4J5FA

Crystal structure of b. thuringiensis aiia mutant f107w
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
250
structure length
250
Chain Sequence
MTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHWDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIETEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A phenylalanine clamp controls substrate specificity in the quorum-quenching metallo-gamma-lactonase from Bacillus thuringiensis.
pubmed doi rcsb
source organism Bacillus thuringiensis
molecule tags Hydrolase
molecule keywords N-acyl homoserine lactonase
total genus 80
structure length 250
sequence length 250
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2013-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4j5fA01
4YSKA 4C1DA 2UYXA 2BG2A 2FU8A 3P2UA 5KILA 5AHOA 1JJEA 2HB9A 4AD9A 2ZO4A 2VW8A 5HH6A 1ZKPA 3DHAA 4V0HA 5EV6A 3X30A 1XTOA 4YSLA 1XM8A 4H0DA 5EH9A 2GMNA 2WYLA 1K07A 5K0WA 4XUKA 1WUPA 4AX0B 1WRAA 3WXCA 2AIOA 3H3EA 5LCFA 2DKFA 4F6HA 4GCWA 3TP9A 5AYAA 4D1UA 4EYLA 1DXKA 2FK6A 4D1WA 1BC2A 2R2DA 3IE0A 4RAMA 4D1TA 4ZEJA 5FQBA 1ZTCA 3R2UA 3I11A 1KO2A 3IEMA 5B15A 1YCGA 3FCZA 4UWRB 4J5FA 2QEDA 2GFJA 5HIQA 2Y8AA 4U4LA 2FHXA 1JT1A 1KO3A 3ADRA 5LS3A 4NQ6A 4TYFA 2YNWA 4AWYB 2I7XA 4ZO3A 5A0TA 3ESHA 5EVDA 5A87A 4EXSA 3FAIA 4FEKA 4Z5ZA 3ZWFA 3ZR9A 2FHXB 5EHTA 2XR1A 2BFKA 2BFZB 1VJNA 2BG8A 2Y8BA 4TYTA 3SPUA 3KNSA 4RL0A 4Z6XA 3X2YA 2FU7A 2P97A 2ZNBA 1A7TA 1VGNA 2WYMC 5B3RA 2I7VA 3IOGA 3ZNBA 4HL2A 3G1PA 1A8TA 2E7YA 3PY5A 4HKYA 4O98A 1QH3A 4FSBA 3RPCA 2OHIA 2NYPA 3I13A 4ZNBA 2H6AA 4GYQA 5A0VA 2NZEA 2I7TA 2WRSA 2Q42A 4DILA 3QH8A 5ACSA 4EFZA 5K4NA 3I0VA 1WW1A 3IEKA 2M5DA 5EVKA 3BC2A 4EYBA 4HL1A 2QJSA 3T3OA 4BZ3A 2BC2A 1QH5A 4ZO2A 1X8GA 4C1CA 4C1HA 5HIPA 3Q6VA 5ACTA 2ZZIA 3RKKA 3IOFA 2QINA 4KEQA 5AHRA 1MQOA 2P4ZA 2M5CA 2BFLA 2OHJA 2AZ4A 3DHBA 1YCFA 4PVOA 5LSCA 4BP0A 4NQ4A 3AF5A 4UWPB 3F9OA 2Q9UA 3KL7A 2YNTA 3DHCA 5K4KA 2P1EA 4P62A 5KIKA 4Z7RA 4D1VA 3JXPA 1DDKA 1L9YA 2FU9A 5LLDA 3SBLA 5A5ZA 3ZQ4A 2ZWRA 2BG8B 5ACQA 4EYFA 4EY2A 4GYUA 5FQAA 5ACUA 2P18A 3SD9A 2OHHA 4RM5A 4WD6A 2BGAA 4XWWA 5AXRA 2YCBA 4C1GA 4EXYA 3MD7A 4UA4A 5EVBA 1SMLA 5HH5A 2YNVB 1VMEA 2BTNA 5LCHA 3BK2A 5ACWA 5EV8A 3X2XA 2Y87A 4RAWA 5ACVA 2Q0IA 3IELA 1Y44A 4D02A 4JO0A 4TZBA 3T9MA 2Q0JA 4FR7A 5AEBA 2NZFA 3SRXA 5ACRA 3I15A 2YNTB 3SW3A 4YSBA 2BG6A 2QDSA 5LCAA 1DD6A 4TZ9A 4J5HA 4RBSA 5ACPA 3IE1A 5IQKA 4C1EA 5HISA 2BR6A 5HIOA 3IDZA 2DOOA 2GFKA 4LE6A 3KNRA 4UAMA 3DH8A 4DIKA 4NQ2A 3SFPA 3VQZA 2GCUA 2YNUA 3PY6A 4CHLA 5LE1A 3PG4A 2QDTA 3X2ZA 3RKJA 4UWSB 4Z60A 2WYMA 1WUOA 2CBNA 2YZ3A 1BVTA 3L6NA 4UWOB 4PVTA 1M2XA 5LMCA 3IE2A 1KR3A 2YNVA 2FU6A 4Z5YA 4Z67A 3AJ3A 5EW0A 4C1FA 2A7MA 4B87A 5K4MA 3AF6A 2NXAA 3A4YA 4TZFA 4RL2A 4XWTA 5AXOA 2XF4A 3VPEA 2GKLA 2BMIA 1JJTA 5DPXA 1P9EA 3BV6A 3LVZA 5HH4A 4KEPA 1X8IA 5FQCA 4TZEA 5LM6A 4F6ZA 2FM6A 4UBQA 5EWAA 4AX1B 1E5DA 3BK1A 1YCHA 1HLKA 1X8HA 4NQ5A 5B1UA 3S0ZA 1BMCA 2BFZA 1ZNBA 2BIBA 2BG7A 2WHGA 3I14A 5ACXA 4C09A 3T3NA 4AWZA
chains in the Genus database with same CATH superfamily
4YSKA 4C1DA 2UYXA 2BG2A 2FU8A 3P2UA 5KILA 5AHOA 1JJEA 2HB9A 4AD9A 2ZO4A 2VW8A 5HH6A 1ZKPA 3DHAA 4V0HA 5EV6A 3X30A 1XTOA 4YSLA 1XM8A 4H0DA 5EH9A 2GMNA 2WYLA 1K07A 5K0WA 4XUKA 1WUPA 4AX0B 1WRAA 3WXCA 2AIOA 3H3EA 5LCFA 2DKFA 4F6HA 4GCWA 3TP9A 5AYAA 4D1UA 4EYLA 1DXKA 2CFZA 2FK6A 4D1WA 1BC2A 2R2DA 3IE0A 4RAMA 4D1TA 4ZEJA 5FQBA 1ZTCA 3R2UA 3I11A 1KO2A 3IEMA 5B15A 1YCGA 3FCZA 4UWRB 4J5FA 2QEDA 2GFJA 5HIQA 2Y8AA 4U4LA 2FHXA 1JT1A 1KO3A 3ADRA 5LS3A 4NQ6A 4TYFA 2YNWA 4AWYB 2I7XA 4AXHA 4ZO3A 2YHEA 5A0TA 3ESHA 5EVDA 5A87A 4EXSA 3FAIA 4FEKA 4Z5ZA 3ZWFA 3ZR9A 2CG2A 2FHXB 5EHTA 2XR1A 2BFKA 2BFZB 1VJNA 4NURA 2BG8A 2Y8BA 4TYTA 3SPUA 3KNSA 4RL0A 4Z6XA 3X2YA 2FU7A 2P97A 2ZNBA 1A7TA 1VGNA 2WYMC 5B3RA 2I7VA 3IOGA 3ZNBA 4HL2A 3G1PA 1A8TA 2E7YA 3PY5A 4HKYA 4O98A 1QH3A 4FSBA 3RPCA 2OHIA 2NYPA 2CFUA 3I13A 4ZNBA 2H6AA 4GYQA 5A23A 5A0VA 2NZEA 2I7TA 2WRSA 2Q42A 4DILA 3QH8A 5ACSA 4EFZA 5K4NA 3I0VA 1WW1A 3IEKA 2M5DA 5EVKA 3BC2A 4EYBA 4HL1A 2QJSA 3T3OA 4BZ3A 2BC2A 1QH5A 4ZO2A 1X8GA 4C1CA 4C1HA 5HIPA 3Q6VA 5ACTA 2ZZIA 3RKKA 3IOFA 2QINA 4KEQA 5AHRA 1MQOA 2P4ZA 2M5CA 2BFLA 2OHJA 2AZ4A 3DHBA 1YCFA 4PVOA 2CG3A 5LSCA 4BP0A 4NQ4A 3AF5A 4UWPB 3F9OA 2Q9UA 3KL7A 2YNTA 3DHCA 5K4KA 2P1EA 4P62A 5KIKA 4Z7RA 4D1VA 3JXPA 1DDKA 1L9YA 2FU9A 5LLDA 3SBLA 5A5ZA 3ZQ4A 2ZWRA 2BG8B 5ACQA 4EYFA 4EY2A 4GYUA 5FQAA 5ACUA 2P18A 3SD9A 2OHHA 4RM5A 4WD6A 2BGAA 4XWWA 5AXRA 2YCBA 4C1GA 4EXYA 3MD7A 4UA4A 5EVBA 1SMLA 5HH5A 2YNVB 1VMEA 2BTNA 5LCHA 3BK2A 5ACWA 5EV8A 3X2XA 2Y87A 4RAWA 5ACVA 2Q0IA 3IELA 4AV7A 4PDXA 1Y44A 4D02A 4JO0A 4TZBA 3T9MA 2Q0JA 4FR7A 5AEBA 2NZFA 3SRXA 5ACRA 3I15A 2YNTB 3SW3A 4YSBA 2BG6A 2QDSA 5AJLA 5LCAA 1DD6A 4TZ9A 4J5HA 4RBSA 5ACPA 3IE1A 5IQKA 4C1EA 5HISA 2BR6A 5HIOA 3IDZA 2DOOA 2GFKA 4LE6A 3KNRA 4UAMA 3DH8A 4DIKA 4NQ2A 3SFPA 3VQZA 2GCUA 2YNUA 3PY6A 4CHLA 5LE1A 3PG4A 2QDTA 3X2ZA 3RKJA 4UWSB 4Z60A 2WYMA 1WUOA 2CBNA 2YZ3A 1BVTA 3L6NA 4UWOB 4PVTA 1M2XA 5LMCA 3IE2A 1KR3A 2YNVA 2FU6A 4Z5YA 4Z67A 3AJ3A 5EW0A 4C1FA 2A7MA 4B87A 5K4MA 3AF6A 2NXAA 3A4YA 4TZFA 4RL2A 4XWTA 5AXOA 2XF4A 3VPEA 2GKLA 2BMIA 1JJTA 5DPXA 1P9EA 3BV6A 3LVZA 5HH4A 4KEPA 1X8IA 5FQCA 4TZEA 5LM6A 4F6ZA 2FM6A 4UBQA 5EWAA 4AX1B 1E5DA 3BK1A 1YCHA 1HLKA 1X8HA 4NQ5A 5B1UA 3S0ZA 1BMCA 2BFZA 1ZNBA 2BIBA 5AIJA 2BG7A 2WHGA 3I14A 5ACXA 4C09A 3T3NA 4AWZA
chains in the Genus database with same CATH topology
4YSKA 4C1DA 2UYXA 2BG2A 2FU8A 3P2UA 5KILA 5AHOA 1JJEA 2HB9A 4AD9A 2ZO4A 2VW8A 5HH6A 1ZKPA 3DHAA 4V0HA 5EV6A 3X30A 1XTOA 4YSLA 1XM8A 4H0DA 5EH9A 2GMNA 2WYLA 1K07A 5K0WA 4XUKA 1WUPA 4AX0B 1WRAA 3WXCA 2AIOA 3H3EA 5LCFA 2DKFA 4F6HA 4GCWA 3TP9A 5AYAA 4D1UA 4EYLA 1DXKA 2FK6A 4D1WA 1BC2A 2R2DA 3IE0A 4RAMA 4D1TA 4ZEJA 5FQBA 1ZTCA 3R2UA 3I11A 1KO2A 3IEMA 5B15A 1YCGA 3FCZA 4UWRB 4J5FA 2QEDA 2GFJA 5HIQA 2Y8AA 4U4LA 2FHXA 1JT1A 1KO3A 3ADRA 5LS3A 4NQ6A 4TYFA 2YNWA 4AWYB 2I7XA 4ZO3A 5A0TA 3ESHA 5EVDA 5A87A 4EXSA 3FAIA 4FEKA 4Z5ZA 3ZWFA 3ZR9A 2FHXB 5EHTA 2XR1A 2BFKA 2BFZB 1VJNA 2BG8A 2Y8BA 4TYTA 3SPUA 3KNSA 4RL0A 4Z6XA 3X2YA 2FU7A 2P97A 2ZNBA 1A7TA 1VGNA 2WYMC 5B3RA 2I7VA 3IOGA 3ZNBA 4HL2A 3G1PA 1A8TA 2E7YA 3PY5A 4HKYA 4O98A 1QH3A 4FSBA 3RPCA 2OHIA 2NYPA 3I13A 4ZNBA 2H6AA 4GYQA 5A0VA 2NZEA 2I7TA 2WRSA 2Q42A 4DILA 3QH8A 5ACSA 4EFZA 5K4NA 3I0VA 1WW1A 3IEKA 2M5DA 5EVKA 3BC2A 4EYBA 4HL1A 2QJSA 3T3OA 4BZ3A 2BC2A 1QH5A 4ZO2A 1X8GA 4C1CA 4C1HA 5HIPA 3Q6VA 5ACTA 2ZZIA 3RKKA 3IOFA 2QINA 4KEQA 5AHRA 1MQOA 2P4ZA 2M5CA 2BFLA 2OHJA 2AZ4A 3DHBA 1YCFA 4PVOA 5LSCA 4BP0A 4NQ4A 3AF5A 4UWPB 3F9OA 2Q9UA 3KL7A 2YNTA 3DHCA 5K4KA 2P1EA 4P62A 5KIKA 4Z7RA 4D1VA 3JXPA 1DDKA 1L9YA 2FU9A 5LLDA 3SBLA 5A5ZA 3ZQ4A 2ZWRA 2BG8B 5ACQA 4EYFA 4EY2A 4GYUA 5FQAA 5ACUA 2P18A 3SD9A 2OHHA 4RM5A 4WD6A 2BGAA 4XWWA 5AXRA 2YCBA 4C1GA 4EXYA 3MD7A 4UA4A 5EVBA 1SMLA 5HH5A 2YNVB 1VMEA 2BTNA 5LCHA 3BK2A 5ACWA 5EV8A 3X2XA 2Y87A 4RAWA 5ACVA 2Q0IA 3IELA 1Y44A 4D02A 4JO0A 4TZBA 3T9MA 2Q0JA 4FR7A 5AEBA 2NZFA 3SRXA 5ACRA 3I15A 2YNTB 3SW3A 4YSBA 2BG6A 2QDSA 5LCAA 1DD6A 4TZ9A 4J5HA 4RBSA 5ACPA 3IE1A 5IQKA 4C1EA 5HISA 2BR6A 5HIOA 3IDZA 2DOOA 2GFKA 4LE6A 3KNRA 4UAMA 3DH8A 4DIKA 4NQ2A 3SFPA 3VQZA 2GCUA 2YNUA 3PY6A 4CHLA 5LE1A 3PG4A 2QDTA 3X2ZA 3RKJA 4UWSB 4Z60A 2WYMA 1WUOA 2CBNA 2YZ3A 1BVTA 3L6NA 4UWOB 4PVTA 1M2XA 5LMCA 3IE2A 1KR3A 2YNVA 2FU6A 4Z5YA 4Z67A 3AJ3A 5EW0A 4C1FA 2A7MA 4B87A 5K4MA 3AF6A 2NXAA 3A4YA 4TZFA 4RL2A 4XWTA 5AXOA 2XF4A 3VPEA 2GKLA 2BMIA 1JJTA 5DPXA 1P9EA 3BV6A 3LVZA 5HH4A 4KEPA 1X8IA 5FQCA 4TZEA 5LM6A 4F6ZA 2FM6A 4UBQA 5EWAA 4AX1B 1E5DA 3BK1A 1YCHA 1HLKA 1X8HA 4NQ5A 5B1UA 3S0ZA 1BMCA 2BFZA 1ZNBA 2BIBA 2BG7A 2WHGA 3I14A 5ACXA 4C09A 3T3NA 4AWZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YSK A;  4C1D A;  2UYX A;  2BG2 A;  2FU8 A;  3P2U A;  5KIL A;  5AHO A;  1JJE A;  2HB9 A;  4AD9 A;  2ZO4 A;  2VW8 A;  5HH6 A;  1ZKP A;  3DHA A;  4V0H A;  5EV6 A;  3X30 A;  1XTO A;  4YSL A;  1XM8 A;  4H0D A;  5EH9 A;  2GMN A;  2WYL A;  1K07 A;  5K0W A;  4XUK A;  1WUP A;  4AX0 B;  1WRA A;  3WXC A;  2AIO A;  3H3E A;  5LCF A;  2DKF A;  4F6H A;  4GCW A;  3TP9 A;  5AYA A;  4D1U A;  4EYL A;  1DXK A;  2FK6 A;  4D1W A;  1BC2 A;  2R2D A;  3IE0 A;  4RAM A;  4D1T A;  4ZEJ A;  5FQB A;  1ZTC A;  3R2U A;  3I11 A;  1KO2 A;  3IEM A;  5B15 A;  1YCG A;  3FCZ A;  4UWR B;  4J5F A;  2QED A;  2GFJ A;  5HIQ A;  2Y8A A;  4U4L A;  2FHX A;  1JT1 A;  1KO3 A;  3ADR A;  5LS3 A;  4NQ6 A;  4TYF A;  2YNW A;  4AWY B;  2I7X A;  4ZO3 A;  5A0T A;  3ESH A;  5EVD A;  5A87 A;  4EXS A;  3FAI A;  4FEK A;  4Z5Z A;  3ZWF A;  3ZR9 A;  2FHX B;  5EHT A;  2XR1 A;  2BFK A;  2BFZ B;  1VJN A;  2BG8 A;  2Y8B A;  4TYT A;  3SPU A;  3KNS A;  4RL0 A;  4Z6X A;  3X2Y A;  2FU7 A;  2P97 A;  2ZNB A;  1A7T A;  1VGN A;  2WYM C;  5B3R A;  2I7V A;  3IOG A;  3ZNB A;  4HL2 A;  3G1P A;  1A8T A;  2E7Y A;  3PY5 A;  4HKY A;  4O98 A;  1QH3 A;  4FSB A;  3RPC A;  2OHI A;  2NYP A;  3I13 A;  4ZNB A;  2H6A A;  4GYQ A;  5A0V A;  2NZE A;  2I7T A;  2WRS A;  2Q42 A;  4DIL A;  3QH8 A;  5ACS A;  4EFZ A;  5K4N A;  3I0V A;  1WW1 A;  3IEK A;  2M5D A;  5EVK A;  3BC2 A;  4EYB A;  4HL1 A;  2QJS A;  3T3O A;  4BZ3 A;  2BC2 A;  1QH5 A;  4ZO2 A;  1X8G A;  4C1C A;  4C1H A;  5HIP A;  3Q6V A;  5ACT A;  2ZZI A;  3RKK A;  3IOF A;  2QIN A;  4KEQ A;  5AHR A;  1MQO A;  2P4Z A;  2M5C A;  2BFL A;  2OHJ A;  2AZ4 A;  3DHB A;  1YCF A;  4PVO A;  5LSC A;  4BP0 A;  4NQ4 A;  3AF5 A;  4UWP B;  3F9O A;  2Q9U A;  3KL7 A;  2YNT A;  3DHC A;  5K4K A;  2P1E A;  4P62 A;  5KIK A;  4Z7R A;  4D1V A;  3JXP A;  1DDK A;  1L9Y A;  2FU9 A;  5LLD A;  3SBL A;  5A5Z A;  3ZQ4 A;  2ZWR A;  2BG8 B;  5ACQ A;  4EYF A;  4EY2 A;  4GYU A;  5FQA A;  5ACU A;  2P18 A;  3SD9 A;  2OHH A;  4RM5 A;  4WD6 A;  2BGA A;  4XWW A;  5AXR A;  2YCB A;  4C1G A;  4EXY A;  3MD7 A;  4UA4 A;  5EVB A;  1SML A;  5HH5 A;  2YNV B;  1VME A;  2BTN A;  5LCH A;  3BK2 A;  5ACW A;  5EV8 A;  3X2X A;  2Y87 A;  4RAW A;  5ACV A;  2Q0I A;  3IEL A;  1Y44 A;  4D02 A;  4JO0 A;  4TZB A;  3T9M A;  2Q0J A;  4FR7 A;  5AEB A;  2NZF A;  3SRX A;  5ACR A;  3I15 A;  2YNT B;  3SW3 A;  4YSB A;  2BG6 A;  2QDS A;  5LCA A;  1DD6 A;  4TZ9 A;  4J5H A;  4RBS A;  5ACP A;  3IE1 A;  5IQK A;  4C1E A;  5HIS A;  2BR6 A;  5HIO A;  3IDZ A;  2DOO A;  2GFK A;  4LE6 A;  3KNR A;  4UAM A;  3DH8 A;  4DIK A;  4NQ2 A;  3SFP A;  3VQZ A;  2GCU A;  2YNU A;  3PY6 A;  4CHL A;  5LE1 A;  3PG4 A;  2QDT A;  3X2Z A;  3RKJ A;  4UWS B;  4Z60 A;  2WYM A;  1WUO A;  2CBN A;  2YZ3 A;  1BVT A;  3L6N A;  4UWO B;  4PVT A;  1M2X A;  5LMC A;  3IE2 A;  1KR3 A;  2YNV A;  2FU6 A;  4Z5Y A;  4Z67 A;  3AJ3 A;  5EW0 A;  4C1F A;  2A7M A;  4B87 A;  5K4M A;  3AF6 A;  2NXA A;  3A4Y A;  4TZF A;  4RL2 A;  4XWT A;  5AXO A;  2XF4 A;  3VPE A;  2GKL A;  2BMI A;  1JJT A;  5DPX A;  1P9E A;  3BV6 A;  3LVZ A;  5HH4 A;  4KEP A;  1X8I A;  5FQC A;  4TZE A;  5LM6 A;  4F6Z A;  2FM6 A;  4UBQ A;  5EWA A;  4AX1 B;  1E5D A;  3BK1 A;  1YCH A;  1HLK A;  1X8H A;  4NQ5 A;  5B1U A;  3S0Z A;  1BMC A;  2BFZ A;  1ZNB A;  2BIB A;  2BG7 A;  2WHG A;  3I14 A;  5ACX A;  4C09 A;  3T3N A;  4AWZ A; 
#chains in the Genus database with same CATH topology
 4YSK A;  4C1D A;  2UYX A;  2BG2 A;  2FU8 A;  3P2U A;  5KIL A;  5AHO A;  1JJE A;  2HB9 A;  4AD9 A;  2ZO4 A;  2VW8 A;  5HH6 A;  1ZKP A;  3DHA A;  4V0H A;  5EV6 A;  3X30 A;  1XTO A;  4YSL A;  1XM8 A;  4H0D A;  5EH9 A;  2GMN A;  2WYL A;  1K07 A;  5K0W A;  4XUK A;  1WUP A;  4AX0 B;  1WRA A;  3WXC A;  2AIO A;  3H3E A;  5LCF A;  2DKF A;  4F6H A;  4GCW A;  3TP9 A;  5AYA A;  4D1U A;  4EYL A;  1DXK A;  2CFZ A;  2FK6 A;  4D1W A;  1BC2 A;  2R2D A;  3IE0 A;  4RAM A;  4D1T A;  4ZEJ A;  5FQB A;  1ZTC A;  3R2U A;  3I11 A;  1KO2 A;  3IEM A;  5B15 A;  1YCG A;  3FCZ A;  4UWR B;  4J5F A;  2QED A;  2GFJ A;  5HIQ A;  2Y8A A;  4U4L A;  2FHX A;  1JT1 A;  1KO3 A;  3ADR A;  5LS3 A;  4NQ6 A;  4TYF A;  2YNW A;  4AWY B;  2I7X A;  4AXH A;  4ZO3 A;  2YHE A;  5A0T A;  3ESH A;  5EVD A;  5A87 A;  4EXS A;  3FAI A;  4FEK A;  4Z5Z A;  3ZWF A;  3ZR9 A;  2CG2 A;  2FHX B;  5EHT A;  2XR1 A;  2BFK A;  2BFZ B;  1VJN A;  4NUR A;  2BG8 A;  2Y8B A;  4TYT A;  3SPU A;  3KNS A;  4RL0 A;  4Z6X A;  3X2Y A;  2FU7 A;  2P97 A;  2ZNB A;  1A7T A;  1VGN A;  2WYM C;  5B3R A;  2I7V A;  3IOG A;  3ZNB A;  4HL2 A;  3G1P A;  1A8T A;  2E7Y A;  3PY5 A;  4HKY A;  4O98 A;  1QH3 A;  4FSB A;  3RPC A;  2OHI A;  2NYP A;  2CFU A;  3I13 A;  4ZNB A;  2H6A A;  4GYQ A;  5A23 A;  5A0V A;  2NZE A;  2I7T A;  2WRS A;  2Q42 A;  4DIL A;  3QH8 A;  5ACS A;  4EFZ A;  5K4N A;  3I0V A;  1WW1 A;  3IEK A;  2M5D A;  5EVK A;  3BC2 A;  4EYB A;  4HL1 A;  2QJS A;  3T3O A;  4BZ3 A;  2BC2 A;  1QH5 A;  4ZO2 A;  1X8G A;  4C1C A;  4C1H A;  5HIP A;  3Q6V A;  5ACT A;  2ZZI A;  3RKK A;  3IOF A;  2QIN A;  4KEQ A;  5AHR A;  1MQO A;  2P4Z A;  2M5C A;  2BFL A;  2OHJ A;  2AZ4 A;  3DHB A;  1YCF A;  4PVO A;  2CG3 A;  5LSC A;  4BP0 A;  4NQ4 A;  3AF5 A;  4UWP B;  3F9O A;  2Q9U A;  3KL7 A;  2YNT A;  3DHC A;  5K4K A;  2P1E A;  4P62 A;  5KIK A;  4Z7R A;  4D1V A;  3JXP A;  1DDK A;  1L9Y A;  2FU9 A;  5LLD A;  3SBL A;  5A5Z A;  3ZQ4 A;  2ZWR A;  2BG8 B;  5ACQ A;  4EYF A;  4EY2 A;  4GYU A;  5FQA A;  5ACU A;  2P18 A;  3SD9 A;  2OHH A;  4RM5 A;  4WD6 A;  2BGA A;  4XWW A;  5AXR A;  2YCB A;  4C1G A;  4EXY A;  3MD7 A;  4UA4 A;  5EVB A;  1SML A;  5HH5 A;  2YNV B;  1VME A;  2BTN A;  5LCH A;  3BK2 A;  5ACW A;  5EV8 A;  3X2X A;  2Y87 A;  4RAW A;  5ACV A;  2Q0I A;  3IEL A;  4AV7 A;  4PDX A;  1Y44 A;  4D02 A;  4JO0 A;  4TZB A;  3T9M A;  2Q0J A;  4FR7 A;  5AEB A;  2NZF A;  3SRX A;  5ACR A;  3I15 A;  2YNT B;  3SW3 A;  4YSB A;  2BG6 A;  2QDS A;  5AJL A;  5LCA A;  1DD6 A;  4TZ9 A;  4J5H A;  4RBS A;  5ACP A;  3IE1 A;  5IQK A;  4C1E A;  5HIS A;  2BR6 A;  5HIO A;  3IDZ A;  2DOO A;  2GFK A;  4LE6 A;  3KNR A;  4UAM A;  3DH8 A;  4DIK A;  4NQ2 A;  3SFP A;  3VQZ A;  2GCU A;  2YNU A;  3PY6 A;  4CHL A;  5LE1 A;  3PG4 A;  2QDT A;  3X2Z A;  3RKJ A;  4UWS B;  4Z60 A;  2WYM A;  1WUO A;  2CBN A;  2YZ3 A;  1BVT A;  3L6N A;  4UWO B;  4PVT A;  1M2X A;  5LMC A;  3IE2 A;  1KR3 A;  2YNV A;  2FU6 A;  4Z5Y A;  4Z67 A;  3AJ3 A;  5EW0 A;  4C1F A;  2A7M A;  4B87 A;  5K4M A;  3AF6 A;  2NXA A;  3A4Y A;  4TZF A;  4RL2 A;  4XWT A;  5AXO A;  2XF4 A;  3VPE A;  2GKL A;  2BMI A;  1JJT A;  5DPX A;  1P9E A;  3BV6 A;  3LVZ A;  5HH4 A;  4KEP A;  1X8I A;  5FQC A;  4TZE A;  5LM6 A;  4F6Z A;  2FM6 A;  4UBQ A;  5EWA A;  4AX1 B;  1E5D A;  3BK1 A;  1YCH A;  1HLK A;  1X8H A;  4NQ5 A;  5B1U A;  3S0Z A;  1BMC A;  2BFZ A;  1ZNB A;  2BIB A;  5AIJ A;  2BG7 A;  2WHG A;  3I14 A;  5ACX A;  4C09 A;  3T3N A;  4AWZ A; 
#chains in the Genus database with same CATH homology
 4YSK A;  4C1D A;  2UYX A;  2BG2 A;  2FU8 A;  3P2U A;  5KIL A;  5AHO A;  1JJE A;  2HB9 A;  4AD9 A;  2ZO4 A;  2VW8 A;  5HH6 A;  1ZKP A;  3DHA A;  4V0H A;  5EV6 A;  3X30 A;  1XTO A;  4YSL A;  1XM8 A;  4H0D A;  5EH9 A;  2GMN A;  2WYL A;  1K07 A;  5K0W A;  4XUK A;  1WUP A;  4AX0 B;  1WRA A;  3WXC A;  2AIO A;  3H3E A;  5LCF A;  2DKF A;  4F6H A;  4GCW A;  3TP9 A;  5AYA A;  4D1U A;  4EYL A;  1DXK A;  2FK6 A;  4D1W A;  1BC2 A;  2R2D A;  3IE0 A;  4RAM A;  4D1T A;  4ZEJ A;  5FQB A;  1ZTC A;  3R2U A;  3I11 A;  1KO2 A;  3IEM A;  5B15 A;  1YCG A;  3FCZ A;  4UWR B;  4J5F A;  2QED A;  2GFJ A;  5HIQ A;  2Y8A A;  4U4L A;  2FHX A;  1JT1 A;  1KO3 A;  3ADR A;  5LS3 A;  4NQ6 A;  4TYF A;  2YNW A;  4AWY B;  2I7X A;  4ZO3 A;  5A0T A;  3ESH A;  5EVD A;  5A87 A;  4EXS A;  3FAI A;  4FEK A;  4Z5Z A;  3ZWF A;  3ZR9 A;  2FHX B;  5EHT A;  2XR1 A;  2BFK A;  2BFZ B;  1VJN A;  2BG8 A;  2Y8B A;  4TYT A;  3SPU A;  3KNS A;  4RL0 A;  4Z6X A;  3X2Y A;  2FU7 A;  2P97 A;  2ZNB A;  1A7T A;  1VGN A;  2WYM C;  5B3R A;  2I7V A;  3IOG A;  3ZNB A;  4HL2 A;  3G1P A;  1A8T A;  2E7Y A;  3PY5 A;  4HKY A;  4O98 A;  1QH3 A;  4FSB A;  3RPC A;  2OHI A;  2NYP A;  3I13 A;  4ZNB A;  2H6A A;  4GYQ A;  5A0V A;  2NZE A;  2I7T A;  2WRS A;  2Q42 A;  4DIL A;  3QH8 A;  5ACS A;  4EFZ A;  5K4N A;  3I0V A;  1WW1 A;  3IEK A;  2M5D A;  5EVK A;  3BC2 A;  4EYB A;  4HL1 A;  2QJS A;  3T3O A;  4BZ3 A;  2BC2 A;  1QH5 A;  4ZO2 A;  1X8G A;  4C1C A;  4C1H A;  5HIP A;  3Q6V A;  5ACT A;  2ZZI A;  3RKK A;  3IOF A;  2QIN A;  4KEQ A;  5AHR A;  1MQO A;  2P4Z A;  2M5C A;  2BFL A;  2OHJ A;  2AZ4 A;  3DHB A;  1YCF A;  4PVO A;  5LSC A;  4BP0 A;  4NQ4 A;  3AF5 A;  4UWP B;  3F9O A;  2Q9U A;  3KL7 A;  2YNT A;  3DHC A;  5K4K A;  2P1E A;  4P62 A;  5KIK A;  4Z7R A;  4D1V A;  3JXP A;  1DDK A;  1L9Y A;  2FU9 A;  5LLD A;  3SBL A;  5A5Z A;  3ZQ4 A;  2ZWR A;  2BG8 B;  5ACQ A;  4EYF A;  4EY2 A;  4GYU A;  5FQA A;  5ACU A;  2P18 A;  3SD9 A;  2OHH A;  4RM5 A;  4WD6 A;  2BGA A;  4XWW A;  5AXR A;  2YCB A;  4C1G A;  4EXY A;  3MD7 A;  4UA4 A;  5EVB A;  1SML A;  5HH5 A;  2YNV B;  1VME A;  2BTN A;  5LCH A;  3BK2 A;  5ACW A;  5EV8 A;  3X2X A;  2Y87 A;  4RAW A;  5ACV A;  2Q0I A;  3IEL A;  1Y44 A;  4D02 A;  4JO0 A;  4TZB A;  3T9M A;  2Q0J A;  4FR7 A;  5AEB A;  2NZF A;  3SRX A;  5ACR A;  3I15 A;  2YNT B;  3SW3 A;  4YSB A;  2BG6 A;  2QDS A;  5LCA A;  1DD6 A;  4TZ9 A;  4J5H A;  4RBS A;  5ACP A;  3IE1 A;  5IQK A;  4C1E A;  5HIS A;  2BR6 A;  5HIO A;  3IDZ A;  2DOO A;  2GFK A;  4LE6 A;  3KNR A;  4UAM A;  3DH8 A;  4DIK A;  4NQ2 A;  3SFP A;  3VQZ A;  2GCU A;  2YNU A;  3PY6 A;  4CHL A;  5LE1 A;  3PG4 A;  2QDT A;  3X2Z A;  3RKJ A;  4UWS B;  4Z60 A;  2WYM A;  1WUO A;  2CBN A;  2YZ3 A;  1BVT A;  3L6N A;  4UWO B;  4PVT A;  1M2X A;  5LMC A;  3IE2 A;  1KR3 A;  2YNV A;  2FU6 A;  4Z5Y A;  4Z67 A;  3AJ3 A;  5EW0 A;  4C1F A;  2A7M A;  4B87 A;  5K4M A;  3AF6 A;  2NXA A;  3A4Y A;  4TZF A;  4RL2 A;  4XWT A;  5AXO A;  2XF4 A;  3VPE A;  2GKL A;  2BMI A;  1JJT A;  5DPX A;  1P9E A;  3BV6 A;  3LVZ A;  5HH4 A;  4KEP A;  1X8I A;  5FQC A;  4TZE A;  5LM6 A;  4F6Z A;  2FM6 A;  4UBQ A;  5EWA A;  4AX1 B;  1E5D A;  3BK1 A;  1YCH A;  1HLK A;  1X8H A;  4NQ5 A;  5B1U A;  3S0Z A;  1BMC A;  2BFZ A;  1ZNB A;  2BIB A;  2BG7 A;  2WHG A;  3I14 A;  5ACX A;  4C09 A;  3T3N A;  4AWZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...