4J5FA

Crystal structure of b. thuringiensis aiia mutant f107w
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
250
structure length
250
Chain Sequence
MTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHWDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIETEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords N-acyl homoserine lactonase
publication title A phenylalanine clamp controls substrate specificity in the quorum-quenching metallo-gamma-lactonase from Bacillus thuringiensis.
pubmed doi rcsb
source organism Bacillus thuringiensis
total genus 80
structure length 250
sequence length 250
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2013-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4j5fA01
2OHIA 4UBQA 2BTNA 3DH8A 2BFLA 2BR6A 4C1FA 4PVTA 2Q0IA 5K4MA 3I15A 2BIBA 1HLKA 4HL2A 4F6HA 2QDSA 3SD9A 3PG4A 3I14A 1VGNA 4CHLA 3X30A 2FU8A 5DPXA 5ACUA 3ZR9A 3AF5A 2OHJA 2M5DA 2BG8A 4DILA 1WW1A 3P2UA 3SPUA 1A8TA 4XWTA 2YNTB 2ZZIA 4J5HA 1WUPA 4EYLA 1X8GA 4EYFA 4TZ9A 4UWPB 3A4YA 2Y87A 5ACRA 4YSKA 1DDKA 4C1DA 2P18A 3KNSA 2P97A 3FAIA 5EHTA 5LLDA 1P9EA 3X2ZA 4TZEA 5LM6A 4UWSB 4Z5YA 2WYLA 4D1TA 2BG6A 2AIOA 2QEDA 1K07A 3BV6A 4J5FA 2Y8AA 4Z67A 1KO3A 3IOGA 3ESHA 3T9MA 4BZ3A 2WRSA 2UYXA 1X8IA 2AZ4A 2YNVA 3WXCA 2NZFA 4C1EA 3SRXA 3BK1A 4JO0A 1M2XA 4D02A 5EVKA 2R2DA 1YCFA 4UWOB 5LCAA 2GFJA 3Q6VA 4UAMA 5LSCA 3IEMA 5EW0A 5ACPA 5KIKA 5HIPA 4Z60A 4GYQA 4EXSA 4EYBA 4GYUA 4XUKA 1XM8A 1ZNBA 3L6NA 5ACQA 1KO2A 5AEBA 2FHXB 5HIOA 3ZQ4A 5EVDA 3BC2A 3I13A 4ZO2A 5LS3A 2QJSA 3AF6A 5EV6A 1XTOA 3IE0A 2YCBA 4FR7A 2QDTA 4AWZA 2NYPA 2WHGA 3FCZA 2GFKA 2BMIA 2H6AA 4LE6A 1WRAA 2I7XA 2OHHA 4UWRB 2BG2A 1ZKPA 3KL7A 3MD7A 2Q9UA 2FK6A 2HB9A 1L9YA 3DHAA 4DIKA 3VQZA 2WYMA 4ZNBA 4V0HA 2ZO4A 3RKJA 3KNRA 2BG7A 5KILA 4TYTA 3SW3A 1BC2A 3IEKA 2CBNA 4EY2A 4O98A 5HH4A 2XF4A 2Y8BA 4D1UA 3BK2A 1BVTA 1SMLA 5B1UA 1YCHA 2YNVB 3ADRA 5EVBA 3VPEA 5ACTA 4RAWA 5A0VA 2YNTA 4NQ5A 1X8HA 1YCGA 5LCHA 2I7TA 3QH8A 4C1HA 2XR1A 3IE1A 2VW8A 4XWWA 3JXPA 5A5ZA 1WUOA 1KR3A 2BFZB 2GKLA 2M5CA 5K0WA 3IELA 4YSBA 3I0VA 5FQCA 2GCUA 3X2YA 3AJ3A 1JJEA 2WYMC 2YNUA 3SBLA 4EFZA 1VMEA 2NXAA 3DHBA 4P62A 4F6ZA 4ZO3A 3ZWFA 5HH6A 2FU9A 2P4ZA 3R2UA 4UA4A 4BP0A 4TYFA 5B15A 2BFKA 2ZNBA 4RBSA 5FQBA 5HIQA 3PY6A 4D1WA 1A7TA 5ACWA 2BG8B 2DOOA 2Q0JA 5LE1A 4KEQA 4TZFA 4AD9A 3RKKA 2E7YA 4RAMA 4C1GA 1JT1A 1QH3A 5HISA 5IQKA 5AXOA 4RL2A 2QINA 3ZNBA 4TZBA 4NQ4A 4AWYB 1DD6A 2P1EA 2A7MA 3SFPA 1E5DA 5LMCA 5K4KA 5AYAA 3IE2A 2FHXA 5FQAA 4B87A 4FEKA 4WD6A 5ACXA 5AXRA 4EXYA 1JJTA 2YNWA 2I7VA 2FU7A 2ZWRA 1QH5A 4U4LA 5ACSA 5EWAA 4NQ6A 3I11A 4YSLA 4HL1A 3G1PA 2NZEA 3RPCA 5EV8A 1Y44A 3X2XA 3DHCA 1VJNA 4Z7RA 5B3RA 3S0ZA 3T3NA 5A0TA 3PY5A 3F9OA 3TP9A 5AHRA 4RL0A 5ACVA 5HH5A 4AX0B 2FU6A 4ZEJA 4D1VA 4C1CA 5LCFA 3H3EA 5AHOA 3IDZA 4AX1B 2YZ3A 4Z5ZA 4KEPA 4GCWA 2DKFA 5A87A 4NQ2A 5EH9A 3T3OA 4Z6XA 1DXKA 3IOFA 4PVOA 4H0DA 1MQOA 2Q42A 2BC2A 4HKYA 2BGAA 2BFZA 4RM5A 5K4NA 2GMNA 1ZTCA 2FM6A 1BMCA 4C09A 3LVZA 4FSBA
chains in the Genus database with same CATH superfamily
2OHIA 4UBQA 2BTNA 3DH8A 2BFLA 2BR6A 4C1FA 4PVTA 2Q0IA 5K4MA 3I15A 2BIBA 1HLKA 4HL2A 4F6HA 2QDSA 3SD9A 3PG4A 3I14A 1VGNA 4CHLA 3X30A 2FU8A 5DPXA 5ACUA 3ZR9A 3AF5A 2OHJA 2M5DA 2BG8A 4DILA 1WW1A 3P2UA 3SPUA 1A8TA 4XWTA 2YNTB 2ZZIA 4J5HA 1WUPA 4EYLA 1X8GA 4EYFA 4TZ9A 4UWPB 3A4YA 2Y87A 5ACRA 4YSKA 1DDKA 4C1DA 4NURA 2P18A 3KNSA 2P97A 3FAIA 5EHTA 5LLDA 1P9EA 3X2ZA 4TZEA 5LM6A 4UWSB 4Z5YA 2WYLA 4D1TA 2BG6A 2AIOA 2QEDA 1K07A 3BV6A 4J5FA 2Y8AA 4Z67A 1KO3A 3IOGA 3ESHA 3T9MA 4BZ3A 2WRSA 2UYXA 1X8IA 2AZ4A 2YNVA 3WXCA 2NZFA 4C1EA 3SRXA 3BK1A 4JO0A 1M2XA 4D02A 5EVKA 2R2DA 1YCFA 4UWOB 5LCAA 2GFJA 3Q6VA 4UAMA 5LSCA 3IEMA 5EW0A 5ACPA 5KIKA 5HIPA 4Z60A 4GYQA 4EXSA 4EYBA 4GYUA 4XUKA 1XM8A 1ZNBA 3L6NA 5ACQA 1KO2A 5AEBA 2FHXB 5HIOA 3ZQ4A 5EVDA 3BC2A 3I13A 4ZO2A 5LS3A 2CG3A 2QJSA 3AF6A 5A23A 5EV6A 1XTOA 3IE0A 2YCBA 4FR7A 2QDTA 4AWZA 4AXHA 2NYPA 2WHGA 3FCZA 2GFKA 2BMIA 2H6AA 4LE6A 1WRAA 2I7XA 2OHHA 4UWRB 2BG2A 1ZKPA 3KL7A 3MD7A 2Q9UA 2FK6A 2HB9A 1L9YA 3DHAA 4DIKA 3VQZA 2WYMA 4ZNBA 4V0HA 2ZO4A 3RKJA 3KNRA 2BG7A 2CG2A 5KILA 4TYTA 3SW3A 1BC2A 3IEKA 2CBNA 4EY2A 4O98A 5HH4A 2XF4A 2Y8BA 5AIJA 4D1UA 3BK2A 1BVTA 2CFZA 1SMLA 5B1UA 1YCHA 2YNVB 3ADRA 5EVBA 3VPEA 5ACTA 4RAWA 5A0VA 2YNTA 4NQ5A 1X8HA 1YCGA 5LCHA 2I7TA 3QH8A 4C1HA 2XR1A 3IE1A 2VW8A 4XWWA 3JXPA 5A5ZA 1WUOA 1KR3A 2BFZB 2GKLA 2M5CA 5K0WA 3IELA 4YSBA 3I0VA 5FQCA 2GCUA 3X2YA 5AJLA 3AJ3A 2YHEA 1JJEA 2WYMC 2YNUA 3SBLA 4EFZA 1VMEA 2NXAA 3DHBA 4P62A 4F6ZA 4ZO3A 3ZWFA 5HH6A 2FU9A 2P4ZA 3R2UA 4UA4A 4BP0A 4TYFA 5B15A 2BFKA 2ZNBA 4RBSA 5FQBA 5HIQA 3PY6A 4D1WA 1A7TA 5ACWA 2BG8B 2DOOA 2Q0JA 5LE1A 4KEQA 4TZFA 4AD9A 3RKKA 2E7YA 4RAMA 4C1GA 1JT1A 1QH3A 5HISA 5IQKA 5AXOA 4RL2A 2QINA 3ZNBA 4TZBA 4NQ4A 4AWYB 1DD6A 2P1EA 2A7MA 3SFPA 1E5DA 5LMCA 5K4KA 5AYAA 3IE2A 2FHXA 5FQAA 4B87A 4FEKA 4WD6A 5ACXA 5AXRA 4EXYA 1JJTA 2YNWA 4AV7A 2I7VA 2FU7A 2ZWRA 1QH5A 4U4LA 5ACSA 5EWAA 4NQ6A 3I11A 4YSLA 4HL1A 3G1PA 2NZEA 3RPCA 5EV8A 1Y44A 3X2XA 3DHCA 1VJNA 4Z7RA 5B3RA 3S0ZA 3T3NA 5A0TA 2CFUA 3PY5A 3F9OA 3TP9A 5AHRA 4RL0A 5ACVA 5HH5A 4AX0B 2FU6A 4ZEJA 4D1VA 4C1CA 5LCFA 3H3EA 5AHOA 3IDZA 4AX1B 2YZ3A 4Z5ZA 4KEPA 4GCWA 2DKFA 5A87A 4NQ2A 5EH9A 3T3OA 4Z6XA 1DXKA 3IOFA 4PVOA 4H0DA 4PDXA 1MQOA 2Q42A 2BC2A 4HKYA 2BGAA 2BFZA 4RM5A 5K4NA 2GMNA 1ZTCA 2FM6A 1BMCA 4C09A 3LVZA 4FSBA
chains in the Genus database with same CATH topology
2OHIA 4UBQA 2BTNA 3DH8A 2BFLA 2BR6A 4C1FA 4PVTA 2Q0IA 5K4MA 3I15A 2BIBA 1HLKA 4HL2A 4F6HA 2QDSA 3SD9A 3PG4A 3I14A 1VGNA 4CHLA 3X30A 2FU8A 5DPXA 5ACUA 3ZR9A 3AF5A 2OHJA 2M5DA 2BG8A 4DILA 1WW1A 3P2UA 3SPUA 1A8TA 4XWTA 2YNTB 2ZZIA 4J5HA 1WUPA 4EYLA 1X8GA 4EYFA 4TZ9A 4UWPB 3A4YA 2Y87A 5ACRA 4YSKA 1DDKA 4C1DA 2P18A 3KNSA 2P97A 3FAIA 5EHTA 5LLDA 1P9EA 3X2ZA 4TZEA 5LM6A 4UWSB 4Z5YA 2WYLA 4D1TA 2BG6A 2AIOA 2QEDA 1K07A 3BV6A 4J5FA 2Y8AA 4Z67A 1KO3A 3IOGA 3ESHA 3T9MA 4BZ3A 2WRSA 2UYXA 1X8IA 2AZ4A 2YNVA 3WXCA 2NZFA 4C1EA 3SRXA 3BK1A 4JO0A 1M2XA 4D02A 5EVKA 2R2DA 1YCFA 4UWOB 5LCAA 2GFJA 3Q6VA 4UAMA 5LSCA 3IEMA 5EW0A 5ACPA 5KIKA 5HIPA 4Z60A 4GYQA 4EXSA 4EYBA 4GYUA 4XUKA 1XM8A 1ZNBA 3L6NA 5ACQA 1KO2A 5AEBA 2FHXB 5HIOA 3ZQ4A 5EVDA 3BC2A 3I13A 4ZO2A 5LS3A 2QJSA 3AF6A 5EV6A 1XTOA 3IE0A 2YCBA 4FR7A 2QDTA 4AWZA 2NYPA 2WHGA 3FCZA 2GFKA 2BMIA 2H6AA 4LE6A 1WRAA 2I7XA 2OHHA 4UWRB 2BG2A 1ZKPA 3KL7A 3MD7A 2Q9UA 2FK6A 2HB9A 1L9YA 3DHAA 4DIKA 3VQZA 2WYMA 4ZNBA 4V0HA 2ZO4A 3RKJA 3KNRA 2BG7A 5KILA 4TYTA 3SW3A 1BC2A 3IEKA 2CBNA 4EY2A 4O98A 5HH4A 2XF4A 2Y8BA 4D1UA 3BK2A 1BVTA 1SMLA 5B1UA 1YCHA 2YNVB 3ADRA 5EVBA 3VPEA 5ACTA 4RAWA 5A0VA 2YNTA 4NQ5A 1X8HA 1YCGA 5LCHA 2I7TA 3QH8A 4C1HA 2XR1A 3IE1A 2VW8A 4XWWA 3JXPA 5A5ZA 1WUOA 1KR3A 2BFZB 2GKLA 2M5CA 5K0WA 3IELA 4YSBA 3I0VA 5FQCA 2GCUA 3X2YA 3AJ3A 1JJEA 2WYMC 2YNUA 3SBLA 4EFZA 1VMEA 2NXAA 3DHBA 4P62A 4F6ZA 4ZO3A 3ZWFA 5HH6A 2FU9A 2P4ZA 3R2UA 4UA4A 4BP0A 4TYFA 5B15A 2BFKA 2ZNBA 4RBSA 5FQBA 5HIQA 3PY6A 4D1WA 1A7TA 5ACWA 2BG8B 2DOOA 2Q0JA 5LE1A 4KEQA 4TZFA 4AD9A 3RKKA 2E7YA 4RAMA 4C1GA 1JT1A 1QH3A 5HISA 5IQKA 5AXOA 4RL2A 2QINA 3ZNBA 4TZBA 4NQ4A 4AWYB 1DD6A 2P1EA 2A7MA 3SFPA 1E5DA 5LMCA 5K4KA 5AYAA 3IE2A 2FHXA 5FQAA 4B87A 4FEKA 4WD6A 5ACXA 5AXRA 4EXYA 1JJTA 2YNWA 2I7VA 2FU7A 2ZWRA 1QH5A 4U4LA 5ACSA 5EWAA 4NQ6A 3I11A 4YSLA 4HL1A 3G1PA 2NZEA 3RPCA 5EV8A 1Y44A 3X2XA 3DHCA 1VJNA 4Z7RA 5B3RA 3S0ZA 3T3NA 5A0TA 3PY5A 3F9OA 3TP9A 5AHRA 4RL0A 5ACVA 5HH5A 4AX0B 2FU6A 4ZEJA 4D1VA 4C1CA 5LCFA 3H3EA 5AHOA 3IDZA 4AX1B 2YZ3A 4Z5ZA 4KEPA 4GCWA 2DKFA 5A87A 4NQ2A 5EH9A 3T3OA 4Z6XA 1DXKA 3IOFA 4PVOA 4H0DA 1MQOA 2Q42A 2BC2A 4HKYA 2BGAA 2BFZA 4RM5A 5K4NA 2GMNA 1ZTCA 2FM6A 1BMCA 4C09A 3LVZA 4FSBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OHI A;  4UBQ A;  2BTN A;  3DH8 A;  2BFL A;  2BR6 A;  4C1F A;  4PVT A;  2Q0I A;  5K4M A;  3I15 A;  2BIB A;  1HLK A;  4HL2 A;  4F6H A;  2QDS A;  3SD9 A;  3PG4 A;  3I14 A;  1VGN A;  4CHL A;  3X30 A;  2FU8 A;  5DPX A;  5ACU A;  3ZR9 A;  3AF5 A;  2OHJ A;  2M5D A;  2BG8 A;  4DIL A;  1WW1 A;  3P2U A;  3SPU A;  1A8T A;  4XWT A;  2YNT B;  2ZZI A;  4J5H A;  1WUP A;  4EYL A;  1X8G A;  4EYF A;  4TZ9 A;  4UWP B;  3A4Y A;  2Y87 A;  5ACR A;  4YSK A;  1DDK A;  4C1D A;  2P18 A;  3KNS A;  2P97 A;  3FAI A;  5EHT A;  5LLD A;  1P9E A;  3X2Z A;  4TZE A;  5LM6 A;  4UWS B;  4Z5Y A;  2WYL A;  4D1T A;  2BG6 A;  2AIO A;  2QED A;  1K07 A;  3BV6 A;  4J5F A;  2Y8A A;  4Z67 A;  1KO3 A;  3IOG A;  3ESH A;  3T9M A;  4BZ3 A;  2WRS A;  2UYX A;  1X8I A;  2AZ4 A;  2YNV A;  3WXC A;  2NZF A;  4C1E A;  3SRX A;  3BK1 A;  4JO0 A;  1M2X A;  4D02 A;  5EVK A;  2R2D A;  1YCF A;  4UWO B;  5LCA A;  2GFJ A;  3Q6V A;  4UAM A;  5LSC A;  3IEM A;  5EW0 A;  5ACP A;  5KIK A;  5HIP A;  4Z60 A;  4GYQ A;  4EXS A;  4EYB A;  4GYU A;  4XUK A;  1XM8 A;  1ZNB A;  3L6N A;  5ACQ A;  1KO2 A;  5AEB A;  2FHX B;  5HIO A;  3ZQ4 A;  5EVD A;  3BC2 A;  3I13 A;  4ZO2 A;  5LS3 A;  2QJS A;  3AF6 A;  5EV6 A;  1XTO A;  3IE0 A;  2YCB A;  4FR7 A;  2QDT A;  4AWZ A;  2NYP A;  2WHG A;  3FCZ A;  2GFK A;  2BMI A;  2H6A A;  4LE6 A;  1WRA A;  2I7X A;  2OHH A;  4UWR B;  2BG2 A;  1ZKP A;  3KL7 A;  3MD7 A;  2Q9U A;  2FK6 A;  2HB9 A;  1L9Y A;  3DHA A;  4DIK A;  3VQZ A;  2WYM A;  4ZNB A;  4V0H A;  2ZO4 A;  3RKJ A;  3KNR A;  2BG7 A;  5KIL A;  4TYT A;  3SW3 A;  1BC2 A;  3IEK A;  2CBN A;  4EY2 A;  4O98 A;  5HH4 A;  2XF4 A;  2Y8B A;  4D1U A;  3BK2 A;  1BVT A;  1SML A;  5B1U A;  1YCH A;  2YNV B;  3ADR A;  5EVB A;  3VPE A;  5ACT A;  4RAW A;  5A0V A;  2YNT A;  4NQ5 A;  1X8H A;  1YCG A;  5LCH A;  2I7T A;  3QH8 A;  4C1H A;  2XR1 A;  3IE1 A;  2VW8 A;  4XWW A;  3JXP A;  5A5Z A;  1WUO A;  1KR3 A;  2BFZ B;  2GKL A;  2M5C A;  5K0W A;  3IEL A;  4YSB A;  3I0V A;  5FQC A;  2GCU A;  3X2Y A;  3AJ3 A;  1JJE A;  2WYM C;  2YNU A;  3SBL A;  4EFZ A;  1VME A;  2NXA A;  3DHB A;  4P62 A;  4F6Z A;  4ZO3 A;  3ZWF A;  5HH6 A;  2FU9 A;  2P4Z A;  3R2U A;  4UA4 A;  4BP0 A;  4TYF A;  5B15 A;  2BFK A;  2ZNB A;  4RBS A;  5FQB A;  5HIQ A;  3PY6 A;  4D1W A;  1A7T A;  5ACW A;  2BG8 B;  2DOO A;  2Q0J A;  5LE1 A;  4KEQ A;  4TZF A;  4AD9 A;  3RKK A;  2E7Y A;  4RAM A;  4C1G A;  1JT1 A;  1QH3 A;  5HIS A;  5IQK A;  5AXO A;  4RL2 A;  2QIN A;  3ZNB A;  4TZB A;  4NQ4 A;  4AWY B;  1DD6 A;  2P1E A;  2A7M A;  3SFP A;  1E5D A;  5LMC A;  5K4K A;  5AYA A;  3IE2 A;  2FHX A;  5FQA A;  4B87 A;  4FEK A;  4WD6 A;  5ACX A;  5AXR A;  4EXY A;  1JJT A;  2YNW A;  2I7V A;  2FU7 A;  2ZWR A;  1QH5 A;  4U4L A;  5ACS A;  5EWA A;  4NQ6 A;  3I11 A;  4YSL A;  4HL1 A;  3G1P A;  2NZE A;  3RPC A;  5EV8 A;  1Y44 A;  3X2X A;  3DHC A;  1VJN A;  4Z7R A;  5B3R A;  3S0Z A;  3T3N A;  5A0T A;  3PY5 A;  3F9O A;  3TP9 A;  5AHR A;  4RL0 A;  5ACV A;  5HH5 A;  4AX0 B;  2FU6 A;  4ZEJ A;  4D1V A;  4C1C A;  5LCF A;  3H3E A;  5AHO A;  3IDZ A;  4AX1 B;  2YZ3 A;  4Z5Z A;  4KEP A;  4GCW A;  2DKF A;  5A87 A;  4NQ2 A;  5EH9 A;  3T3O A;  4Z6X A;  1DXK A;  3IOF A;  4PVO A;  4H0D A;  1MQO A;  2Q42 A;  2BC2 A;  4HKY A;  2BGA A;  2BFZ A;  4RM5 A;  5K4N A;  2GMN A;  1ZTC A;  2FM6 A;  1BMC A;  4C09 A;  3LVZ A;  4FSB A; 
#chains in the Genus database with same CATH topology
 2OHI A;  4UBQ A;  2BTN A;  3DH8 A;  2BFL A;  2BR6 A;  4C1F A;  4PVT A;  2Q0I A;  5K4M A;  3I15 A;  2BIB A;  1HLK A;  4HL2 A;  4F6H A;  2QDS A;  3SD9 A;  3PG4 A;  3I14 A;  1VGN A;  4CHL A;  3X30 A;  2FU8 A;  5DPX A;  5ACU A;  3ZR9 A;  3AF5 A;  2OHJ A;  2M5D A;  2BG8 A;  4DIL A;  1WW1 A;  3P2U A;  3SPU A;  1A8T A;  4XWT A;  2YNT B;  2ZZI A;  4J5H A;  1WUP A;  4EYL A;  1X8G A;  4EYF A;  4TZ9 A;  4UWP B;  3A4Y A;  2Y87 A;  5ACR A;  4YSK A;  1DDK A;  4C1D A;  4NUR A;  2P18 A;  3KNS A;  2P97 A;  3FAI A;  5EHT A;  5LLD A;  1P9E A;  3X2Z A;  4TZE A;  5LM6 A;  4UWS B;  4Z5Y A;  2WYL A;  4D1T A;  2BG6 A;  2AIO A;  2QED A;  1K07 A;  3BV6 A;  4J5F A;  2Y8A A;  4Z67 A;  1KO3 A;  3IOG A;  3ESH A;  3T9M A;  4BZ3 A;  2WRS A;  2UYX A;  1X8I A;  2AZ4 A;  2YNV A;  3WXC A;  2NZF A;  4C1E A;  3SRX A;  3BK1 A;  4JO0 A;  1M2X A;  4D02 A;  5EVK A;  2R2D A;  1YCF A;  4UWO B;  5LCA A;  2GFJ A;  3Q6V A;  4UAM A;  5LSC A;  3IEM A;  5EW0 A;  5ACP A;  5KIK A;  5HIP A;  4Z60 A;  4GYQ A;  4EXS A;  4EYB A;  4GYU A;  4XUK A;  1XM8 A;  1ZNB A;  3L6N A;  5ACQ A;  1KO2 A;  5AEB A;  2FHX B;  5HIO A;  3ZQ4 A;  5EVD A;  3BC2 A;  3I13 A;  4ZO2 A;  5LS3 A;  2CG3 A;  2QJS A;  3AF6 A;  5A23 A;  5EV6 A;  1XTO A;  3IE0 A;  2YCB A;  4FR7 A;  2QDT A;  4AWZ A;  4AXH A;  2NYP A;  2WHG A;  3FCZ A;  2GFK A;  2BMI A;  2H6A A;  4LE6 A;  1WRA A;  2I7X A;  2OHH A;  4UWR B;  2BG2 A;  1ZKP A;  3KL7 A;  3MD7 A;  2Q9U A;  2FK6 A;  2HB9 A;  1L9Y A;  3DHA A;  4DIK A;  3VQZ A;  2WYM A;  4ZNB A;  4V0H A;  2ZO4 A;  3RKJ A;  3KNR A;  2BG7 A;  2CG2 A;  5KIL A;  4TYT A;  3SW3 A;  1BC2 A;  3IEK A;  2CBN A;  4EY2 A;  4O98 A;  5HH4 A;  2XF4 A;  2Y8B A;  5AIJ A;  4D1U A;  3BK2 A;  1BVT A;  2CFZ A;  1SML A;  5B1U A;  1YCH A;  2YNV B;  3ADR A;  5EVB A;  3VPE A;  5ACT A;  4RAW A;  5A0V A;  2YNT A;  4NQ5 A;  1X8H A;  1YCG A;  5LCH A;  2I7T A;  3QH8 A;  4C1H A;  2XR1 A;  3IE1 A;  2VW8 A;  4XWW A;  3JXP A;  5A5Z A;  1WUO A;  1KR3 A;  2BFZ B;  2GKL A;  2M5C A;  5K0W A;  3IEL A;  4YSB A;  3I0V A;  5FQC A;  2GCU A;  3X2Y A;  5AJL A;  3AJ3 A;  2YHE A;  1JJE A;  2WYM C;  2YNU A;  3SBL A;  4EFZ A;  1VME A;  2NXA A;  3DHB A;  4P62 A;  4F6Z A;  4ZO3 A;  3ZWF A;  5HH6 A;  2FU9 A;  2P4Z A;  3R2U A;  4UA4 A;  4BP0 A;  4TYF A;  5B15 A;  2BFK A;  2ZNB A;  4RBS A;  5FQB A;  5HIQ A;  3PY6 A;  4D1W A;  1A7T A;  5ACW A;  2BG8 B;  2DOO A;  2Q0J A;  5LE1 A;  4KEQ A;  4TZF A;  4AD9 A;  3RKK A;  2E7Y A;  4RAM A;  4C1G A;  1JT1 A;  1QH3 A;  5HIS A;  5IQK A;  5AXO A;  4RL2 A;  2QIN A;  3ZNB A;  4TZB A;  4NQ4 A;  4AWY B;  1DD6 A;  2P1E A;  2A7M A;  3SFP A;  1E5D A;  5LMC A;  5K4K A;  5AYA A;  3IE2 A;  2FHX A;  5FQA A;  4B87 A;  4FEK A;  4WD6 A;  5ACX A;  5AXR A;  4EXY A;  1JJT A;  2YNW A;  4AV7 A;  2I7V A;  2FU7 A;  2ZWR A;  1QH5 A;  4U4L A;  5ACS A;  5EWA A;  4NQ6 A;  3I11 A;  4YSL A;  4HL1 A;  3G1P A;  2NZE A;  3RPC A;  5EV8 A;  1Y44 A;  3X2X A;  3DHC A;  1VJN A;  4Z7R A;  5B3R A;  3S0Z A;  3T3N A;  5A0T A;  2CFU A;  3PY5 A;  3F9O A;  3TP9 A;  5AHR A;  4RL0 A;  5ACV A;  5HH5 A;  4AX0 B;  2FU6 A;  4ZEJ A;  4D1V A;  4C1C A;  5LCF A;  3H3E A;  5AHO A;  3IDZ A;  4AX1 B;  2YZ3 A;  4Z5Z A;  4KEP A;  4GCW A;  2DKF A;  5A87 A;  4NQ2 A;  5EH9 A;  3T3O A;  4Z6X A;  1DXK A;  3IOF A;  4PVO A;  4H0D A;  4PDX A;  1MQO A;  2Q42 A;  2BC2 A;  4HKY A;  2BGA A;  2BFZ A;  4RM5 A;  5K4N A;  2GMN A;  1ZTC A;  2FM6 A;  1BMC A;  4C09 A;  3LVZ A;  4FSB A; 
#chains in the Genus database with same CATH homology
 2OHI A;  4UBQ A;  2BTN A;  3DH8 A;  2BFL A;  2BR6 A;  4C1F A;  4PVT A;  2Q0I A;  5K4M A;  3I15 A;  2BIB A;  1HLK A;  4HL2 A;  4F6H A;  2QDS A;  3SD9 A;  3PG4 A;  3I14 A;  1VGN A;  4CHL A;  3X30 A;  2FU8 A;  5DPX A;  5ACU A;  3ZR9 A;  3AF5 A;  2OHJ A;  2M5D A;  2BG8 A;  4DIL A;  1WW1 A;  3P2U A;  3SPU A;  1A8T A;  4XWT A;  2YNT B;  2ZZI A;  4J5H A;  1WUP A;  4EYL A;  1X8G A;  4EYF A;  4TZ9 A;  4UWP B;  3A4Y A;  2Y87 A;  5ACR A;  4YSK A;  1DDK A;  4C1D A;  2P18 A;  3KNS A;  2P97 A;  3FAI A;  5EHT A;  5LLD A;  1P9E A;  3X2Z A;  4TZE A;  5LM6 A;  4UWS B;  4Z5Y A;  2WYL A;  4D1T A;  2BG6 A;  2AIO A;  2QED A;  1K07 A;  3BV6 A;  4J5F A;  2Y8A A;  4Z67 A;  1KO3 A;  3IOG A;  3ESH A;  3T9M A;  4BZ3 A;  2WRS A;  2UYX A;  1X8I A;  2AZ4 A;  2YNV A;  3WXC A;  2NZF A;  4C1E A;  3SRX A;  3BK1 A;  4JO0 A;  1M2X A;  4D02 A;  5EVK A;  2R2D A;  1YCF A;  4UWO B;  5LCA A;  2GFJ A;  3Q6V A;  4UAM A;  5LSC A;  3IEM A;  5EW0 A;  5ACP A;  5KIK A;  5HIP A;  4Z60 A;  4GYQ A;  4EXS A;  4EYB A;  4GYU A;  4XUK A;  1XM8 A;  1ZNB A;  3L6N A;  5ACQ A;  1KO2 A;  5AEB A;  2FHX B;  5HIO A;  3ZQ4 A;  5EVD A;  3BC2 A;  3I13 A;  4ZO2 A;  5LS3 A;  2QJS A;  3AF6 A;  5EV6 A;  1XTO A;  3IE0 A;  2YCB A;  4FR7 A;  2QDT A;  4AWZ A;  2NYP A;  2WHG A;  3FCZ A;  2GFK A;  2BMI A;  2H6A A;  4LE6 A;  1WRA A;  2I7X A;  2OHH A;  4UWR B;  2BG2 A;  1ZKP A;  3KL7 A;  3MD7 A;  2Q9U A;  2FK6 A;  2HB9 A;  1L9Y A;  3DHA A;  4DIK A;  3VQZ A;  2WYM A;  4ZNB A;  4V0H A;  2ZO4 A;  3RKJ A;  3KNR A;  2BG7 A;  5KIL A;  4TYT A;  3SW3 A;  1BC2 A;  3IEK A;  2CBN A;  4EY2 A;  4O98 A;  5HH4 A;  2XF4 A;  2Y8B A;  4D1U A;  3BK2 A;  1BVT A;  1SML A;  5B1U A;  1YCH A;  2YNV B;  3ADR A;  5EVB A;  3VPE A;  5ACT A;  4RAW A;  5A0V A;  2YNT A;  4NQ5 A;  1X8H A;  1YCG A;  5LCH A;  2I7T A;  3QH8 A;  4C1H A;  2XR1 A;  3IE1 A;  2VW8 A;  4XWW A;  3JXP A;  5A5Z A;  1WUO A;  1KR3 A;  2BFZ B;  2GKL A;  2M5C A;  5K0W A;  3IEL A;  4YSB A;  3I0V A;  5FQC A;  2GCU A;  3X2Y A;  3AJ3 A;  1JJE A;  2WYM C;  2YNU A;  3SBL A;  4EFZ A;  1VME A;  2NXA A;  3DHB A;  4P62 A;  4F6Z A;  4ZO3 A;  3ZWF A;  5HH6 A;  2FU9 A;  2P4Z A;  3R2U A;  4UA4 A;  4BP0 A;  4TYF A;  5B15 A;  2BFK A;  2ZNB A;  4RBS A;  5FQB A;  5HIQ A;  3PY6 A;  4D1W A;  1A7T A;  5ACW A;  2BG8 B;  2DOO A;  2Q0J A;  5LE1 A;  4KEQ A;  4TZF A;  4AD9 A;  3RKK A;  2E7Y A;  4RAM A;  4C1G A;  1JT1 A;  1QH3 A;  5HIS A;  5IQK A;  5AXO A;  4RL2 A;  2QIN A;  3ZNB A;  4TZB A;  4NQ4 A;  4AWY B;  1DD6 A;  2P1E A;  2A7M A;  3SFP A;  1E5D A;  5LMC A;  5K4K A;  5AYA A;  3IE2 A;  2FHX A;  5FQA A;  4B87 A;  4FEK A;  4WD6 A;  5ACX A;  5AXR A;  4EXY A;  1JJT A;  2YNW A;  2I7V A;  2FU7 A;  2ZWR A;  1QH5 A;  4U4L A;  5ACS A;  5EWA A;  4NQ6 A;  3I11 A;  4YSL A;  4HL1 A;  3G1P A;  2NZE A;  3RPC A;  5EV8 A;  1Y44 A;  3X2X A;  3DHC A;  1VJN A;  4Z7R A;  5B3R A;  3S0Z A;  3T3N A;  5A0T A;  3PY5 A;  3F9O A;  3TP9 A;  5AHR A;  4RL0 A;  5ACV A;  5HH5 A;  4AX0 B;  2FU6 A;  4ZEJ A;  4D1V A;  4C1C A;  5LCF A;  3H3E A;  5AHO A;  3IDZ A;  4AX1 B;  2YZ3 A;  4Z5Z A;  4KEP A;  4GCW A;  2DKF A;  5A87 A;  4NQ2 A;  5EH9 A;  3T3O A;  4Z6X A;  1DXK A;  3IOF A;  4PVO A;  4H0D A;  1MQO A;  2Q42 A;  2BC2 A;  4HKY A;  2BGA A;  2BFZ A;  4RM5 A;  5K4N A;  2GMN A;  1ZTC A;  2FM6 A;  1BMC A;  4C09 A;  3LVZ A;  4FSB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...