4J5FA

Crystal structure of b. thuringiensis aiia mutant f107w
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
250
structure length
250
Chain Sequence
b'MTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHWDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIETEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acyl homoserine lactonase
publication title A phenylalanine clamp controls substrate specificity in the quorum-quenching metallo-gamma-lactonase from Bacillus thuringiensis.
pubmed doi rcsb
source organism Bacillus thuringiensis
molecule tags Hydrolase
total genus 80
structure length 250
sequence length 250
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2013-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4j5fA01
3IE0A 3DHBA 1VGNA 5HIQA 1SMLA 5AYAA 1DDKA 2A7MA 2QEDA 4C1EA 2BG8A 1WUOA 2E7YA 5EVBA 3SBLA 1KR3A 4AX0B 4D1WA 2XR1A 1XM8A 5AHRA 4C1GA 3ZNBA 1ZKPA 2WYLA 5B1UA 3DH8A 4CHLA 5HH5A 5B3RA 1VMEA 2H6AA 5AXOA 4EFZA 3SRXA 3ADRA 4DILA 5KILA 4EYBA 2P1EA 3X2XA 1YCHA 4RL0A 3IELA 3JXPA 2CBNA 3IDZA 5EV6A 2P97A 3SD9A 1KO3A 2WRSA 2OHHA 5EWAA 1K07A 4DIKA 3QH8A 1QH3A 5K4MA 1ZTCA 2YCBA 5KIKA 3BV6A 5A0VA 1WUPA 5K4NA 5LM6A 4D1UA 1JT1A 4Z6XA 2I7TA 1X8HA 2FK6A 5ACUA 2Y8AA 4HL1A 4Z67A 4B87A 4NQ6A 4AX1B 4BZ3A 2FHXB 2Q0IA 5DPXA 3ZWFA 5EVKA 3F9OA 3G1PA 4UWOB 4UWPB 2OHIA 5ACXA 2VW8A 4GYQA 5ACRA 3R2UA 1HLKA 4J5FA 4C09A 1E5DA 2BG8B 1WW1A 1A7TA 4ZO3A 1DD6A 5A0TA 3I0VA 2ZZIA 3BC2A 3SPUA 3AF5A 3X2ZA 3P2UA 2DKFA 2BMIA 5K4KA 5A5ZA 3WXCA 5ACSA 3BK1A 2FU8A 2YZ3A 2GMNA 1X8IA 4ZO2A 3IOFA 2QDSA 4EYLA 5LE1A 5LS3A 5ACQA 4LE6A 4UA4A 4UAMA 1DXKA 3SW3A 2OHJA 3T3NA 5HIPA 3ZR9A 4PVTA 1BVTA 1JJEA 1WRAA 2YNUA 4Z5ZA 2YNVA 2BGAA 2R2DA 3PG4A 3A4YA 3X30A 3ESHA 3I13A 4Z7RA 4C1CA 1XTOA 4AWZA 4UWRB 1JJTA 3T9MA 5EH9A 3MD7A 4TZ9A 1ZNBA 2FU7A 5LMCA 3DHAA 3FAIA 1X8GA 2GCUA 5IQKA 3IE1A 1YCFA 3LVZA 1M2XA 2BG6A 2NYPA 2Q0JA 4EYFA 4C1DA 1YCGA 4O98A 2I7VA 2ZO4A 2NXAA 3FCZA 4H0DA 5LCFA 2BG2A 4GYUA 4GCWA 2XF4A 3IEKA 5K0WA 5A87A 2UYXA 4TYFA 4YSLA 3PY5A 3RKKA 5AXRA 5AEBA 4AD9A 2Q42A 4RAMA 4YSKA 1P9EA 2ZWRA 3IOGA 4D1VA 4U4LA 3RPCA 3KL7A 2I7XA 2BFZA 5FQBA 4EXYA 2QINA 2GFKA 3IEMA 2GKLA 4C1FA 2HB9A 3VPEA 5LCHA 2BTNA 2WYMC 5ACPA 3RKJA 1A8TA 3KNRA 4HL2A 5ACVA 2YNVB 4BP0A 5LCAA 5AHOA 1BC2A 5HIOA 4ZEJA 4NQ5A 2BC2A 2FU6A 4TZBA 4ZNBA 2ZNBA 3ZQ4A 4TYTA 4RAWA 3I14A 2WHGA 4EXSA 3BK2A 5B15A 2YNWA 3X2YA 2FM6A 4Z60A 2P18A 5FQAA 2YNTA 4FEKA 4PVOA 3AJ3A 4P62A 4YSBA 3Q6VA 4XWTA 2BR6A 4NQ4A 5LSCA 4C1HA 3KNSA 4V0HA 2Y8BA 4FSBA 3I15A 1VJNA 3I11A 5EW0A 4D1TA 5EHTA 2AZ4A 4RL2A 3VQZA 3TP9A 3DHCA 4UBQA 2BFKA 2Y87A 4XWWA 3H3EA 4RBSA 5HH4A 3PY6A 2BIBA 2BFZB 4Z5YA 3IE2A 5LLDA 3AF6A 2AIOA 5FQCA 5EV8A 4XUKA 3T3OA 2FU9A 4KEPA 4AWYB 4FR7A 2DOOA 4J5HA 2Q9UA 3SFPA 2BFLA 4D02A 1L9YA 4JO0A 4KEQA 3S0ZA 4TZEA 2M5DA 5ACTA 5HH6A 2QJSA 5ACWA 4RM5A 4TZFA 2NZEA 4UWSB 4HKYA 1Y44A 2WYMA 4EY2A 5HISA 4F6HA 1QH5A 2M5CA 2YNTB 4NQ2A 2BG7A 2NZFA 2P4ZA 3L6NA 4F6ZA 2GFJA 1MQOA 2FHXA 1BMCA 4WD6A 1KO2A 2QDTA 5EVDA
chains in the Genus database with same CATH superfamily
3IE0A 3DHBA 1VGNA 5HIQA 4AXHA 1SMLA 2CFZA 5AYAA 1DDKA 2A7MA 2QEDA 4C1EA 2BG8A 1WUOA 2E7YA 5EVBA 3SBLA 1KR3A 4AX0B 4D1WA 2XR1A 1XM8A 5AHRA 4C1GA 3ZNBA 1ZKPA 2WYLA 5B1UA 3DH8A 4CHLA 5HH5A 5B3RA 1VMEA 2H6AA 5AXOA 4EFZA 3SRXA 3ADRA 4DILA 5KILA 4EYBA 2P1EA 3X2XA 1YCHA 4RL0A 3IELA 3JXPA 2CBNA 3IDZA 5EV6A 2P97A 3SD9A 1KO3A 2WRSA 2OHHA 5EWAA 1K07A 4DIKA 2CG3A 3QH8A 1QH3A 5K4MA 1ZTCA 2YCBA 5KIKA 3BV6A 4AV7A 5A0VA 1WUPA 5K4NA 5LM6A 4D1UA 1JT1A 4Z6XA 2I7TA 1X8HA 2FK6A 5ACUA 2Y8AA 4HL1A 4Z67A 4B87A 4NQ6A 4AX1B 4BZ3A 2FHXB 2Q0IA 5DPXA 3ZWFA 5EVKA 3F9OA 3G1PA 4UWOB 4UWPB 2OHIA 5ACXA 2VW8A 4GYQA 5ACRA 3R2UA 1HLKA 4J5FA 4C09A 1E5DA 2BG8B 1WW1A 1A7TA 4ZO3A 1DD6A 5A0TA 3I0VA 2ZZIA 3BC2A 3SPUA 3AF5A 3X2ZA 3P2UA 2DKFA 2BMIA 5K4KA 5A5ZA 3WXCA 5ACSA 3BK1A 2FU8A 2YZ3A 2GMNA 1X8IA 4ZO2A 3IOFA 2QDSA 4EYLA 5LE1A 5LS3A 5ACQA 4LE6A 4UA4A 4UAMA 1DXKA 3SW3A 2OHJA 3T3NA 5HIPA 3ZR9A 4PVTA 1BVTA 1JJEA 1WRAA 2YNUA 4Z5ZA 2YNVA 2BGAA 2R2DA 3PG4A 3A4YA 3X30A 3ESHA 3I13A 4Z7RA 4C1CA 1XTOA 4AWZA 4UWRB 1JJTA 3T9MA 5EH9A 3MD7A 4TZ9A 1ZNBA 2FU7A 5LMCA 3DHAA 4NURA 3FAIA 1X8GA 2GCUA 5IQKA 3IE1A 1YCFA 3LVZA 1M2XA 2BG6A 2NYPA 2Q0JA 4EYFA 4C1DA 1YCGA 4O98A 2I7VA 2ZO4A 2NXAA 3FCZA 4H0DA 5LCFA 2BG2A 4GYUA 4PDXA 4GCWA 2XF4A 3IEKA 5K0WA 5A87A 2UYXA 4TYFA 4YSLA 3PY5A 3RKKA 5AXRA 5AEBA 4AD9A 2Q42A 4RAMA 4YSKA 1P9EA 2ZWRA 3IOGA 4D1VA 4U4LA 3RPCA 3KL7A 2I7XA 2BFZA 5FQBA 4EXYA 2QINA 2GFKA 3IEMA 2GKLA 4C1FA 2HB9A 3VPEA 5LCHA 2BTNA 2WYMC 5ACPA 3RKJA 1A8TA 3KNRA 4HL2A 5ACVA 2YNVB 4BP0A 5LCAA 5AHOA 1BC2A 5HIOA 4ZEJA 4NQ5A 2BC2A 2FU6A 4TZBA 4ZNBA 2ZNBA 3ZQ4A 4TYTA 4RAWA 3I14A 2WHGA 4EXSA 3BK2A 5B15A 2YNWA 3X2YA 2FM6A 4Z60A 2P18A 5FQAA 2YNTA 4FEKA 4PVOA 5AJLA 3AJ3A 4P62A 4YSBA 3Q6VA 4XWTA 2BR6A 4NQ4A 5LSCA 4C1HA 3KNSA 4V0HA 2Y8BA 4FSBA 3I15A 1VJNA 3I11A 5A23A 5EW0A 4D1TA 5EHTA 2AZ4A 4RL2A 3VQZA 3TP9A 3DHCA 4UBQA 2BFKA 2Y87A 2CG2A 4XWWA 3H3EA 4RBSA 5HH4A 3PY6A 2BIBA 2BFZB 4Z5YA 3IE2A 5LLDA 3AF6A 2AIOA 5FQCA 5EV8A 4XUKA 3T3OA 2FU9A 4KEPA 4AWYB 4FR7A 2DOOA 4J5HA 2Q9UA 3SFPA 2BFLA 4D02A 1L9YA 4JO0A 4KEQA 3S0ZA 4TZEA 5AIJA 2M5DA 5ACTA 5HH6A 2QJSA 5ACWA 4RM5A 4TZFA 2NZEA 4UWSB 4HKYA 1Y44A 2WYMA 4EY2A 2CFUA 5HISA 4F6HA 1QH5A 2M5CA 2YNTB 2YHEA 2BG7A 2NZFA 2P4ZA 4NQ2A 3L6NA 4F6ZA 2GFJA 1MQOA 2FHXA 1BMCA 4WD6A 1KO2A 2QDTA 5EVDA
chains in the Genus database with same CATH topology
3IE0A 3DHBA 1VGNA 5HIQA 1SMLA 5AYAA 1DDKA 2A7MA 2QEDA 4C1EA 2BG8A 1WUOA 2E7YA 5EVBA 3SBLA 1KR3A 4AX0B 4D1WA 2XR1A 1XM8A 5AHRA 4C1GA 3ZNBA 1ZKPA 2WYLA 5B1UA 3DH8A 4CHLA 5HH5A 5B3RA 1VMEA 2H6AA 5AXOA 4EFZA 3SRXA 3ADRA 4DILA 5KILA 4EYBA 2P1EA 3X2XA 1YCHA 4RL0A 3IELA 3JXPA 2CBNA 3IDZA 5EV6A 2P97A 3SD9A 1KO3A 2WRSA 2OHHA 5EWAA 1K07A 4DIKA 3QH8A 1QH3A 5K4MA 1ZTCA 2YCBA 5KIKA 3BV6A 5A0VA 1WUPA 5K4NA 5LM6A 4D1UA 1JT1A 4Z6XA 2I7TA 1X8HA 2FK6A 5ACUA 2Y8AA 4HL1A 4Z67A 4B87A 4NQ6A 4AX1B 4BZ3A 2FHXB 2Q0IA 5DPXA 3ZWFA 5EVKA 3F9OA 3G1PA 4UWOB 4UWPB 2OHIA 5ACXA 2VW8A 4GYQA 5ACRA 3R2UA 1HLKA 4J5FA 4C09A 1E5DA 2BG8B 1WW1A 1A7TA 4ZO3A 1DD6A 5A0TA 3I0VA 2ZZIA 3BC2A 3SPUA 3AF5A 3X2ZA 3P2UA 2DKFA 2BMIA 5K4KA 5A5ZA 3WXCA 5ACSA 3BK1A 2FU8A 2YZ3A 2GMNA 1X8IA 4ZO2A 3IOFA 2QDSA 4EYLA 5LE1A 5LS3A 5ACQA 4LE6A 4UA4A 4UAMA 1DXKA 3SW3A 2OHJA 3T3NA 5HIPA 3ZR9A 4PVTA 1BVTA 1JJEA 1WRAA 2YNUA 4Z5ZA 2YNVA 2BGAA 2R2DA 3PG4A 3A4YA 3X30A 3ESHA 3I13A 4Z7RA 4C1CA 1XTOA 4AWZA 4UWRB 1JJTA 3T9MA 5EH9A 3MD7A 4TZ9A 1ZNBA 2FU7A 5LMCA 3DHAA 3FAIA 1X8GA 2GCUA 5IQKA 3IE1A 1YCFA 3LVZA 1M2XA 2BG6A 2NYPA 2Q0JA 4EYFA 4C1DA 1YCGA 4O98A 2I7VA 2ZO4A 2NXAA 3FCZA 4H0DA 5LCFA 2BG2A 4GYUA 4GCWA 2XF4A 3IEKA 5K0WA 5A87A 2UYXA 4TYFA 4YSLA 3PY5A 3RKKA 5AXRA 5AEBA 4AD9A 2Q42A 4RAMA 4YSKA 1P9EA 2ZWRA 3IOGA 4D1VA 4U4LA 3RPCA 3KL7A 2I7XA 2BFZA 5FQBA 4EXYA 2QINA 2GFKA 3IEMA 2GKLA 4C1FA 2HB9A 3VPEA 5LCHA 2BTNA 2WYMC 5ACPA 3RKJA 1A8TA 3KNRA 4HL2A 5ACVA 2YNVB 4BP0A 5LCAA 5AHOA 1BC2A 5HIOA 4ZEJA 4NQ5A 2BC2A 2FU6A 4TZBA 4ZNBA 2ZNBA 3ZQ4A 4TYTA 4RAWA 3I14A 2WHGA 4EXSA 3BK2A 5B15A 2YNWA 3X2YA 2FM6A 4Z60A 2P18A 5FQAA 2YNTA 4FEKA 4PVOA 3AJ3A 4P62A 4YSBA 3Q6VA 4XWTA 2BR6A 4NQ4A 5LSCA 4C1HA 3KNSA 4V0HA 2Y8BA 4FSBA 3I15A 1VJNA 3I11A 5EW0A 4D1TA 5EHTA 2AZ4A 4RL2A 3VQZA 3TP9A 3DHCA 4UBQA 2BFKA 2Y87A 4XWWA 3H3EA 4RBSA 5HH4A 3PY6A 2BIBA 2BFZB 4Z5YA 3IE2A 5LLDA 3AF6A 2AIOA 5FQCA 5EV8A 4XUKA 3T3OA 2FU9A 4KEPA 4AWYB 4FR7A 2DOOA 4J5HA 2Q9UA 3SFPA 2BFLA 4D02A 1L9YA 4JO0A 4KEQA 3S0ZA 4TZEA 2M5DA 5ACTA 5HH6A 2QJSA 5ACWA 4RM5A 4TZFA 2NZEA 4UWSB 4HKYA 1Y44A 2WYMA 4EY2A 5HISA 4F6HA 1QH5A 2M5CA 2YNTB 4NQ2A 2BG7A 2NZFA 2P4ZA 3L6NA 4F6ZA 2GFJA 1MQOA 2FHXA 1BMCA 4WD6A 1KO2A 2QDTA 5EVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IE0 A;  3DHB A;  1VGN A;  5HIQ A;  1SML A;  5AYA A;  1DDK A;  2A7M A;  2QED A;  4C1E A;  2BG8 A;  1WUO A;  2E7Y A;  5EVB A;  3SBL A;  1KR3 A;  4AX0 B;  4D1W A;  2XR1 A;  1XM8 A;  5AHR A;  4C1G A;  3ZNB A;  1ZKP A;  2WYL A;  5B1U A;  3DH8 A;  4CHL A;  5HH5 A;  5B3R A;  1VME A;  2H6A A;  5AXO A;  4EFZ A;  3SRX A;  3ADR A;  4DIL A;  5KIL A;  4EYB A;  2P1E A;  3X2X A;  1YCH A;  4RL0 A;  3IEL A;  3JXP A;  2CBN A;  3IDZ A;  5EV6 A;  2P97 A;  3SD9 A;  1KO3 A;  2WRS A;  2OHH A;  5EWA A;  1K07 A;  4DIK A;  3QH8 A;  1QH3 A;  5K4M A;  1ZTC A;  2YCB A;  5KIK A;  3BV6 A;  5A0V A;  1WUP A;  5K4N A;  5LM6 A;  4D1U A;  1JT1 A;  4Z6X A;  2I7T A;  1X8H A;  2FK6 A;  5ACU A;  2Y8A A;  4HL1 A;  4Z67 A;  4B87 A;  4NQ6 A;  4AX1 B;  4BZ3 A;  2FHX B;  2Q0I A;  5DPX A;  3ZWF A;  5EVK A;  3F9O A;  3G1P A;  4UWO B;  4UWP B;  2OHI A;  5ACX A;  2VW8 A;  4GYQ A;  5ACR A;  3R2U A;  1HLK A;  4J5F A;  4C09 A;  1E5D A;  2BG8 B;  1WW1 A;  1A7T A;  4ZO3 A;  1DD6 A;  5A0T A;  3I0V A;  2ZZI A;  3BC2 A;  3SPU A;  3AF5 A;  3X2Z A;  3P2U A;  2DKF A;  2BMI A;  5K4K A;  5A5Z A;  3WXC A;  5ACS A;  3BK1 A;  2FU8 A;  2YZ3 A;  2GMN A;  1X8I A;  4ZO2 A;  3IOF A;  2QDS A;  4EYL A;  5LE1 A;  5LS3 A;  5ACQ A;  4LE6 A;  4UA4 A;  4UAM A;  1DXK A;  3SW3 A;  2OHJ A;  3T3N A;  5HIP A;  3ZR9 A;  4PVT A;  1BVT A;  1JJE A;  1WRA A;  2YNU A;  4Z5Z A;  2YNV A;  2BGA A;  2R2D A;  3PG4 A;  3A4Y A;  3X30 A;  3ESH A;  3I13 A;  4Z7R A;  4C1C A;  1XTO A;  4AWZ A;  4UWR B;  1JJT A;  3T9M A;  5EH9 A;  3MD7 A;  4TZ9 A;  1ZNB A;  2FU7 A;  5LMC A;  3DHA A;  3FAI A;  1X8G A;  2GCU A;  5IQK A;  3IE1 A;  1YCF A;  3LVZ A;  1M2X A;  2BG6 A;  2NYP A;  2Q0J A;  4EYF A;  4C1D A;  1YCG A;  4O98 A;  2I7V A;  2ZO4 A;  2NXA A;  3FCZ A;  4H0D A;  5LCF A;  2BG2 A;  4GYU A;  4GCW A;  2XF4 A;  3IEK A;  5K0W A;  5A87 A;  2UYX A;  4TYF A;  4YSL A;  3PY5 A;  3RKK A;  5AXR A;  5AEB A;  4AD9 A;  2Q42 A;  4RAM A;  4YSK A;  1P9E A;  2ZWR A;  3IOG A;  4D1V A;  4U4L A;  3RPC A;  3KL7 A;  2I7X A;  2BFZ A;  5FQB A;  4EXY A;  2QIN A;  2GFK A;  3IEM A;  2GKL A;  4C1F A;  2HB9 A;  3VPE A;  5LCH A;  2BTN A;  2WYM C;  5ACP A;  3RKJ A;  1A8T A;  3KNR A;  4HL2 A;  5ACV A;  2YNV B;  4BP0 A;  5LCA A;  5AHO A;  1BC2 A;  5HIO A;  4ZEJ A;  4NQ5 A;  2BC2 A;  2FU6 A;  4TZB A;  4ZNB A;  2ZNB A;  3ZQ4 A;  4TYT A;  4RAW A;  3I14 A;  2WHG A;  4EXS A;  3BK2 A;  5B15 A;  2YNW A;  3X2Y A;  2FM6 A;  4Z60 A;  2P18 A;  5FQA A;  2YNT A;  4FEK A;  4PVO A;  3AJ3 A;  4P62 A;  4YSB A;  3Q6V A;  4XWT A;  2BR6 A;  4NQ4 A;  5LSC A;  4C1H A;  3KNS A;  4V0H A;  2Y8B A;  4FSB A;  3I15 A;  1VJN A;  3I11 A;  5EW0 A;  4D1T A;  5EHT A;  2AZ4 A;  4RL2 A;  3VQZ A;  3TP9 A;  3DHC A;  4UBQ A;  2BFK A;  2Y87 A;  4XWW A;  3H3E A;  4RBS A;  5HH4 A;  3PY6 A;  2BIB A;  2BFZ B;  4Z5Y A;  3IE2 A;  5LLD A;  3AF6 A;  2AIO A;  5FQC A;  5EV8 A;  4XUK A;  3T3O A;  2FU9 A;  4KEP A;  4AWY B;  4FR7 A;  2DOO A;  4J5H A;  2Q9U A;  3SFP A;  2BFL A;  4D02 A;  1L9Y A;  4JO0 A;  4KEQ A;  3S0Z A;  4TZE A;  2M5D A;  5ACT A;  5HH6 A;  2QJS A;  5ACW A;  4RM5 A;  4TZF A;  2NZE A;  4UWS B;  4HKY A;  1Y44 A;  2WYM A;  4EY2 A;  5HIS A;  4F6H A;  1QH5 A;  2M5C A;  2YNT B;  4NQ2 A;  2BG7 A;  2NZF A;  2P4Z A;  3L6N A;  4F6Z A;  2GFJ A;  1MQO A;  2FHX A;  1BMC A;  4WD6 A;  1KO2 A;  2QDT A;  5EVD A; 
#chains in the Genus database with same CATH topology
 3IE0 A;  3DHB A;  1VGN A;  5HIQ A;  4AXH A;  1SML A;  2CFZ A;  5AYA A;  1DDK A;  2A7M A;  2QED A;  4C1E A;  2BG8 A;  1WUO A;  2E7Y A;  5EVB A;  3SBL A;  1KR3 A;  4AX0 B;  4D1W A;  2XR1 A;  1XM8 A;  5AHR A;  4C1G A;  3ZNB A;  1ZKP A;  2WYL A;  5B1U A;  3DH8 A;  4CHL A;  5HH5 A;  5B3R A;  1VME A;  2H6A A;  5AXO A;  4EFZ A;  3SRX A;  3ADR A;  4DIL A;  5KIL A;  4EYB A;  2P1E A;  3X2X A;  1YCH A;  4RL0 A;  3IEL A;  3JXP A;  2CBN A;  3IDZ A;  5EV6 A;  2P97 A;  3SD9 A;  1KO3 A;  2WRS A;  2OHH A;  5EWA A;  1K07 A;  4DIK A;  2CG3 A;  3QH8 A;  1QH3 A;  5K4M A;  1ZTC A;  2YCB A;  5KIK A;  3BV6 A;  4AV7 A;  5A0V A;  1WUP A;  5K4N A;  5LM6 A;  4D1U A;  1JT1 A;  4Z6X A;  2I7T A;  1X8H A;  2FK6 A;  5ACU A;  2Y8A A;  4HL1 A;  4Z67 A;  4B87 A;  4NQ6 A;  4AX1 B;  4BZ3 A;  2FHX B;  2Q0I A;  5DPX A;  3ZWF A;  5EVK A;  3F9O A;  3G1P A;  4UWO B;  4UWP B;  2OHI A;  5ACX A;  2VW8 A;  4GYQ A;  5ACR A;  3R2U A;  1HLK A;  4J5F A;  4C09 A;  1E5D A;  2BG8 B;  1WW1 A;  1A7T A;  4ZO3 A;  1DD6 A;  5A0T A;  3I0V A;  2ZZI A;  3BC2 A;  3SPU A;  3AF5 A;  3X2Z A;  3P2U A;  2DKF A;  2BMI A;  5K4K A;  5A5Z A;  3WXC A;  5ACS A;  3BK1 A;  2FU8 A;  2YZ3 A;  2GMN A;  1X8I A;  4ZO2 A;  3IOF A;  2QDS A;  4EYL A;  5LE1 A;  5LS3 A;  5ACQ A;  4LE6 A;  4UA4 A;  4UAM A;  1DXK A;  3SW3 A;  2OHJ A;  3T3N A;  5HIP A;  3ZR9 A;  4PVT A;  1BVT A;  1JJE A;  1WRA A;  2YNU A;  4Z5Z A;  2YNV A;  2BGA A;  2R2D A;  3PG4 A;  3A4Y A;  3X30 A;  3ESH A;  3I13 A;  4Z7R A;  4C1C A;  1XTO A;  4AWZ A;  4UWR B;  1JJT A;  3T9M A;  5EH9 A;  3MD7 A;  4TZ9 A;  1ZNB A;  2FU7 A;  5LMC A;  3DHA A;  4NUR A;  3FAI A;  1X8G A;  2GCU A;  5IQK A;  3IE1 A;  1YCF A;  3LVZ A;  1M2X A;  2BG6 A;  2NYP A;  2Q0J A;  4EYF A;  4C1D A;  1YCG A;  4O98 A;  2I7V A;  2ZO4 A;  2NXA A;  3FCZ A;  4H0D A;  5LCF A;  2BG2 A;  4GYU A;  4PDX A;  4GCW A;  2XF4 A;  3IEK A;  5K0W A;  5A87 A;  2UYX A;  4TYF A;  4YSL A;  3PY5 A;  3RKK A;  5AXR A;  5AEB A;  4AD9 A;  2Q42 A;  4RAM A;  4YSK A;  1P9E A;  2ZWR A;  3IOG A;  4D1V A;  4U4L A;  3RPC A;  3KL7 A;  2I7X A;  2BFZ A;  5FQB A;  4EXY A;  2QIN A;  2GFK A;  3IEM A;  2GKL A;  4C1F A;  2HB9 A;  3VPE A;  5LCH A;  2BTN A;  2WYM C;  5ACP A;  3RKJ A;  1A8T A;  3KNR A;  4HL2 A;  5ACV A;  2YNV B;  4BP0 A;  5LCA A;  5AHO A;  1BC2 A;  5HIO A;  4ZEJ A;  4NQ5 A;  2BC2 A;  2FU6 A;  4TZB A;  4ZNB A;  2ZNB A;  3ZQ4 A;  4TYT A;  4RAW A;  3I14 A;  2WHG A;  4EXS A;  3BK2 A;  5B15 A;  2YNW A;  3X2Y A;  2FM6 A;  4Z60 A;  2P18 A;  5FQA A;  2YNT A;  4FEK A;  4PVO A;  5AJL A;  3AJ3 A;  4P62 A;  4YSB A;  3Q6V A;  4XWT A;  2BR6 A;  4NQ4 A;  5LSC A;  4C1H A;  3KNS A;  4V0H A;  2Y8B A;  4FSB A;  3I15 A;  1VJN A;  3I11 A;  5A23 A;  5EW0 A;  4D1T A;  5EHT A;  2AZ4 A;  4RL2 A;  3VQZ A;  3TP9 A;  3DHC A;  4UBQ A;  2BFK A;  2Y87 A;  2CG2 A;  4XWW A;  3H3E A;  4RBS A;  5HH4 A;  3PY6 A;  2BIB A;  2BFZ B;  4Z5Y A;  3IE2 A;  5LLD A;  3AF6 A;  2AIO A;  5FQC A;  5EV8 A;  4XUK A;  3T3O A;  2FU9 A;  4KEP A;  4AWY B;  4FR7 A;  2DOO A;  4J5H A;  2Q9U A;  3SFP A;  2BFL A;  4D02 A;  1L9Y A;  4JO0 A;  4KEQ A;  3S0Z A;  4TZE A;  5AIJ A;  2M5D A;  5ACT A;  5HH6 A;  2QJS A;  5ACW A;  4RM5 A;  4TZF A;  2NZE A;  4UWS B;  4HKY A;  1Y44 A;  2WYM A;  4EY2 A;  2CFU A;  5HIS A;  4F6H A;  1QH5 A;  2M5C A;  2YNT B;  2YHE A;  2BG7 A;  2NZF A;  2P4Z A;  4NQ2 A;  3L6N A;  4F6Z A;  2GFJ A;  1MQO A;  2FHX A;  1BMC A;  4WD6 A;  1KO2 A;  2QDT A;  5EVD A; 
#chains in the Genus database with same CATH homology
 3IE0 A;  3DHB A;  1VGN A;  5HIQ A;  1SML A;  5AYA A;  1DDK A;  2A7M A;  2QED A;  4C1E A;  2BG8 A;  1WUO A;  2E7Y A;  5EVB A;  3SBL A;  1KR3 A;  4AX0 B;  4D1W A;  2XR1 A;  1XM8 A;  5AHR A;  4C1G A;  3ZNB A;  1ZKP A;  2WYL A;  5B1U A;  3DH8 A;  4CHL A;  5HH5 A;  5B3R A;  1VME A;  2H6A A;  5AXO A;  4EFZ A;  3SRX A;  3ADR A;  4DIL A;  5KIL A;  4EYB A;  2P1E A;  3X2X A;  1YCH A;  4RL0 A;  3IEL A;  3JXP A;  2CBN A;  3IDZ A;  5EV6 A;  2P97 A;  3SD9 A;  1KO3 A;  2WRS A;  2OHH A;  5EWA A;  1K07 A;  4DIK A;  3QH8 A;  1QH3 A;  5K4M A;  1ZTC A;  2YCB A;  5KIK A;  3BV6 A;  5A0V A;  1WUP A;  5K4N A;  5LM6 A;  4D1U A;  1JT1 A;  4Z6X A;  2I7T A;  1X8H A;  2FK6 A;  5ACU A;  2Y8A A;  4HL1 A;  4Z67 A;  4B87 A;  4NQ6 A;  4AX1 B;  4BZ3 A;  2FHX B;  2Q0I A;  5DPX A;  3ZWF A;  5EVK A;  3F9O A;  3G1P A;  4UWO B;  4UWP B;  2OHI A;  5ACX A;  2VW8 A;  4GYQ A;  5ACR A;  3R2U A;  1HLK A;  4J5F A;  4C09 A;  1E5D A;  2BG8 B;  1WW1 A;  1A7T A;  4ZO3 A;  1DD6 A;  5A0T A;  3I0V A;  2ZZI A;  3BC2 A;  3SPU A;  3AF5 A;  3X2Z A;  3P2U A;  2DKF A;  2BMI A;  5K4K A;  5A5Z A;  3WXC A;  5ACS A;  3BK1 A;  2FU8 A;  2YZ3 A;  2GMN A;  1X8I A;  4ZO2 A;  3IOF A;  2QDS A;  4EYL A;  5LE1 A;  5LS3 A;  5ACQ A;  4LE6 A;  4UA4 A;  4UAM A;  1DXK A;  3SW3 A;  2OHJ A;  3T3N A;  5HIP A;  3ZR9 A;  4PVT A;  1BVT A;  1JJE A;  1WRA A;  2YNU A;  4Z5Z A;  2YNV A;  2BGA A;  2R2D A;  3PG4 A;  3A4Y A;  3X30 A;  3ESH A;  3I13 A;  4Z7R A;  4C1C A;  1XTO A;  4AWZ A;  4UWR B;  1JJT A;  3T9M A;  5EH9 A;  3MD7 A;  4TZ9 A;  1ZNB A;  2FU7 A;  5LMC A;  3DHA A;  3FAI A;  1X8G A;  2GCU A;  5IQK A;  3IE1 A;  1YCF A;  3LVZ A;  1M2X A;  2BG6 A;  2NYP A;  2Q0J A;  4EYF A;  4C1D A;  1YCG A;  4O98 A;  2I7V A;  2ZO4 A;  2NXA A;  3FCZ A;  4H0D A;  5LCF A;  2BG2 A;  4GYU A;  4GCW A;  2XF4 A;  3IEK A;  5K0W A;  5A87 A;  2UYX A;  4TYF A;  4YSL A;  3PY5 A;  3RKK A;  5AXR A;  5AEB A;  4AD9 A;  2Q42 A;  4RAM A;  4YSK A;  1P9E A;  2ZWR A;  3IOG A;  4D1V A;  4U4L A;  3RPC A;  3KL7 A;  2I7X A;  2BFZ A;  5FQB A;  4EXY A;  2QIN A;  2GFK A;  3IEM A;  2GKL A;  4C1F A;  2HB9 A;  3VPE A;  5LCH A;  2BTN A;  2WYM C;  5ACP A;  3RKJ A;  1A8T A;  3KNR A;  4HL2 A;  5ACV A;  2YNV B;  4BP0 A;  5LCA A;  5AHO A;  1BC2 A;  5HIO A;  4ZEJ A;  4NQ5 A;  2BC2 A;  2FU6 A;  4TZB A;  4ZNB A;  2ZNB A;  3ZQ4 A;  4TYT A;  4RAW A;  3I14 A;  2WHG A;  4EXS A;  3BK2 A;  5B15 A;  2YNW A;  3X2Y A;  2FM6 A;  4Z60 A;  2P18 A;  5FQA A;  2YNT A;  4FEK A;  4PVO A;  3AJ3 A;  4P62 A;  4YSB A;  3Q6V A;  4XWT A;  2BR6 A;  4NQ4 A;  5LSC A;  4C1H A;  3KNS A;  4V0H A;  2Y8B A;  4FSB A;  3I15 A;  1VJN A;  3I11 A;  5EW0 A;  4D1T A;  5EHT A;  2AZ4 A;  4RL2 A;  3VQZ A;  3TP9 A;  3DHC A;  4UBQ A;  2BFK A;  2Y87 A;  4XWW A;  3H3E A;  4RBS A;  5HH4 A;  3PY6 A;  2BIB A;  2BFZ B;  4Z5Y A;  3IE2 A;  5LLD A;  3AF6 A;  2AIO A;  5FQC A;  5EV8 A;  4XUK A;  3T3O A;  2FU9 A;  4KEP A;  4AWY B;  4FR7 A;  2DOO A;  4J5H A;  2Q9U A;  3SFP A;  2BFL A;  4D02 A;  1L9Y A;  4JO0 A;  4KEQ A;  3S0Z A;  4TZE A;  2M5D A;  5ACT A;  5HH6 A;  2QJS A;  5ACW A;  4RM5 A;  4TZF A;  2NZE A;  4UWS B;  4HKY A;  1Y44 A;  2WYM A;  4EY2 A;  5HIS A;  4F6H A;  1QH5 A;  2M5C A;  2YNT B;  4NQ2 A;  2BG7 A;  2NZF A;  2P4Z A;  3L6N A;  4F6Z A;  2GFJ A;  1MQO A;  2FHX A;  1BMC A;  4WD6 A;  1KO2 A;  2QDT A;  5EVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...