HIOA 5EWAA 4D1WA 1P9EA 5AJLA 3RKKA 4J5HA 2BG6A 3G1PA 3WXCA 4EFZA 2WHGA 1XM8A 5AXRA 2WYLA 2FU9A 1JJEA 2CG3A 5AHRA 5EV6A 5ACUA 4UWOB 5EVDA 3ESHA 5ACWA 3IEKA 1KR3A 2FHXB 4Z6XA 4BZ3A 3SFPA 2AZ4A 3RKJA 4Z5ZA 1L9YA 2CFUA 3DH8A 2YNWA 4NQ2A 5A23A 4TZFA 5B3RA 2GKLA 2BMIA 2NXAA 4NQ4A 4YSKA 4RAMA 5LCAA 2YNTA 2WYMA 4AX0B 1X8IA 5LSCA 3T9MA 2YHEA 1WW1A 5IQKA 2Q42A 3BK2A 1K07A 4WD6A 5LM6A 3DHBA 5AIJA 4C1EA 1BC2A 3SW3A 1X8HA 4D02A 5K0WA 5AXOA 3KNSA 4FSBA 2DKFA 1VGNA 2WRSA 4AX1B 2OHJA 1JJTA 4TYFA 5ACXA 2VW8A 1A7TA 3BK1A
chains in the Genus database with same CATH topology
5EW0A 2P1EA 1BVTA 5EVBA 2GMNA 3DHCA 2BFLA 4YSLA 3H3EA 4RM5A 3JXPA 3PY6A 4Z60A 4UWRB 3IE2A 5DPXA 5K4MA 3FAIA 4BP0A 2YNVB 2BG7A 1WUPA 2ZO4A 1VMEA 4EYBA 1X8GA 5ACTA 2DOOA 2H6AA 2Y8BA 2WYMC 3I11A 2BG8A 4V0HA 2YNUA 5A87A 1VJNA 5HH4A 4C1DA 2Q0IA 5A0TA 3Q6VA 4U4LA 2ZNBA 3PY5A 4C1GA 4TYTA 5HISA 5B15A 5ACSA 4AWZA 3IOGA 5AEBA 1ZKPA 2A7MA 2ZZIA 1YCGA 2YCBA 2E7YA 3L6NA 4AWYB 5LS3A 4UBQA 3S0ZA 4C1CA 5FQBA 4UAMA 4Z5YA 4DILA 5LLDA 2QDTA 3QH8A 4EY2A 2R2DA 3X30A 5LE1A 4HL2A 4D1VA 3IEMA 5LMCA 3IE1A 4LE6A 1BMCA 1DD6A 4PVOA 5EHTA 4NQ5A 3RPCA 4XWWA 2XR1A 3IOFA 4AD9A 4HKYA 3SRXA 2I7TA 2QEDA 1KO2A 4B87A 3ZWFA 4KEPA 5EH9A 1KO3A 3IDZA 3VPEA 2YNTB 4D1UA 3TP9A 4RL0A 4F6ZA 5A0VA 2YZ3A 4F6HA 2M5CA 4PVTA 5ACVA 2P97A 4H0DA 5HIPA 3I0VA 1MQOA 4RL2A 2QDSA 1YCFA 4XWTA 2BR6A 3ZR9A 2FU6A 4HL1A 4KEQA 2FU8A 5EVKA 3I13A 3IE0A 3P2UA 5ACRA 3X2YA 5HH6A 4UWSB 1HLKA 3FCZA 2I7VA 5AHOA 3DHAA 3BC2A 5ACPA 2OHIA 2QINA 2NZEA 4Z67A 4GYQA 2BGAA 1WRAA 3X2XA 2XF4A 2BC2A 3AF5A 2Q9UA 5ACQA 3KNRA 2FK6A 2BFZB 4Z7RA 2P18A 1WUOA 2GFJA 2M5DA 2BG2A 4FR7A 3MD7A 3F9OA 4TZBA 2FHXA 5KILA 2FU7A 5A5ZA 4CHLA 4D1TA 5K4NA 2BG8B 3ZNBA 4ZO2A 3SD9A 3KL7A 4P62A 1QH5A 1SMLA 4GYUA 2GCUA 4EYFA 2P4ZA 3A4YA 5FQCA 2HB9A 4EYLA 4DIKA 5K4KA 2Q0JA 2NYPA 2I7XA 1E5DA 4TZ9A 1JT1A 2GFKA 4UWPB 2BTNA 5FQAA 2AIOA 4FEKA 4C1HA 4GCWA 1DXKA 2QJSA 4ZEJA 4O98A 5KIKA 2UYXA 1Y44A 3SPUA 3LVZA 4C09A 5AYAA 1ZNBA 4UA4A 1YCHA 3IELA 4J5FA 3AJ3A 2Y8AA 2BIBA 1DDKA 3ZQ4A 4RBSA 4ZO3A 5LCHA 1QH3A 2Y87A 1XTOA 4JO0A 3I15A 3X2ZA 2YNVA 4YSBA 2ZWRA 4EXSA 3VQZA 3T3NA 3AF6A 3I14A 2BFKA 1ZTCA 4XUKA 4TZEA 2OHHA 2NZFA 4ZNBA 5EV8A 4EXYA 5B1UA 3T3OA 4NQ6A 1M2XA 2FM6A 3SBLA 5LCFA 2BFZA 1A8TA 4RAWA 5HH5A 3BV6A 3PG4A 3R2UA 5HIQA 3ADRA 4C1FA 2CBNA 5HIOA 5EWAA 4D1WA 1P9EA 3RKKA 4J5HA 2BG6A 3G1PA 3WXCA 4EFZA 2WHGA 1XM8A 5AXRA 2WYLA 2FU9A 1JJEA 5AHRA 5EV6A 5ACUA 4UWOB 5EVDA 3ESHA 5ACWA 3IEKA 1KR3A 2FHXB 4Z6XA 4BZ3A 3SFPA 2AZ4A 3RKJA 4Z5ZA 1L9YA 3DH8A 2YNWA 4NQ2A 4TZFA 5B3RA 2GKLA 2BMIA 2NXAA 4NQ4A 4YSKA 4RAMA 5LCAA 2YNTA 2WYMA 4AX0B 1X8IA 5LSCA 3T9MA 1WW1A 5IQKA 2Q42A 3BK2A 1K07A 4WD6A 5LM6A 3DHBA 4C1EA 1BC2A 3SW3A 1X8HA 4D02A 5K0WA 5AXOA 3KNSA 4FSBA 2DKFA 1VGNA 2WRSA 4AX1B 2OHJA 1JJTA 4TYFA 5ACXA 2VW8A 1A7TA 3BK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EW0 A;  2P1E A;  1BVT A;  5EVB A;  2GMN A;  3DHC A;  2BFL A;  4YSL A;  3H3E A;  4RM5 A;  3JXP A;  3PY6 A;  4Z60 A;  4UWR B;  3IE2 A;  5DPX A;  5K4M A;  3FAI A;  4BP0 A;  2YNV B;  2BG7 A;  1WUP A;  2ZO4 A;  1VME A;  4EYB A;  1X8G A;  5ACT A;  2DOO A;  2H6A A;  2Y8B A;  2WYM C;  3I11 A;  2BG8 A;  4V0H A;  2YNU A;  5A87 A;  1VJN A;  5HH4 A;  4C1D A;  2Q0I A;  5A0T A;  3Q6V A;  4U4L A;  2ZNB A;  3PY5 A;  4C1G A;  4TYT A;  5HIS A;  5B15 A;  5ACS A;  4AWZ A;  3IOG A;  5AEB A;  1ZKP A;  2A7M A;  2ZZI A;  1YCG A;  2YCB A;  2E7Y A;  3L6N A;  4AWY B;  5LS3 A;  4UBQ A;  3S0Z A;  4C1C A;  5FQB A;  4UAM A;  4Z5Y A;  4DIL A;  5LLD A;  2QDT A;  3QH8 A;  4EY2 A;  2R2D A;  3X30 A;  5LE1 A;  4HL2 A;  4D1V A;  3IEM A;  5LMC A;  3IE1 A;  4LE6 A;  1BMC A;  1DD6 A;  4PVO A;  5EHT A;  4NQ5 A;  3RPC A;  4XWW A;  2XR1 A;  3IOF A;  4AD9 A;  4HKY A;  3SRX A;  2I7T A;  2QED A;  1KO2 A;  4B87 A;  3ZWF A;  4KEP A;  5EH9 A;  1KO3 A;  3IDZ A;  3VPE A;  2YNT B;  4D1U A;  3TP9 A;  4RL0 A;  4F6Z A;  5A0V A;  2YZ3 A;  4F6H A;  2M5C A;  4PVT A;  5ACV A;  2P97 A;  4H0D A;  5HIP A;  3I0V A;  1MQO A;  4RL2 A;  2QDS A;  1YCF A;  4XWT A;  2BR6 A;  3ZR9 A;  2FU6 A;  4HL1 A;  4KEQ A;  2FU8 A;  5EVK A;  3I13 A;  3IE0 A;  3P2U A;  5ACR A;  3X2Y A;  5HH6 A;  4UWS B;  1HLK A;  3FCZ A;  2I7V A;  5AHO A;  3DHA A;  3BC2 A;  5ACP A;  2OHI A;  2QIN A;  2NZE A;  4Z67 A;  4GYQ A;  2BGA A;  1WRA A;  3X2X A;  2XF4 A;  2BC2 A;  3AF5 A;  2Q9U A;  5ACQ A;  3KNR A;  2FK6 A;  2BFZ B;  4Z7R A;  2P18 A;  1WUO A;  2GFJ A;  2M5D A;  2BG2 A;  4FR7 A;  3MD7 A;  3F9O A;  4TZB A;  2FHX A;  5KIL A;  2FU7 A;  5A5Z A;  4CHL A;  4D1T A;  5K4N A;  2BG8 B;  3ZNB A;  4ZO2 A;  3SD9 A;  3KL7 A;  4P62 A;  1QH5 A;  1SML A;  4GYU A;  2GCU A;  4EYF A;  2P4Z A;  3A4Y A;  5FQC A;  2HB9 A;  4EYL A;  4DIK A;  5K4K A;  2Q0J A;  2NYP A;  2I7X A;  1E5D A;  4TZ9 A;  1JT1 A;  2GFK A;  4UWP B;  2BTN A;  5FQA A;  2AIO A;  4FEK A;  4C1H A;  4GCW A;  1DXK A;  2QJS A;  4ZEJ A;  4O98 A;  5KIK A;  2UYX A;  1Y44 A;  3SPU A;  3LVZ A;  4C09 A;  5AYA A;  1ZNB A;  4UA4 A;  1YCH A;  3IEL A;  4J5F A;  3AJ3 A;  2Y8A A;  2BIB A;  1DDK A;  3ZQ4 A;  4RBS A;  4ZO3 A;  5LCH A;  1QH3 A;  2Y87 A;  1XTO A;  4JO0 A;  3I15 A;  3X2Z A;  2YNV A;  4YSB A;  2ZWR A;  4EXS A;  3VQZ A;  3T3N A;  3AF6 A;  3I14 A;  2BFK A;  1ZTC A;  4XUK A;  4TZE A;  2OHH A;  2NZF A;  4ZNB A;  5EV8 A;  4EXY A;  5B1U A;  3T3O A;  4NQ6 A;  1M2X A;  2FM6 A;  3SBL A;  5LCF A;  2BFZ A;  1A8T A;  4RAW A;  5HH5 A;  3BV6 A;  3PG4 A;  3R2U A;  5HIQ A;  3ADR A;  4C1F A;  2CBN A;  5HIO A;  5EWA A;  4D1W A;  1P9E A;  3RKK A;  4J5H A;  2BG6 A;  3G1P A;  3WXC A;  4EFZ A;  2WHG A;  1XM8 A;  5AXR A;  2WYL A;  2FU9 A;  1JJE A;  5AHR A;  5EV6 A;  5ACU A;  4UWO B;  5EVD A;  3ESH A;  5ACW A;  3IEK A;  1KR3 A;  2FHX B;  4Z6X A;  4BZ3 A;  3SFP A;  2AZ4 A;  3RKJ A;  4Z5Z A;  1L9Y A;  3DH8 A;  2YNW A;  4NQ2 A;  4TZF A;  5B3R A;  2GKL A;  2BMI A;  2NXA A;  4NQ4 A;  4YSK A;  4RAM A;  5LCA A;  2YNT A;  2WYM A;  4AX0 B;  1X8I A;  5LSC A;  3T9M A;  1WW1 A;  5IQK A;  2Q42 A;  3BK2 A;  1K07 A;  4WD6 A;  5LM6 A;  3DHB A;  4C1E A;  1BC2 A;  3SW3 A;  1X8H A;  4D02 A;  5K0W A;  5AXO A;  3KNS A;  4FSB A;  2DKF A;  1VGN A;  2WRS A;  4AX1 B;  2OHJ A;  1JJT A;  4TYF A;  5ACX A;  2VW8 A;  1A7T A;  3BK1 A; 
#chains in the Genus database with same CATH topology
 5EW0 A;  2P1E A;  1BVT A;  5EVB A;  2GMN A;  3DHC A;  2BFL A;  4YSL A;  3H3E A;  4RM5 A;  3JXP A;  3PY6 A;  4Z60 A;  4UWR B;  3IE2 A;  5DPX A;  5K4M A;  3FAI A;  4BP0 A;  2YNV B;  2BG7 A;  1WUP A;  2ZO4 A;  1VME A;  4EYB A;  1X8G A;  5ACT A;  2DOO A;  2H6A A;  2Y8B A;  2WYM C;  3I11 A;  2BG8 A;  4V0H A;  2YNU A;  5A87 A;  1VJN A;  5HH4 A;  4C1D A;  2Q0I A;  5A0T A;  3Q6V A;  4U4L A;  2ZNB A;  3PY5 A;  4C1G A;  4TYT A;  5HIS A;  5B15 A;  5ACS A;  4AWZ A;  3IOG A;  5AEB A;  1ZKP A;  2A7M A;  2ZZI A;  1YCG A;  2YCB A;  2E7Y A;  3L6N A;  4AWY B;  5LS3 A;  4UBQ A;  3S0Z A;  4C1C A;  5FQB A;  4UAM A;  4Z5Y A;  4DIL A;  5LLD A;  2QDT A;  3QH8 A;  4EY2 A;  2R2D A;  3X30 A;  5LE1 A;  4HL2 A;  4D1V A;  3IEM A;  5LMC A;  3IE1 A;  4LE6 A;  1BMC A;  1DD6 A;  4PVO A;  5EHT A;  4NQ5 A;  3RPC A;  4XWW A;  2XR1 A;  4PDX A;  3IOF A;  4AD9 A;  4HKY A;  3SRX A;  2I7T A;  2QED A;  1KO2 A;  4B87 A;  3ZWF A;  4KEP A;  4AXH A;  5EH9 A;  1KO3 A;  3IDZ A;  3VPE A;  2YNT B;  4D1U A;  3TP9 A;  4RL0 A;  4F6Z A;  5A0V A;  2YZ3 A;  4F6H A;  2M5C A;  4PVT A;  5ACV A;  2P97 A;  4H0D A;  5HIP A;  3I0V A;  1MQO A;  4RL2 A;  2QDS A;  4NUR A;  1YCF A;  4XWT A;  2BR6 A;  3ZR9 A;  2FU6 A;  4HL1 A;  4KEQ A;  2FU8 A;  5EVK A;  3I13 A;  3IE0 A;  3P2U A;  5ACR A;  3X2Y A;  5HH6 A;  4UWS B;  1HLK A;  3FCZ A;  2I7V A;  5AHO A;  3DHA A;  3BC2 A;  5ACP A;  2OHI A;  2QIN A;  2NZE A;  4Z67 A;  4GYQ A;  4AV7 A;  2BGA A;  1WRA A;  3X2X A;  2XF4 A;  2BC2 A;  3AF5 A;  2Q9U A;  5ACQ A;  3KNR A;  2FK6 A;  2BFZ B;  4Z7R A;  2P18 A;  1WUO A;  2GFJ A;  2M5D A;  2BG2 A;  4FR7 A;  3MD7 A;  3F9O A;  4TZB A;  2FHX A;  5KIL A;  2FU7 A;  5A5Z A;  4CHL A;  4D1T A;  5K4N A;  2BG8 B;  3ZNB A;  4ZO2 A;  3SD9 A;  3KL7 A;  4P62 A;  1QH5 A;  1SML A;  4GYU A;  2GCU A;  4EYF A;  2P4Z A;  3A4Y A;  5FQC A;  2HB9 A;  4EYL A;  4DIK A;  2CG2 A;  5K4K A;  2Q0J A;  2NYP A;  2I7X A;  1E5D A;  4TZ9 A;  1JT1 A;  2GFK A;  4UWP B;  2BTN A;  5FQA A;  2AIO A;  4FEK A;  4C1H A;  4GCW A;  1DXK A;  2QJS A;  4ZEJ A;  4O98 A;  5KIK A;  2UYX A;  1Y44 A;  3SPU A;  3LVZ A;  4C09 A;  5AYA A;  1ZNB A;  4UA4 A;  1YCH A;  3IEL A;  4J5F A;  3AJ3 A;  2Y8A A;  2BIB A;  1DDK A;  3ZQ4 A;  4RBS A;  4ZO3 A;  5LCH A;  1QH3 A;  2Y87 A;  1XTO A;  4JO0 A;  2CFZ A;  3I15 A;  3X2Z A;  2YNV A;  4YSB A;  2ZWR A;  4EXS A;  3VQZ A;  3T3N A;  3AF6 A;  3I14 A;  2BFK A;  1ZTC A;  4XUK A;  4TZE A;  2OHH A;  2NZF A;  4ZNB A;  5EV8 A;  4EXY A;  5B1U A;  3T3O A;  4NQ6 A;  1M2X A;  2FM6 A;  3SBL A;  5LCF A;  2BFZ A;  1A8T A;  4RAW A;  5HH5 A;  3BV6 A;  3PG4 A;  3R2U A;  5HIQ A;  3ADR A;  4C1F A;  2CBN A;  5HIO A;  5EWA A;  4D1W A;  1P9E A;  5AJL A;  3RKK A;  4J5H A;  2BG6 A;  3G1P A;  3WXC A;  4EFZ A;  2WHG A;  1XM8 A;  5AXR A;  2WYL A;  2FU9 A;  1JJE A;  2CG3 A;  5AHR A;  5EV6 A;  5ACU A;  4UWO B;  5EVD A;  3ESH A;  5ACW A;  3IEK A;  1KR3 A;  2FHX B;  4Z6X A;  4BZ3 A;  3SFP A;  2AZ4 A;  3RKJ A;  4Z5Z A;  1L9Y A;  2CFU A;  3DH8 A;  2YNW A;  4NQ2 A;  5A23 A;  4TZF A;  5B3R A;  2GKL A;  2BMI A;  2NXA A;  4NQ4 A;  4YSK A;  4RAM A;  5LCA A;  2YNT A;  2WYM A;  4AX0 B;  1X8I A;  5LSC A;  3T9M A;  2YHE A;  1WW1 A;  5IQK A;  2Q42 A;  3BK2 A;  1K07 A;  4WD6 A;  5LM6 A;  3DHB A;  5AIJ A;  4C1E A;  1BC2 A;  3SW3 A;  1X8H A;  4D02 A;  5K0W A;  5AXO A;  3KNS A;  4FSB A;  2DKF A;  1VGN A;  2WRS A;  4AX1 B;  2OHJ A;  1JJT A;  4TYF A;  5ACX A;  2VW8 A;  1A7T A;  3BK1 A; 
#chains in the Genus database with same CATH homology
 5EW0 A;  2P1E A;  1BVT A;  5EVB A;  2GMN A;  3DHC A;  2BFL A;  4YSL A;  3H3E A;  4RM5 A;  3JXP A;  3PY6 A;  4Z60 A;  4UWR B;  3IE2 A;  5DPX A;  5K4M A;  3FAI A;  4BP0 A;  2YNV B;  2BG7 A;  1WUP A;  2ZO4 A;  1VME A;  4EYB A;  1X8G A;  5ACT A;  2DOO A;  2H6A A;  2Y8B A;  2WYM C;  3I11 A;  2BG8 A;  4V0H A;  2YNU A;  5A87 A;  1VJN A;  5HH4 A;  4C1D A;  2Q0I A;  5A0T A;  3Q6V A;  4U4L A;  2ZNB A;  3PY5 A;  4C1G A;  4TYT A;  5HIS A;  5B15 A;  5ACS A;  4AWZ A;  3IOG A;  5AEB A;  1ZKP A;  2A7M A;  2ZZI A;  1YCG A;  2YCB A;  2E7Y A;  3L6N A;  4AWY B;  5LS3 A;  4UBQ A;  3S0Z A;  4C1C A;  5FQB A;  4UAM A;  4Z5Y A;  4DIL A;  5LLD A;  2QDT A;  3QH8 A;  4EY2 A;  2R2D A;  3X30 A;  5LE1 A;  4HL2 A;  4D1V A;  3IEM A;  5LMC A;  3IE1 A;  4LE6 A;  1BMC A;  1DD6 A;  4PVO A;  5EHT A;  4NQ5 A;  3RPC A;  4XWW A;  2XR1 A;  3IOF A;  4AD9 A;  4HKY A;  3SRX A;  2I7T A;  2QED A;  1KO2 A;  4B87 A;  3ZWF A;  4KEP A;  5EH9 A;  1KO3 A;  3IDZ A;  3VPE A;  2YNT B;  4D1U A;  3TP9 A;  4RL0 A;  4F6Z A;  5A0V A;  2YZ3 A;  4F6H A;  2M5C A;  4PVT A;  5ACV A;  2P97 A;  4H0D A;  5HIP A;  3I0V A;  1MQO A;  4RL2 A;  2QDS A;  1YCF A;  4XWT A;  2BR6 A;  3ZR9 A;  2FU6 A;  4HL1 A;  4KEQ A;  2FU8 A;  5EVK A;  3I13 A;  3IE0 A;  3P2U A;  5ACR A;  3X2Y A;  5HH6 A;  4UWS B;  1HLK A;  3FCZ A;  2I7V A;  5AHO A;  3DHA A;  3BC2 A;  5ACP A;  2OHI A;  2QIN A;  2NZE A;  4Z67 A;  4GYQ A;  2BGA A;  1WRA A;  3X2X A;  2XF4 A;  2BC2 A;  3AF5 A;  2Q9U A;  5ACQ A;  3KNR A;  2FK6 A;  2BFZ B;  4Z7R A;  2P18 A;  1WUO A;  2GFJ A;  2M5D A;  2BG2 A;  4FR7 A;  3MD7 A;  3F9O A;  4TZB A;  2FHX A;  5KIL A;  2FU7 A;  5A5Z A;  4CHL A;  4D1T A;  5K4N A;  2BG8 B;  3ZNB A;  4ZO2 A;  3SD9 A;  3KL7 A;  4P62 A;  1QH5 A;  1SML A;  4GYU A;  2GCU A;  4EYF A;  2P4Z A;  3A4Y A;  5FQC A;  2HB9 A;  4EYL A;  4DIK A;  5K4K A;  2Q0J A;  2NYP A;  2I7X A;  1E5D A;  4TZ9 A;  1JT1 A;  2GFK A;  4UWP B;  2BTN A;  5FQA A;  2AIO A;  4FEK A;  4C1H A;  4GCW A;  1DXK A;  2QJS A;  4ZEJ A;  4O98 A;  5KIK A;  2UYX A;  1Y44 A;  3SPU A;  3LVZ A;  4C09 A;  5AYA A;  1ZNB A;  4UA4 A;  1YCH A;  3IEL A;  4J5F A;  3AJ3 A;  2Y8A A;  2BIB A;  1DDK A;  3ZQ4 A;  4RBS A;  4ZO3 A;  5LCH A;  1QH3 A;  2Y87 A;  1XTO A;  4JO0 A;  3I15 A;  3X2Z A;  2YNV A;  4YSB A;  2ZWR A;  4EXS A;  3VQZ A;  3T3N A;  3AF6 A;  3I14 A;  2BFK A;  1ZTC A;  4XUK A;  4TZE A;  2OHH A;  2NZF A;  4ZNB A;  5EV8 A;  4EXY A;  5B1U A;  3T3O A;  4NQ6 A;  1M2X A;  2FM6 A;  3SBL A;  5LCF A;  2BFZ A;  1A8T A;  4RAW A;  5HH5 A;  3BV6 A;  3PG4 A;  3R2U A;  5HIQ A;  3ADR A;  4C1F A;  2CBN A;  5HIO A;  5EWA A;  4D1W A;  1P9E A;  3RKK A;  4J5H A;  2BG6 A;  3G1P A;  3WXC A;  4EFZ A;  2WHG A;  1XM8 A;  5AXR A;  2WYL A;  2FU9 A;  1JJE A;  5AHR A;  5EV6 A;  5ACU A;  4UWO B;  5EVD A;  3ESH A;  5ACW A;  3IEK A;  1KR3 A;  2FHX B;  4Z6X A;  4BZ3 A;  3SFP A;  2AZ4 A;  3RKJ A;  4Z5Z A;  1L9Y A;  3DH8 A;  2YNW A;  4NQ2 A;  4TZF A;  5B3R A;  2GKL A;  2BMI A;  2NXA A;  4NQ4 A;  4YSK A;  4RAM A;  5LCA A;  2YNT A;  2WYM A;  4AX0 B;  1X8I A;  5LSC A;  3T9M A;  1WW1 A;  5IQK A;  2Q42 A;  3BK2 A;  1K07 A;  4WD6 A;  5LM6 A;  3DHB A;  4C1E A;  1BC2 A;  3SW3 A;  1X8H A;  4D02 A;  5K0W A;  5AXO A;  3KNS A;  4FSB A;  2DKF A;  1VGN A;  2WRS A;  4AX1 B;  2OHJ A;  1JJT A;  4TYF A;  5ACX A;  2VW8 A;  1A7T A;  3BK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...