4AX0B

Q157a mutant. crystal structure of the mobile metallo-beta-lactamase aim-1 from pseudomonas aeruginosa: insights into antibiotic binding and the role of gln157
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
270
structure length
270
Chain Sequence
ASRGCADDAGWNDPAMPLKVYGNTWYVGTCGISALLVTSDAGHILVDAATPQAGPQILANIRALGFRPEDVRAIVFSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLPDRTDPAFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRSCEGDDCRQMVYADSLTAISDDVFRYSDDAAHPGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRIGPRAAAPLMDTTACRRYAQGARQRLEKRLAEEAATS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords METALLO-BETA-LACTAMASE AIM-1
publication title Crystal Structure of the Mobile Metallo-Beta-Lactamase Aim-1 from Pseudomonas Aeruginosa: Insights Into Antibiotic Binding and the Role of Gln157
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 92
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2012-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4ax0B00
2H6AA 3ESHA 1ZNBA 4V0HA 4PVTA 2QEDA 3T9MA 5EHTA 4UWRB 4UA4A 4TYTA 2Y87A 5K4KA 5A87A 2I7XA 3RKJA 5AXRA 3BV6A 1ZTCA 2OHJA 3IEKA 3SD9A 3TP9A 1BVTA 5HIQA 4BP0A 4FEKA 5EH9A 1M2XA 2A7MA 2CBNA 3BC2A 2QINA 1A7TA 4J5HA 3I13A 5KILA 2WYLA 1KO3A 3IEMA 4Z5ZA 3I15A 2BC2A 2BG8B 2NZFA 2XF4A 4C1GA 3AJ3A 2P4ZA 4BZ3A 1P9EA 5ACVA 5LCHA 4AX1B 3FAIA 3ZWFA 2DOOA 4O98A 2P97A 4AWZA 1XM8A 3RKKA 3SRXA 4J5FA 5B15A 2QDTA 5EVBA 2VW8A 4UWSB 4AWYB 2BFZA 3DHCA 3G1PA 5AYAA 3IE2A 3JXPA 4C09A 2GKLA 2GCUA 4WD6A 2YCBA 4KEQA 4C1FA 2FU6A 5HH6A 4AX0B 5HIPA 4D1UA 3ZNBA 4Z6XA 4JO0A 5EVDA 3KL7A 3IDZA 3I14A 5AHOA 3IOFA 3SFPA 2ZZIA 1SMLA 3R2UA 1WRAA 5AEBA 4C1EA 5ACXA 4D1WA 4Z60A 5ACWA 5A5ZA 1VMEA 4EY2A 3A4YA 4PVOA 4GCWA 5LLDA 5AHRA 4KEPA 2YZ3A 2GFJA 2BGAA 3AF6A 4NQ6A 3MD7A 3FCZA 4AD9A 3X2YA 1YCFA 2BIBA 4Z67A 2WHGA 3KNRA 3Q6VA 3T3OA 1A8TA 3SPUA 2HB9A 1BC2A 4U4LA 3H3EA 3ZQ4A 2BFZB 4RL2A 3I11A 2WRSA 3VQZA 4RL0A 5AXOA 5ACPA 2DKFA 2BFLA 1WUOA 4YSBA 4F6ZA 1QH5A 3F9OA 2OHHA 5FQCA 4XWWA 2BG2A 5IQKA 4ZNBA 4D1TA 1VGNA 4P62A 1YCHA 2M5CA 2R2DA 3IOGA 5EV6A 2I7VA 5HH5A 3I0VA 2QJSA 2WYMC 2Q0JA 3PY5A 5LE1A 5K4MA 4RAMA 4Z7RA 2BMIA 2BFKA 4EYLA 2XR1A 2ZNBA 3IELA 1WW1A 5EVKA 2Q9UA 2P1EA 3SW3A 3P2UA 2AIOA 2QDSA 2FU7A 4C1CA 1DD6A 4HKYA 3L6NA 2FM6A 2GMNA 5HH4A 3X2XA 4C1DA 2BG7A 1WUPA 5ACQA 5EW0A 3BK2A 4YSLA 4EXSA 3SBLA 1Y44A 5DPXA 4DIKA 5ACRA 4RAWA 1HLKA 2ZO4A 5K0WA 2Q42A 5LM6A 2OHIA 4EYBA 2NZEA 2I7TA 5KIKA 4H0DA 2YNTA 4Z5YA 3VPEA 1QH3A 2P18A 5A0VA 1X8GA 2FHXA 4D1VA 4RBSA 1JT1A 3WXCA 3S0ZA 2UYXA 3RPCA 3LVZA 2WYMA 1E5DA 4UWOB 2NXAA 2NYPA 3PY6A 2BG6A 4ZO3A 2YNVA 3DHAA 1JJTA 4TZ9A 1DDKA 1XTOA 5LCFA 3AF5A 4NQ4A 3BK1A 4UBQA 4F6HA 1ZKPA 3PG4A 3ADRA 4RM5A 5HIOA 4GYQA 4UWPB 1JJEA 1MQOA 4HL1A 5K4NA 3QH8A 1X8HA 4B87A 2YNWA 2GFKA 4FSBA 1YCGA 4EYFA 2BR6A 4CHLA 4TYFA 2AZ4A 2FU9A 2ZWRA 4XUKA 1L9YA 1X8IA 3IE0A 4NQ5A 1K07A 1DXKA 5A0TA 5FQAA 2YNTB 2Y8BA 4UAMA 4TZFA 5B3RA 2FHXB 4FR7A 1BMCA 4EFZA 4GYUA 2M5DA 5LCAA 3X30A 1KO2A 1VJNA 4NQ2A 2Y8AA 4EXYA 3KNSA 3DH8A 1KR3A 2YNVB 4YSKA 5ACUA 2Q0IA 5B1UA 5ACTA 4HL2A 5FQBA 5HISA 3IE1A 5LS3A 4XWTA 4DILA 5LMCA 4ZO2A 4ZEJA 2BG8A 4TZEA 2E7YA 2FU8A 3T3NA 5LSCA 2BTNA 4LE6A 3X2ZA 4D02A 5EWAA 4TZBA 3DHBA 2YNUA 2FK6A 5EV8A 4C1HA 3ZR9A 5ACSA
chains in the Genus database with same CATH superfamily
2H6AA 3ESHA 1ZNBA 4V0HA 4PVTA 4AV7A 2QEDA 3T9MA 5EHTA 4UWRB 4UA4A 4TYTA 2Y87A 5K4KA 2YHEA 5A87A 2I7XA 3RKJA 5AXRA 3BV6A 1ZTCA 2OHJA 3IEKA 3SD9A 3TP9A 1BVTA 4NURA 5HIQA 4BP0A 4FEKA 5EH9A 1M2XA 2A7MA 2CBNA 3BC2A 2QINA 1A7TA 4J5HA 3I13A 5KILA 2WYLA 1KO3A 3IEMA 4Z5ZA 3I15A 2BC2A 2BG8B 2NZFA 2XF4A 4C1GA 3AJ3A 2P4ZA 4BZ3A 1P9EA 5ACVA 5LCHA 4AX1B 3FAIA 3ZWFA 2DOOA 4O98A 2P97A 4AWZA 1XM8A 3RKKA 3SRXA 4J5FA 5B15A 2QDTA 5EVBA 2VW8A 4UWSB 4AWYB 5AJLA 2BFZA 3DHCA 3G1PA 5AYAA 3IE2A 3JXPA 4C09A 2GKLA 2GCUA 4WD6A 2YCBA 4KEQA 4C1FA 2FU6A 5HH6A 4AX0B 5HIPA 4D1UA 3ZNBA 4Z6XA 2CG3A 4JO0A 5EVDA 3KL7A 3IDZA 3I14A 5AHOA 3IOFA 3SFPA 2ZZIA 1SMLA 3R2UA 1WRAA 5AEBA 4C1EA 5ACXA 4D1WA 4Z60A 5ACWA 5A5ZA 1VMEA 4EY2A 3A4YA 4PVOA 4GCWA 5LLDA 5AHRA 4KEPA 2YZ3A 2GFJA 2BGAA 3AF6A 4NQ6A 3MD7A 3FCZA 4AD9A 3X2YA 1YCFA 2BIBA 4Z67A 2WHGA 3KNRA 3Q6VA 3T3OA 1A8TA 3SPUA 2HB9A 1BC2A 4U4LA 3H3EA 3ZQ4A 2BFZB 4RL2A 3I11A 2WRSA 3VQZA 4RL0A 5AXOA 5ACPA 2DKFA 2BFLA 1WUOA 4YSBA 4F6ZA 1QH5A 3F9OA 2CFZA 2OHHA 5FQCA 4XWWA 2BG2A 5IQKA 4ZNBA 4D1TA 1VGNA 4P62A 1YCHA 2M5CA 2R2DA 3IOGA 5EV6A 2I7VA 5HH5A 3I0VA 2QJSA 2WYMC 2Q0JA 3PY5A 5LE1A 5K4MA 4RAMA 4Z7RA 2BMIA 2CG2A 2BFKA 4EYLA 2XR1A 2ZNBA 3IELA 4AXHA 1WW1A 5EVKA 2Q9UA 2P1EA 3SW3A 3P2UA 2AIOA 2QDSA 2FU7A 4C1CA 1DD6A 4HKYA 3L6NA 2FM6A 2GMNA 5HH4A 3X2XA 4C1DA 2BG7A 1WUPA 5ACQA 5EW0A 3BK2A 4YSLA 4EXSA 3SBLA 1Y44A 5DPXA 4DIKA 5ACRA 4RAWA 1HLKA 2ZO4A 5K0WA 2Q42A 5LM6A 2OHIA 4EYBA 5AIJA 2NZEA 2I7TA 2CFUA 5KIKA 4H0DA 2YNTA 4Z5YA 3VPEA 1QH3A 2P18A 5A0VA 1X8GA 2FHXA 4D1VA 4RBSA 1JT1A 4PDXA 3WXCA 3S0ZA 2UYXA 3RPCA 3LVZA 2WYMA 1E5DA 4UWOB 2NXAA 2NYPA 3PY6A 2BG6A 4ZO3A 2YNVA 3DHAA 1JJTA 4TZ9A 1DDKA 1XTOA 5LCFA 3AF5A 4NQ4A 3BK1A 4UBQA 4F6HA 1ZKPA 3PG4A 3ADRA 4RM5A 5A23A 5HIOA 4GYQA 4UWPB 1JJEA 1MQOA 4HL1A 5K4NA 3QH8A 1X8HA 4B87A 2YNWA 2GFKA 4FSBA 1YCGA 4EYFA 2BR6A 4CHLA 4TYFA 2AZ4A 2FU9A 2ZWRA 4XUKA 1L9YA 1X8IA 3IE0A 4NQ5A 1K07A 1DXKA 5A0TA 5FQAA 2YNTB 2Y8BA 4UAMA 4TZFA 5B3RA 2FHXB 4FR7A 1BMCA 4EFZA 4GYUA 2M5DA 5LCAA 3X30A 1KO2A 1VJNA 4NQ2A 2Y8AA 4EXYA 3KNSA 3DH8A 1KR3A 2YNVB 4YSKA 5ACUA 2Q0IA 5B1UA 5ACTA 4HL2A 5FQBA 5HISA 3IE1A 5LS3A 4XWTA 4DILA 5LMCA 4ZO2A 4ZEJA 2BG8A 4TZEA 2E7YA 2FU8A 3T3NA 5LSCA 2BTNA 4LE6A 3X2ZA 4D02A 5EWAA 4TZBA 3DHBA 2YNUA 2FK6A 5EV8A 4C1HA 3ZR9A 5ACSA
chains in the Genus database with same CATH topology
2H6AA 3ESHA 1ZNBA 4V0HA 4PVTA 2QEDA 3T9MA 5EHTA 4UWRB 4UA4A 4TYTA 2Y87A 5K4KA 5A87A 2I7XA 3RKJA 5AXRA 3BV6A 1ZTCA 2OHJA 3IEKA 3SD9A 3TP9A 1BVTA 5HIQA 4BP0A 4FEKA 5EH9A 1M2XA 2A7MA 2CBNA 3BC2A 2QINA 1A7TA 4J5HA 3I13A 5KILA 2WYLA 1KO3A 3IEMA 4Z5ZA 3I15A 2BC2A 2BG8B 2NZFA 2XF4A 4C1GA 3AJ3A 2P4ZA 4BZ3A 1P9EA 5ACVA 5LCHA 4AX1B 3FAIA 3ZWFA 2DOOA 4O98A 2P97A 4AWZA 1XM8A 3RKKA 3SRXA 4J5FA 5B15A 2QDTA 5EVBA 2VW8A 4UWSB 4AWYB 2BFZA 3DHCA 3G1PA 5AYAA 3IE2A 3JXPA 4C09A 2GKLA 2GCUA 4WD6A 2YCBA 4KEQA 4C1FA 2FU6A 5HH6A 4AX0B 5HIPA 4D1UA 3ZNBA 4Z6XA 4JO0A 5EVDA 3KL7A 3IDZA 3I14A 5AHOA 3IOFA 3SFPA 2ZZIA 1SMLA 3R2UA 1WRAA 5AEBA 4C1EA 5ACXA 4D1WA 4Z60A 5ACWA 5A5ZA 1VMEA 4EY2A 3A4YA 4PVOA 4GCWA 5LLDA 5AHRA 4KEPA 2YZ3A 2GFJA 2BGAA 3AF6A 4NQ6A 3MD7A 3FCZA 4AD9A 3X2YA 1YCFA 2BIBA 4Z67A 2WHGA 3KNRA 3Q6VA 3T3OA 1A8TA 3SPUA 2HB9A 1BC2A 4U4LA 3H3EA 3ZQ4A 2BFZB 4RL2A 3I11A 2WRSA 3VQZA 4RL0A 5AXOA 5ACPA 2DKFA 2BFLA 1WUOA 4YSBA 4F6ZA 1QH5A 3F9OA 2OHHA 5FQCA 4XWWA 2BG2A 5IQKA 4ZNBA 4D1TA 1VGNA 4P62A 1YCHA 2M5CA 2R2DA 3IOGA 5EV6A 2I7VA 5HH5A 3I0VA 2QJSA 2WYMC 2Q0JA 3PY5A 5LE1A 5K4MA 4RAMA 4Z7RA 2BMIA 2BFKA 4EYLA 2XR1A 2ZNBA 3IELA 1WW1A 5EVKA 2Q9UA 2P1EA 3SW3A 3P2UA 2AIOA 2QDSA 2FU7A 4C1CA 1DD6A 4HKYA 3L6NA 2FM6A 2GMNA 5HH4A 3X2XA 4C1DA 2BG7A 1WUPA 5ACQA 5EW0A 3BK2A 4YSLA 4EXSA 3SBLA 1Y44A 5DPXA 4DIKA 5ACRA 4RAWA 1HLKA 2ZO4A 5K0WA 2Q42A 5LM6A 2OHIA 4EYBA 2NZEA 2I7TA 5KIKA 4H0DA 2YNTA 4Z5YA 3VPEA 1QH3A 2P18A 5A0VA 1X8GA 2FHXA 4D1VA 4RBSA 1JT1A 3WXCA 3S0ZA 2UYXA 3RPCA 3LVZA 2WYMA 1E5DA 4UWOB 2NXAA 2NYPA 3PY6A 2BG6A 4ZO3A 2YNVA 3DHAA 1JJTA 4TZ9A 1DDKA 1XTOA 5LCFA 3AF5A 4NQ4A 3BK1A 4UBQA 4F6HA 1ZKPA 3PG4A 3ADRA 4RM5A 5HIOA 4GYQA 4UWPB 1JJEA 1MQOA 4HL1A 5K4NA 3QH8A 1X8HA 4B87A 2YNWA 2GFKA 4FSBA 1YCGA 4EYFA 2BR6A 4CHLA 4TYFA 2AZ4A 2FU9A 2ZWRA 4XUKA 1L9YA 1X8IA 3IE0A 4NQ5A 1K07A 1DXKA 5A0TA 5FQAA 2YNTB 2Y8BA 4UAMA 4TZFA 5B3RA 2FHXB 4FR7A 1BMCA 4EFZA 4GYUA 2M5DA 5LCAA 3X30A 1KO2A 1VJNA 4NQ2A 2Y8AA 4EXYA 3KNSA 3DH8A 1KR3A 2YNVB 4YSKA 5ACUA 2Q0IA 5B1UA 5ACTA 4HL2A 5FQBA 5HISA 3IE1A 5LS3A 4XWTA 4DILA 5LMCA 4ZO2A 4ZEJA 2BG8A 4TZEA 2E7YA 2FU8A 3T3NA 5LSCA 2BTNA 4LE6A 3X2ZA 4D02A 5EWAA 4TZBA 3DHBA 2YNUA 2FK6A 5EV8A 4C1HA 3ZR9A 5ACSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H6A A;  3ESH A;  1ZNB A;  4V0H A;  4PVT A;  2QED A;  3T9M A;  5EHT A;  4UWR B;  4UA4 A;  4TYT A;  2Y87 A;  5K4K A;  5A87 A;  2I7X A;  3RKJ A;  5AXR A;  3BV6 A;  1ZTC A;  2OHJ A;  3IEK A;  3SD9 A;  3TP9 A;  1BVT A;  5HIQ A;  4BP0 A;  4FEK A;  5EH9 A;  1M2X A;  2A7M A;  2CBN A;  3BC2 A;  2QIN A;  1A7T A;  4J5H A;  3I13 A;  5KIL A;  2WYL A;  1KO3 A;  3IEM A;  4Z5Z A;  3I15 A;  2BC2 A;  2BG8 B;  2NZF A;  2XF4 A;  4C1G A;  3AJ3 A;  2P4Z A;  4BZ3 A;  1P9E A;  5ACV A;  5LCH A;  4AX1 B;  3FAI A;  3ZWF A;  2DOO A;  4O98 A;  2P97 A;  4AWZ A;  1XM8 A;  3RKK A;  3SRX A;  4J5F A;  5B15 A;  2QDT A;  5EVB A;  2VW8 A;  4UWS B;  4AWY B;  2BFZ A;  3DHC A;  3G1P A;  5AYA A;  3IE2 A;  3JXP A;  4C09 A;  2GKL A;  2GCU A;  4WD6 A;  2YCB A;  4KEQ A;  4C1F A;  2FU6 A;  5HH6 A;  4AX0 B;  5HIP A;  4D1U A;  3ZNB A;  4Z6X A;  4JO0 A;  5EVD A;  3KL7 A;  3IDZ A;  3I14 A;  5AHO A;  3IOF A;  3SFP A;  2ZZI A;  1SML A;  3R2U A;  1WRA A;  5AEB A;  4C1E A;  5ACX A;  4D1W A;  4Z60 A;  5ACW A;  5A5Z A;  1VME A;  4EY2 A;  3A4Y A;  4PVO A;  4GCW A;  5LLD A;  5AHR A;  4KEP A;  2YZ3 A;  2GFJ A;  2BGA A;  3AF6 A;  4NQ6 A;  3MD7 A;  3FCZ A;  4AD9 A;  3X2Y A;  1YCF A;  2BIB A;  4Z67 A;  2WHG A;  3KNR A;  3Q6V A;  3T3O A;  1A8T A;  3SPU A;  2HB9 A;  1BC2 A;  4U4L A;  3H3E A;  3ZQ4 A;  2BFZ B;  4RL2 A;  3I11 A;  2WRS A;  3VQZ A;  4RL0 A;  5AXO A;  5ACP A;  2DKF A;  2BFL A;  1WUO A;  4YSB A;  4F6Z A;  1QH5 A;  3F9O A;  2OHH A;  5FQC A;  4XWW A;  2BG2 A;  5IQK A;  4ZNB A;  4D1T A;  1VGN A;  4P62 A;  1YCH A;  2M5C A;  2R2D A;  3IOG A;  5EV6 A;  2I7V A;  5HH5 A;  3I0V A;  2QJS A;  2WYM C;  2Q0J A;  3PY5 A;  5LE1 A;  5K4M A;  4RAM A;  4Z7R A;  2BMI A;  2BFK A;  4EYL A;  2XR1 A;  2ZNB A;  3IEL A;  1WW1 A;  5EVK A;  2Q9U A;  2P1E A;  3SW3 A;  3P2U A;  2AIO A;  2QDS A;  2FU7 A;  4C1C A;  1DD6 A;  4HKY A;  3L6N A;  2FM6 A;  2GMN A;  5HH4 A;  3X2X A;  4C1D A;  2BG7 A;  1WUP A;  5ACQ A;  5EW0 A;  3BK2 A;  4YSL A;  4EXS A;  3SBL A;  1Y44 A;  5DPX A;  4DIK A;  5ACR A;  4RAW A;  1HLK A;  2ZO4 A;  5K0W A;  2Q42 A;  5LM6 A;  2OHI A;  4EYB A;  2NZE A;  2I7T A;  5KIK A;  4H0D A;  2YNT A;  4Z5Y A;  3VPE A;  1QH3 A;  2P18 A;  5A0V A;  1X8G A;  2FHX A;  4D1V A;  4RBS A;  1JT1 A;  3WXC A;  3S0Z A;  2UYX A;  3RPC A;  3LVZ A;  2WYM A;  1E5D A;  4UWO B;  2NXA A;  2NYP A;  3PY6 A;  2BG6 A;  4ZO3 A;  2YNV A;  3DHA A;  1JJT A;  4TZ9 A;  1DDK A;  1XTO A;  5LCF A;  3AF5 A;  4NQ4 A;  3BK1 A;  4UBQ A;  4F6H A;  1ZKP A;  3PG4 A;  3ADR A;  4RM5 A;  5HIO A;  4GYQ A;  4UWP B;  1JJE A;  1MQO A;  4HL1 A;  5K4N A;  3QH8 A;  1X8H A;  4B87 A;  2YNW A;  2GFK A;  4FSB A;  1YCG A;  4EYF A;  2BR6 A;  4CHL A;  4TYF A;  2AZ4 A;  2FU9 A;  2ZWR A;  4XUK A;  1L9Y A;  1X8I A;  3IE0 A;  4NQ5 A;  1K07 A;  1DXK A;  5A0T A;  5FQA A;  2YNT B;  2Y8B A;  4UAM A;  4TZF A;  5B3R A;  2FHX B;  4FR7 A;  1BMC A;  4EFZ A;  4GYU A;  2M5D A;  5LCA A;  3X30 A;  1KO2 A;  1VJN A;  4NQ2 A;  2Y8A A;  4EXY A;  3KNS A;  3DH8 A;  1KR3 A;  2YNV B;  4YSK A;  5ACU A;  2Q0I A;  5B1U A;  5ACT A;  4HL2 A;  5FQB A;  5HIS A;  3IE1 A;  5LS3 A;  4XWT A;  4DIL A;  5LMC A;  4ZO2 A;  4ZEJ A;  2BG8 A;  4TZE A;  2E7Y A;  2FU8 A;  3T3N A;  5LSC A;  2BTN A;  4LE6 A;  3X2Z A;  4D02 A;  5EWA A;  4TZB A;  3DHB A;  2YNU A;  2FK6 A;  5EV8 A;  4C1H A;  3ZR9 A;  5ACS A; 
#chains in the Genus database with same CATH topology
 2H6A A;  3ESH A;  1ZNB A;  4V0H A;  4PVT A;  4AV7 A;  2QED A;  3T9M A;  5EHT A;  4UWR B;  4UA4 A;  4TYT A;  2Y87 A;  5K4K A;  2YHE A;  5A87 A;  2I7X A;  3RKJ A;  5AXR A;  3BV6 A;  1ZTC A;  2OHJ A;  3IEK A;  3SD9 A;  3TP9 A;  1BVT A;  4NUR A;  5HIQ A;  4BP0 A;  4FEK A;  5EH9 A;  1M2X A;  2A7M A;  2CBN A;  3BC2 A;  2QIN A;  1A7T A;  4J5H A;  3I13 A;  5KIL A;  2WYL A;  1KO3 A;  3IEM A;  4Z5Z A;  3I15 A;  2BC2 A;  2BG8 B;  2NZF A;  2XF4 A;  4C1G A;  3AJ3 A;  2P4Z A;  4BZ3 A;  1P9E A;  5ACV A;  5LCH A;  4AX1 B;  3FAI A;  3ZWF A;  2DOO A;  4O98 A;  2P97 A;  4AWZ A;  1XM8 A;  3RKK A;  3SRX A;  4J5F A;  5B15 A;  2QDT A;  5EVB A;  2VW8 A;  4UWS B;  4AWY B;  5AJL A;  2BFZ A;  3DHC A;  3G1P A;  5AYA A;  3IE2 A;  3JXP A;  4C09 A;  2GKL A;  2GCU A;  4WD6 A;  2YCB A;  4KEQ A;  4C1F A;  2FU6 A;  5HH6 A;  4AX0 B;  5HIP A;  4D1U A;  3ZNB A;  4Z6X A;  2CG3 A;  4JO0 A;  5EVD A;  3KL7 A;  3IDZ A;  3I14 A;  5AHO A;  3IOF A;  3SFP A;  2ZZI A;  1SML A;  3R2U A;  1WRA A;  5AEB A;  4C1E A;  5ACX A;  4D1W A;  4Z60 A;  5ACW A;  5A5Z A;  1VME A;  4EY2 A;  3A4Y A;  4PVO A;  4GCW A;  5LLD A;  5AHR A;  4KEP A;  2YZ3 A;  2GFJ A;  2BGA A;  3AF6 A;  4NQ6 A;  3MD7 A;  3FCZ A;  4AD9 A;  3X2Y A;  1YCF A;  2BIB A;  4Z67 A;  2WHG A;  3KNR A;  3Q6V A;  3T3O A;  1A8T A;  3SPU A;  2HB9 A;  1BC2 A;  4U4L A;  3H3E A;  3ZQ4 A;  2BFZ B;  4RL2 A;  3I11 A;  2WRS A;  3VQZ A;  4RL0 A;  5AXO A;  5ACP A;  2DKF A;  2BFL A;  1WUO A;  4YSB A;  4F6Z A;  1QH5 A;  3F9O A;  2CFZ A;  2OHH A;  5FQC A;  4XWW A;  2BG2 A;  5IQK A;  4ZNB A;  4D1T A;  1VGN A;  4P62 A;  1YCH A;  2M5C A;  2R2D A;  3IOG A;  5EV6 A;  2I7V A;  5HH5 A;  3I0V A;  2QJS A;  2WYM C;  2Q0J A;  3PY5 A;  5LE1 A;  5K4M A;  4RAM A;  4Z7R A;  2BMI A;  2CG2 A;  2BFK A;  4EYL A;  2XR1 A;  2ZNB A;  3IEL A;  4AXH A;  1WW1 A;  5EVK A;  2Q9U A;  2P1E A;  3SW3 A;  3P2U A;  2AIO A;  2QDS A;  2FU7 A;  4C1C A;  1DD6 A;  4HKY A;  3L6N A;  2FM6 A;  2GMN A;  5HH4 A;  3X2X A;  4C1D A;  2BG7 A;  1WUP A;  5ACQ A;  5EW0 A;  3BK2 A;  4YSL A;  4EXS A;  3SBL A;  1Y44 A;  5DPX A;  4DIK A;  5ACR A;  4RAW A;  1HLK A;  2ZO4 A;  5K0W A;  2Q42 A;  5LM6 A;  2OHI A;  4EYB A;  5AIJ A;  2NZE A;  2I7T A;  2CFU A;  5KIK A;  4H0D A;  2YNT A;  4Z5Y A;  3VPE A;  1QH3 A;  2P18 A;  5A0V A;  1X8G A;  2FHX A;  4D1V A;  4RBS A;  1JT1 A;  4PDX A;  3WXC A;  3S0Z A;  2UYX A;  3RPC A;  3LVZ A;  2WYM A;  1E5D A;  4UWO B;  2NXA A;  2NYP A;  3PY6 A;  2BG6 A;  4ZO3 A;  2YNV A;  3DHA A;  1JJT A;  4TZ9 A;  1DDK A;  1XTO A;  5LCF A;  3AF5 A;  4NQ4 A;  3BK1 A;  4UBQ A;  4F6H A;  1ZKP A;  3PG4 A;  3ADR A;  4RM5 A;  5A23 A;  5HIO A;  4GYQ A;  4UWP B;  1JJE A;  1MQO A;  4HL1 A;  5K4N A;  3QH8 A;  1X8H A;  4B87 A;  2YNW A;  2GFK A;  4FSB A;  1YCG A;  4EYF A;  2BR6 A;  4CHL A;  4TYF A;  2AZ4 A;  2FU9 A;  2ZWR A;  4XUK A;  1L9Y A;  1X8I A;  3IE0 A;  4NQ5 A;  1K07 A;  1DXK A;  5A0T A;  5FQA A;  2YNT B;  2Y8B A;  4UAM A;  4TZF A;  5B3R A;  2FHX B;  4FR7 A;  1BMC A;  4EFZ A;  4GYU A;  2M5D A;  5LCA A;  3X30 A;  1KO2 A;  1VJN A;  4NQ2 A;  2Y8A A;  4EXY A;  3KNS A;  3DH8 A;  1KR3 A;  2YNV B;  4YSK A;  5ACU A;  2Q0I A;  5B1U A;  5ACT A;  4HL2 A;  5FQB A;  5HIS A;  3IE1 A;  5LS3 A;  4XWT A;  4DIL A;  5LMC A;  4ZO2 A;  4ZEJ A;  2BG8 A;  4TZE A;  2E7Y A;  2FU8 A;  3T3N A;  5LSC A;  2BTN A;  4LE6 A;  3X2Z A;  4D02 A;  5EWA A;  4TZB A;  3DHB A;  2YNU A;  2FK6 A;  5EV8 A;  4C1H A;  3ZR9 A;  5ACS A; 
#chains in the Genus database with same CATH homology
 2H6A A;  3ESH A;  1ZNB A;  4V0H A;  4PVT A;  2QED A;  3T9M A;  5EHT A;  4UWR B;  4UA4 A;  4TYT A;  2Y87 A;  5K4K A;  5A87 A;  2I7X A;  3RKJ A;  5AXR A;  3BV6 A;  1ZTC A;  2OHJ A;  3IEK A;  3SD9 A;  3TP9 A;  1BVT A;  5HIQ A;  4BP0 A;  4FEK A;  5EH9 A;  1M2X A;  2A7M A;  2CBN A;  3BC2 A;  2QIN A;  1A7T A;  4J5H A;  3I13 A;  5KIL A;  2WYL A;  1KO3 A;  3IEM A;  4Z5Z A;  3I15 A;  2BC2 A;  2BG8 B;  2NZF A;  2XF4 A;  4C1G A;  3AJ3 A;  2P4Z A;  4BZ3 A;  1P9E A;  5ACV A;  5LCH A;  4AX1 B;  3FAI A;  3ZWF A;  2DOO A;  4O98 A;  2P97 A;  4AWZ A;  1XM8 A;  3RKK A;  3SRX A;  4J5F A;  5B15 A;  2QDT A;  5EVB A;  2VW8 A;  4UWS B;  4AWY B;  2BFZ A;  3DHC A;  3G1P A;  5AYA A;  3IE2 A;  3JXP A;  4C09 A;  2GKL A;  2GCU A;  4WD6 A;  2YCB A;  4KEQ A;  4C1F A;  2FU6 A;  5HH6 A;  4AX0 B;  5HIP A;  4D1U A;  3ZNB A;  4Z6X A;  4JO0 A;  5EVD A;  3KL7 A;  3IDZ A;  3I14 A;  5AHO A;  3IOF A;  3SFP A;  2ZZI A;  1SML A;  3R2U A;  1WRA A;  5AEB A;  4C1E A;  5ACX A;  4D1W A;  4Z60 A;  5ACW A;  5A5Z A;  1VME A;  4EY2 A;  3A4Y A;  4PVO A;  4GCW A;  5LLD A;  5AHR A;  4KEP A;  2YZ3 A;  2GFJ A;  2BGA A;  3AF6 A;  4NQ6 A;  3MD7 A;  3FCZ A;  4AD9 A;  3X2Y A;  1YCF A;  2BIB A;  4Z67 A;  2WHG A;  3KNR A;  3Q6V A;  3T3O A;  1A8T A;  3SPU A;  2HB9 A;  1BC2 A;  4U4L A;  3H3E A;  3ZQ4 A;  2BFZ B;  4RL2 A;  3I11 A;  2WRS A;  3VQZ A;  4RL0 A;  5AXO A;  5ACP A;  2DKF A;  2BFL A;  1WUO A;  4YSB A;  4F6Z A;  1QH5 A;  3F9O A;  2OHH A;  5FQC A;  4XWW A;  2BG2 A;  5IQK A;  4ZNB A;  4D1T A;  1VGN A;  4P62 A;  1YCH A;  2M5C A;  2R2D A;  3IOG A;  5EV6 A;  2I7V A;  5HH5 A;  3I0V A;  2QJS A;  2WYM C;  2Q0J A;  3PY5 A;  5LE1 A;  5K4M A;  4RAM A;  4Z7R A;  2BMI A;  2BFK A;  4EYL A;  2XR1 A;  2ZNB A;  3IEL A;  1WW1 A;  5EVK A;  2Q9U A;  2P1E A;  3SW3 A;  3P2U A;  2AIO A;  2QDS A;  2FU7 A;  4C1C A;  1DD6 A;  4HKY A;  3L6N A;  2FM6 A;  2GMN A;  5HH4 A;  3X2X A;  4C1D A;  2BG7 A;  1WUP A;  5ACQ A;  5EW0 A;  3BK2 A;  4YSL A;  4EXS A;  3SBL A;  1Y44 A;  5DPX A;  4DIK A;  5ACR A;  4RAW A;  1HLK A;  2ZO4 A;  5K0W A;  2Q42 A;  5LM6 A;  2OHI A;  4EYB A;  2NZE A;  2I7T A;  5KIK A;  4H0D A;  2YNT A;  4Z5Y A;  3VPE A;  1QH3 A;  2P18 A;  5A0V A;  1X8G A;  2FHX A;  4D1V A;  4RBS A;  1JT1 A;  3WXC A;  3S0Z A;  2UYX A;  3RPC A;  3LVZ A;  2WYM A;  1E5D A;  4UWO B;  2NXA A;  2NYP A;  3PY6 A;  2BG6 A;  4ZO3 A;  2YNV A;  3DHA A;  1JJT A;  4TZ9 A;  1DDK A;  1XTO A;  5LCF A;  3AF5 A;  4NQ4 A;  3BK1 A;  4UBQ A;  4F6H A;  1ZKP A;  3PG4 A;  3ADR A;  4RM5 A;  5HIO A;  4GYQ A;  4UWP B;  1JJE A;  1MQO A;  4HL1 A;  5K4N A;  3QH8 A;  1X8H A;  4B87 A;  2YNW A;  2GFK A;  4FSB A;  1YCG A;  4EYF A;  2BR6 A;  4CHL A;  4TYF A;  2AZ4 A;  2FU9 A;  2ZWR A;  4XUK A;  1L9Y A;  1X8I A;  3IE0 A;  4NQ5 A;  1K07 A;  1DXK A;  5A0T A;  5FQA A;  2YNT B;  2Y8B A;  4UAM A;  4TZF A;  5B3R A;  2FHX B;  4FR7 A;  1BMC A;  4EFZ A;  4GYU A;  2M5D A;  5LCA A;  3X30 A;  1KO2 A;  1VJN A;  4NQ2 A;  2Y8A A;  4EXY A;  3KNS A;  3DH8 A;  1KR3 A;  2YNV B;  4YSK A;  5ACU A;  2Q0I A;  5B1U A;  5ACT A;  4HL2 A;  5FQB A;  5HIS A;  3IE1 A;  5LS3 A;  4XWT A;  4DIL A;  5LMC A;  4ZO2 A;  4ZEJ A;  2BG8 A;  4TZE A;  2E7Y A;  2FU8 A;  3T3N A;  5LSC A;  2BTN A;  4LE6 A;  3X2Z A;  4D02 A;  5EWA A;  4TZB A;  3DHB A;  2YNU A;  2FK6 A;  5EV8 A;  4C1H A;  3ZR9 A;  5ACS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...