4J5FA

Crystal structure of b. thuringiensis aiia mutant f107w
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
250
structure length
250
Chain Sequence
MTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHWDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIETEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acyl homoserine lactonase
publication title A phenylalanine clamp controls substrate specificity in the quorum-quenching metallo-gamma-lactonase from Bacillus thuringiensis.
pubmed doi rcsb
source organism Bacillus thuringiensis
molecule tags Hydrolase
total genus 80
structure length 250
sequence length 250
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2013-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4j5fA01
4GYQA 3WXCA 4O98A 4C1FA 4C1GA 5EH9A 5A0TA 1XTOA 4TYFA 4D1WA 2OHHA 2Q0JA 4EYFA 1DXKA 3IOGA 2FK6A 3T9MA 5A0VA 2FU9A 4HKYA 5EV6A 5ACPA 4TYTA 4FEKA 4UWRB 2WRSA 3ZQ4A 4Z60A 1MQOA 5HIQA 1ZTCA 1ZNBA 5ACVA 1A7TA 2QDTA 4HL2A 3Q6VA 2BG8A 4Z5YA 4EFZA 2P1EA 1X8HA 5HH6A 3R2UA 3SW3A 4CHLA 1QH3A 1KO2A 2Y8AA 2YNVB 3PG4A 4U4LA 5ACTA 2YCBA 1YCFA 5A87A 2DOOA 3IE2A 4KEPA 4AX0B 4TZFA 4WD6A 1ZKPA 5K0WA 2YNTB 5LLDA 4RL0A 4B87A 1VMEA 2GKLA 4KEQA 4P62A 2WHGA 2GFJA 4BP0A 2M5DA 3I11A 3X2XA 2P97A 4LE6A 3A4YA 2ZNBA 1WUOA 2XF4A 4Z5ZA 2WYMA 3T3NA 4TZ9A 5LCHA 3JXPA 2YZ3A 4DIKA 5HISA 4YSBA 5LCFA 4XUKA 3VQZA 1VGNA 1YCGA 3ZNBA 2VW8A 4EXYA 3X30A 4EY2A 5B15A 3RKKA 2Q9UA 4AX1B 5EVBA 3DHAA 4D02A 1X8GA 1SMLA 2OHIA 3L6NA 1L9YA 3LVZA 1BC2A 1P9EA 5ACWA 5KILA 1E5DA 4ZO2A 4GCWA 2QINA 2I7TA 4TZBA 2Q0IA 2YNVA 1YCHA 1A8TA 5ACUA 3H3EA 4J5FA 1X8IA 2DKFA 2YNTA 4FSBA 1WW1A 2GMNA 5DPXA 3TP9A 3SPUA 2BR6A 5LE1A 3AF6A 2AZ4A 5AHOA 4RL2A 4D1VA 4XWTA 4C09A 2WYLA 3BV6A 1DDKA 5ACQA 2H6AA 1WRAA 4FR7A 2P4ZA 2UYXA 5FQAA 3I15A 2XR1A 2BIBA 5EV8A 4PVTA 4NQ4A 5HIOA 2I7XA 3P2UA 3X2YA 4YSKA 5FQBA 2OHJA 2BG7A 4RAWA 4F6ZA 2Q42A 3G1PA 3AF5A 2BC2A 4RAMA 5K4MA 3I13A 4UWPB 3DHBA 5A5ZA 2FU7A 4EXSA 5KIKA 3S0ZA 4D1TA 5B1UA 3ZWFA 1BMCA 2M5CA 3FAIA 2FU6A 3KL7A 5AEBA 2NXAA 4UAMA 5EW0A 5K4KA 4UWSB 3RPCA 2FM6A 3BK2A 2FHXB 4AWZA 2BFZB 2Y8BA 1K07A 4ZO3A 3SD9A 4RBSA 2BG2A 5LM6A 3MD7A 3IDZA 4PVOA 2WYMC 4D1UA 4EYLA 4EYBA 5IQKA 3T3OA 3VPEA 2BFKA 4AD9A 3PY6A 4V0HA 4DILA 1JJTA 1BVTA 3KNRA 5FQCA 2BMIA 4ZEJA 3BK1A 3DHCA 5AXOA 3IE0A 4H0DA 4J5HA 3ADRA 2ZO4A 5LSCA 1VJNA 4GYUA 5EVDA 5LMCA 3IEKA 5HIPA 3ESHA 4BZ3A 1KO3A 2HB9A 2E7YA 2NYPA 4F6HA 4TZEA 5LS3A 4C1EA 2ZWRA 2QJSA 3IEMA 4YSLA 5AYAA 1QH5A 5HH4A 3KNSA 5AXRA 1M2XA 2A7MA 3IELA 1JT1A 4UWOB 4NQ2A 4C1DA 2NZFA 3BC2A 3X2ZA 5EVKA 2QEDA 2P18A 5B3RA 5AHRA 2AIOA 3I0VA 4ZNBA 4RM5A 1KR3A 3QH8A 2BFLA 2FHXA 2BG6A 5HH5A 2I7VA 2BFZA 5ACRA 2YNWA 2CBNA 2GFKA 3I14A 5EWAA 5ACSA 1HLKA 2FU8A 4HL1A 2ZZIA 1DD6A 2BG8B 3ZR9A 3FCZA 2Y87A 5K4NA 3AJ3A 3RKJA 1WUPA 4AWYB 5EHTA 3IE1A 4Z6XA 4UA4A 4C1CA 3SFPA 4C1HA 2BGAA 3DH8A 3SBLA 3F9OA 4NQ6A 2GCUA 4Z7RA 5ACXA 2YNUA 3IOFA 1JJEA 2NZEA 4NQ5A 1Y44A 3PY5A 4XWWA 2BTNA 2QDSA 3SRXA 4Z67A 4JO0A 5LCAA 1XM8A 2R2DA 4UBQA
chains in the Genus database with same CATH superfamily
4GYQA 3WXCA 4O98A 4C1FA 4C1GA 2CG3A 5EH9A 5A0TA 1XTOA 4TYFA 4D1WA 2OHHA 2Q0JA 4EYFA 1DXKA 3IOGA 2FK6A 3T9MA 5A0VA 2FU9A 4HKYA 5EV6A 5ACPA 4TYTA 4FEKA 4UWRB 2WRSA 3ZQ4A 4Z60A 1MQOA 5HIQA 1ZTCA 5A23A 1ZNBA 5ACVA 1A7TA 2QDTA 2YHEA 4HL2A 3Q6VA 2BG8A 4Z5YA 4EFZA 2P1EA 1X8HA 5HH6A 3R2UA 3SW3A 4CHLA 1QH3A 1KO2A 2Y8AA 2YNVB 3PG4A 4U4LA 5ACTA 2YCBA 1YCFA 5A87A 2DOOA 3IE2A 4KEPA 4AX0B 4TZFA 4WD6A 1ZKPA 4PDXA 5K0WA 2YNTB 5LLDA 4RL0A 4B87A 1VMEA 2GKLA 4KEQA 4P62A 2WHGA 2GFJA 4BP0A 2M5DA 3I11A 3X2XA 2P97A 4LE6A 3A4YA 2ZNBA 1WUOA 2XF4A 4Z5ZA 2WYMA 3T3NA 4TZ9A 5LCHA 3JXPA 2YZ3A 4DIKA 5HISA 4YSBA 5LCFA 4XUKA 3VQZA 1VGNA 1YCGA 3ZNBA 2VW8A 4EXYA 3X30A 4EY2A 5B15A 3RKKA 2Q9UA 4AX1B 5EVBA 3DHAA 4D02A 1X8GA 1SMLA 2OHIA 3L6NA 1L9YA 3LVZA 1BC2A 1P9EA 5ACWA 5KILA 1E5DA 4ZO2A 4GCWA 2QINA 2I7TA 4TZBA 2Q0IA 2YNVA 1YCHA 1A8TA 5ACUA 3H3EA 4J5FA 1X8IA 2DKFA 2YNTA 4FSBA 1WW1A 2GMNA 5DPXA 3TP9A 3SPUA 2BR6A 5LE1A 3AF6A 2AZ4A 5AHOA 4RL2A 4D1VA 4XWTA 4C09A 2WYLA 3BV6A 1DDKA 5ACQA 2H6AA 1WRAA 4FR7A 2P4ZA 4AV7A 2UYXA 5FQAA 3I15A 2XR1A 2BIBA 5EV8A 4PVTA 4NQ4A 5HIOA 2I7XA 3P2UA 3X2YA 4YSKA 5FQBA 2OHJA 2BG7A 4RAWA 4F6ZA 2Q42A 3G1PA 3AF5A 2BC2A 4RAMA 5K4MA 3I13A 4UWPB 3DHBA 5A5ZA 2FU7A 4EXSA 5KIKA 3S0ZA 5AIJA 4D1TA 5B1UA 3ZWFA 1BMCA 2M5CA 3FAIA 2FU6A 4NURA 3KL7A 5AEBA 2NXAA 4UAMA 5EW0A 5K4KA 4AXHA 4UWSB 3RPCA 2FM6A 3BK2A 2FHXB 4AWZA 2BFZB 2Y8BA 1K07A 4ZO3A 3SD9A 4RBSA 2CFUA 2BG2A 5AJLA 5LM6A 3MD7A 3IDZA 4PVOA 2WYMC 4D1UA 4EYLA 4EYBA 5IQKA 3T3OA 3VPEA 2BFKA 4AD9A 3PY6A 4V0HA 4DILA 1JJTA 1BVTA 3KNRA 5FQCA 2BMIA 4ZEJA 3BK1A 3DHCA 5AXOA 3IE0A 4H0DA 4J5HA 3ADRA 2ZO4A 5LSCA 1VJNA 4GYUA 5EVDA 5LMCA 3IEKA 5HIPA 3ESHA 4BZ3A 1KO3A 2HB9A 2E7YA 2NYPA 4F6HA 4TZEA 5LS3A 4C1EA 2ZWRA 2QJSA 3IEMA 4YSLA 5AYAA 1QH5A 5HH4A 3KNSA 5AXRA 1M2XA 2A7MA 3IELA 1JT1A 4UWOB 4NQ2A 4C1DA 2NZFA 3BC2A 3X2ZA 5EVKA 2QEDA 2P18A 5B3RA 5AHRA 2AIOA 3I0VA 4ZNBA 4RM5A 1KR3A 3QH8A 2BFLA 2FHXA 2BG6A 5HH5A 2I7VA 2BFZA 5ACRA 2YNWA 2CBNA 2GFKA 3I14A 5EWAA 5ACSA 1HLKA 2FU8A 4HL1A 2ZZIA 1DD6A 2BG8B 3ZR9A 3FCZA 2Y87A 5K4NA 3AJ3A 3RKJA 1WUPA 4AWYB 5EHTA 3IE1A 2CG2A 4Z6XA 4UA4A 2CFZA 4C1CA 3SFPA 4C1HA 2BGAA 3DH8A 3SBLA 3F9OA 4NQ6A 2GCUA 4Z7RA 5ACXA 2YNUA 3IOFA 1JJEA 2NZEA 4NQ5A 1Y44A 3PY5A 4XWWA 2BTNA 2QDSA 3SRXA 4Z67A 4JO0A 5LCAA 1XM8A 2R2DA 4UBQA
chains in the Genus database with same CATH topology
4GYQA 3WXCA 4O98A 4C1FA 4C1GA 5EH9A 5A0TA 1XTOA 4TYFA 4D1WA 2OHHA 2Q0JA 4EYFA 1DXKA 3IOGA 2FK6A 3T9MA 5A0VA 2FU9A 4HKYA 5EV6A 5ACPA 4TYTA 4FEKA 4UWRB 2WRSA 3ZQ4A 4Z60A 1MQOA 5HIQA 1ZTCA 1ZNBA 5ACVA 1A7TA 2QDTA 4HL2A 3Q6VA 2BG8A 4Z5YA 4EFZA 2P1EA 1X8HA 5HH6A 3R2UA 3SW3A 4CHLA 1QH3A 1KO2A 2Y8AA 2YNVB 3PG4A 4U4LA 5ACTA 2YCBA 1YCFA 5A87A 2DOOA 3IE2A 4KEPA 4AX0B 4TZFA 4WD6A 1ZKPA 5K0WA 2YNTB 5LLDA 4RL0A 4B87A 1VMEA 2GKLA 4KEQA 4P62A 2WHGA 2GFJA 4BP0A 2M5DA 3I11A 3X2XA 2P97A 4LE6A 3A4YA 2ZNBA 1WUOA 2XF4A 4Z5ZA 2WYMA 3T3NA 4TZ9A 5LCHA 3JXPA 2YZ3A 4DIKA 5HISA 4YSBA 5LCFA 4XUKA 3VQZA 1VGNA 1YCGA 3ZNBA 2VW8A 4EXYA 3X30A 4EY2A 5B15A 3RKKA 2Q9UA 4AX1B 5EVBA 3DHAA 4D02A 1X8GA 1SMLA 2OHIA 3L6NA 1L9YA 3LVZA 1BC2A 1P9EA 5ACWA 5KILA 1E5DA 4ZO2A 4GCWA 2QINA 2I7TA 4TZBA 2Q0IA 2YNVA 1YCHA 1A8TA 5ACUA 3H3EA 4J5FA 1X8IA 2DKFA 2YNTA 4FSBA 1WW1A 2GMNA 5DPXA 3TP9A 3SPUA 2BR6A 5LE1A 3AF6A 2AZ4A 5AHOA 4RL2A 4D1VA 4XWTA 4C09A 2WYLA 3BV6A 1DDKA 5ACQA 2H6AA 1WRAA 4FR7A 2P4ZA 2UYXA 5FQAA 3I15A 2XR1A 2BIBA 5EV8A 4PVTA 4NQ4A 5HIOA 2I7XA 3P2UA 3X2YA 4YSKA 5FQBA 2OHJA 2BG7A 4RAWA 4F6ZA 2Q42A 3G1PA 3AF5A 2BC2A 4RAMA 5K4MA 3I13A 4UWPB 3DHBA 5A5ZA 2FU7A 4EXSA 5KIKA 3S0ZA 4D1TA 5B1UA 3ZWFA 1BMCA 2M5CA 3FAIA 2FU6A 3KL7A 5AEBA 2NXAA 4UAMA 5EW0A 5K4KA 4UWSB 3RPCA 2FM6A 3BK2A 2FHXB 4AWZA 2BFZB 2Y8BA 1K07A 4ZO3A 3SD9A 4RBSA 2BG2A 5LM6A 3MD7A 3IDZA 4PVOA 2WYMC 4D1UA 4EYLA 4EYBA 5IQKA 3T3OA 3VPEA 2BFKA 4AD9A 3PY6A 4V0HA 4DILA 1JJTA 1BVTA 3KNRA 5FQCA 2BMIA 4ZEJA 3BK1A 3DHCA 5AXOA 3IE0A 4H0DA 4J5HA 3ADRA 2ZO4A 5LSCA 1VJNA 4GYUA 5EVDA 5LMCA 3IEKA 5HIPA 3ESHA 4BZ3A 1KO3A 2HB9A 2E7YA 2NYPA 4F6HA 4TZEA 5LS3A 4C1EA 2ZWRA 2QJSA 3IEMA 4YSLA 5AYAA 1QH5A 5HH4A 3KNSA 5AXRA 1M2XA 2A7MA 3IELA 1JT1A 4UWOB 4NQ2A 4C1DA 2NZFA 3BC2A 3X2ZA 5EVKA 2QEDA 2P18A 5B3RA 5AHRA 2AIOA 3I0VA 4ZNBA 4RM5A 1KR3A 3QH8A 2BFLA 2FHXA 2BG6A 5HH5A 2I7VA 2BFZA 5ACRA 2YNWA 2CBNA 2GFKA 3I14A 5EWAA 5ACSA 1HLKA 2FU8A 4HL1A 2ZZIA 1DD6A 2BG8B 3ZR9A 3FCZA 2Y87A 5K4NA 3AJ3A 3RKJA 1WUPA 4AWYB 5EHTA 3IE1A 4Z6XA 4UA4A 4C1CA 3SFPA 4C1HA 2BGAA 3DH8A 3SBLA 3F9OA 4NQ6A 2GCUA 4Z7RA 5ACXA 2YNUA 3IOFA 1JJEA 2NZEA 4NQ5A 1Y44A 3PY5A 4XWWA 2BTNA 2QDSA 3SRXA 4Z67A 4JO0A 5LCAA 1XM8A 2R2DA 4UBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GYQ A;  3WXC A;  4O98 A;  4C1F A;  4C1G A;  5EH9 A;  5A0T A;  1XTO A;  4TYF A;  4D1W A;  2OHH A;  2Q0J A;  4EYF A;  1DXK A;  3IOG A;  2FK6 A;  3T9M A;  5A0V A;  2FU9 A;  4HKY A;  5EV6 A;  5ACP A;  4TYT A;  4FEK A;  4UWR B;  2WRS A;  3ZQ4 A;  4Z60 A;  1MQO A;  5HIQ A;  1ZTC A;  1ZNB A;  5ACV A;  1A7T A;  2QDT A;  4HL2 A;  3Q6V A;  2BG8 A;  4Z5Y A;  4EFZ A;  2P1E A;  1X8H A;  5HH6 A;  3R2U A;  3SW3 A;  4CHL A;  1QH3 A;  1KO2 A;  2Y8A A;  2YNV B;  3PG4 A;  4U4L A;  5ACT A;  2YCB A;  1YCF A;  5A87 A;  2DOO A;  3IE2 A;  4KEP A;  4AX0 B;  4TZF A;  4WD6 A;  1ZKP A;  5K0W A;  2YNT B;  5LLD A;  4RL0 A;  4B87 A;  1VME A;  2GKL A;  4KEQ A;  4P62 A;  2WHG A;  2GFJ A;  4BP0 A;  2M5D A;  3I11 A;  3X2X A;  2P97 A;  4LE6 A;  3A4Y A;  2ZNB A;  1WUO A;  2XF4 A;  4Z5Z A;  2WYM A;  3T3N A;  4TZ9 A;  5LCH A;  3JXP A;  2YZ3 A;  4DIK A;  5HIS A;  4YSB A;  5LCF A;  4XUK A;  3VQZ A;  1VGN A;  1YCG A;  3ZNB A;  2VW8 A;  4EXY A;  3X30 A;  4EY2 A;  5B15 A;  3RKK A;  2Q9U A;  4AX1 B;  5EVB A;  3DHA A;  4D02 A;  1X8G A;  1SML A;  2OHI A;  3L6N A;  1L9Y A;  3LVZ A;  1BC2 A;  1P9E A;  5ACW A;  5KIL A;  1E5D A;  4ZO2 A;  4GCW A;  2QIN A;  2I7T A;  4TZB A;  2Q0I A;  2YNV A;  1YCH A;  1A8T A;  5ACU A;  3H3E A;  4J5F A;  1X8I A;  2DKF A;  2YNT A;  4FSB A;  1WW1 A;  2GMN A;  5DPX A;  3TP9 A;  3SPU A;  2BR6 A;  5LE1 A;  3AF6 A;  2AZ4 A;  5AHO A;  4RL2 A;  4D1V A;  4XWT A;  4C09 A;  2WYL A;  3BV6 A;  1DDK A;  5ACQ A;  2H6A A;  1WRA A;  4FR7 A;  2P4Z A;  2UYX A;  5FQA A;  3I15 A;  2XR1 A;  2BIB A;  5EV8 A;  4PVT A;  4NQ4 A;  5HIO A;  2I7X A;  3P2U A;  3X2Y A;  4YSK A;  5FQB A;  2OHJ A;  2BG7 A;  4RAW A;  4F6Z A;  2Q42 A;  3G1P A;  3AF5 A;  2BC2 A;  4RAM A;  5K4M A;  3I13 A;  4UWP B;  3DHB A;  5A5Z A;  2FU7 A;  4EXS A;  5KIK A;  3S0Z A;  4D1T A;  5B1U A;  3ZWF A;  1BMC A;  2M5C A;  3FAI A;  2FU6 A;  3KL7 A;  5AEB A;  2NXA A;  4UAM A;  5EW0 A;  5K4K A;  4UWS B;  3RPC A;  2FM6 A;  3BK2 A;  2FHX B;  4AWZ A;  2BFZ B;  2Y8B A;  1K07 A;  4ZO3 A;  3SD9 A;  4RBS A;  2BG2 A;  5LM6 A;  3MD7 A;  3IDZ A;  4PVO A;  2WYM C;  4D1U A;  4EYL A;  4EYB A;  5IQK A;  3T3O A;  3VPE A;  2BFK A;  4AD9 A;  3PY6 A;  4V0H A;  4DIL A;  1JJT A;  1BVT A;  3KNR A;  5FQC A;  2BMI A;  4ZEJ A;  3BK1 A;  3DHC A;  5AXO A;  3IE0 A;  4H0D A;  4J5H A;  3ADR A;  2ZO4 A;  5LSC A;  1VJN A;  4GYU A;  5EVD A;  5LMC A;  3IEK A;  5HIP A;  3ESH A;  4BZ3 A;  1KO3 A;  2HB9 A;  2E7Y A;  2NYP A;  4F6H A;  4TZE A;  5LS3 A;  4C1E A;  2ZWR A;  2QJS A;  3IEM A;  4YSL A;  5AYA A;  1QH5 A;  5HH4 A;  3KNS A;  5AXR A;  1M2X A;  2A7M A;  3IEL A;  1JT1 A;  4UWO B;  4NQ2 A;  4C1D A;  2NZF A;  3BC2 A;  3X2Z A;  5EVK A;  2QED A;  2P18 A;  5B3R A;  5AHR A;  2AIO A;  3I0V A;  4ZNB A;  4RM5 A;  1KR3 A;  3QH8 A;  2BFL A;  2FHX A;  2BG6 A;  5HH5 A;  2I7V A;  2BFZ A;  5ACR A;  2YNW A;  2CBN A;  2GFK A;  3I14 A;  5EWA A;  5ACS A;  1HLK A;  2FU8 A;  4HL1 A;  2ZZI A;  1DD6 A;  2BG8 B;  3ZR9 A;  3FCZ A;  2Y87 A;  5K4N A;  3AJ3 A;  3RKJ A;  1WUP A;  4AWY B;  5EHT A;  3IE1 A;  4Z6X A;  4UA4 A;  4C1C A;  3SFP A;  4C1H A;  2BGA A;  3DH8 A;  3SBL A;  3F9O A;  4NQ6 A;  2GCU A;  4Z7R A;  5ACX A;  2YNU A;  3IOF A;  1JJE A;  2NZE A;  4NQ5 A;  1Y44 A;  3PY5 A;  4XWW A;  2BTN A;  2QDS A;  3SRX A;  4Z67 A;  4JO0 A;  5LCA A;  1XM8 A;  2R2D A;  4UBQ A; 
#chains in the Genus database with same CATH topology
 4GYQ A;  3WXC A;  4O98 A;  4C1F A;  4C1G A;  2CG3 A;  5EH9 A;  5A0T A;  1XTO A;  4TYF A;  4D1W A;  2OHH A;  2Q0J A;  4EYF A;  1DXK A;  3IOG A;  2FK6 A;  3T9M A;  5A0V A;  2FU9 A;  4HKY A;  5EV6 A;  5ACP A;  4TYT A;  4FEK A;  4UWR B;  2WRS A;  3ZQ4 A;  4Z60 A;  1MQO A;  5HIQ A;  1ZTC A;  5A23 A;  1ZNB A;  5ACV A;  1A7T A;  2QDT A;  2YHE A;  4HL2 A;  3Q6V A;  2BG8 A;  4Z5Y A;  4EFZ A;  2P1E A;  1X8H A;  5HH6 A;  3R2U A;  3SW3 A;  4CHL A;  1QH3 A;  1KO2 A;  2Y8A A;  2YNV B;  3PG4 A;  4U4L A;  5ACT A;  2YCB A;  1YCF A;  5A87 A;  2DOO A;  3IE2 A;  4KEP A;  4AX0 B;  4TZF A;  4WD6 A;  1ZKP A;  4PDX A;  5K0W A;  2YNT B;  5LLD A;  4RL0 A;  4B87 A;  1VME A;  2GKL A;  4KEQ A;  4P62 A;  2WHG A;  2GFJ A;  4BP0 A;  2M5D A;  3I11 A;  3X2X A;  2P97 A;  4LE6 A;  3A4Y A;  2ZNB A;  1WUO A;  2XF4 A;  4Z5Z A;  2WYM A;  3T3N A;  4TZ9 A;  5LCH A;  3JXP A;  2YZ3 A;  4DIK A;  5HIS A;  4YSB A;  5LCF A;  4XUK A;  3VQZ A;  1VGN A;  1YCG A;  3ZNB A;  2VW8 A;  4EXY A;  3X30 A;  4EY2 A;  5B15 A;  3RKK A;  2Q9U A;  4AX1 B;  5EVB A;  3DHA A;  4D02 A;  1X8G A;  1SML A;  2OHI A;  3L6N A;  1L9Y A;  3LVZ A;  1BC2 A;  1P9E A;  5ACW A;  5KIL A;  1E5D A;  4ZO2 A;  4GCW A;  2QIN A;  2I7T A;  4TZB A;  2Q0I A;  2YNV A;  1YCH A;  1A8T A;  5ACU A;  3H3E A;  4J5F A;  1X8I A;  2DKF A;  2YNT A;  4FSB A;  1WW1 A;  2GMN A;  5DPX A;  3TP9 A;  3SPU A;  2BR6 A;  5LE1 A;  3AF6 A;  2AZ4 A;  5AHO A;  4RL2 A;  4D1V A;  4XWT A;  4C09 A;  2WYL A;  3BV6 A;  1DDK A;  5ACQ A;  2H6A A;  1WRA A;  4FR7 A;  2P4Z A;  4AV7 A;  2UYX A;  5FQA A;  3I15 A;  2XR1 A;  2BIB A;  5EV8 A;  4PVT A;  4NQ4 A;  5HIO A;  2I7X A;  3P2U A;  3X2Y A;  4YSK A;  5FQB A;  2OHJ A;  2BG7 A;  4RAW A;  4F6Z A;  2Q42 A;  3G1P A;  3AF5 A;  2BC2 A;  4RAM A;  5K4M A;  3I13 A;  4UWP B;  3DHB A;  5A5Z A;  2FU7 A;  4EXS A;  5KIK A;  3S0Z A;  5AIJ A;  4D1T A;  5B1U A;  3ZWF A;  1BMC A;  2M5C A;  3FAI A;  2FU6 A;  4NUR A;  3KL7 A;  5AEB A;  2NXA A;  4UAM A;  5EW0 A;  5K4K A;  4AXH A;  4UWS B;  3RPC A;  2FM6 A;  3BK2 A;  2FHX B;  4AWZ A;  2BFZ B;  2Y8B A;  1K07 A;  4ZO3 A;  3SD9 A;  4RBS A;  2CFU A;  2BG2 A;  5AJL A;  5LM6 A;  3MD7 A;  3IDZ A;  4PVO A;  2WYM C;  4D1U A;  4EYL A;  4EYB A;  5IQK A;  3T3O A;  3VPE A;  2BFK A;  4AD9 A;  3PY6 A;  4V0H A;  4DIL A;  1JJT A;  1BVT A;  3KNR A;  5FQC A;  2BMI A;  4ZEJ A;  3BK1 A;  3DHC A;  5AXO A;  3IE0 A;  4H0D A;  4J5H A;  3ADR A;  2ZO4 A;  5LSC A;  1VJN A;  4GYU A;  5EVD A;  5LMC A;  3IEK A;  5HIP A;  3ESH A;  4BZ3 A;  1KO3 A;  2HB9 A;  2E7Y A;  2NYP A;  4F6H A;  4TZE A;  5LS3 A;  4C1E A;  2ZWR A;  2QJS A;  3IEM A;  4YSL A;  5AYA A;  1QH5 A;  5HH4 A;  3KNS A;  5AXR A;  1M2X A;  2A7M A;  3IEL A;  1JT1 A;  4UWO B;  4NQ2 A;  4C1D A;  2NZF A;  3BC2 A;  3X2Z A;  5EVK A;  2QED A;  2P18 A;  5B3R A;  5AHR A;  2AIO A;  3I0V A;  4ZNB A;  4RM5 A;  1KR3 A;  3QH8 A;  2BFL A;  2FHX A;  2BG6 A;  5HH5 A;  2I7V A;  2BFZ A;  5ACR A;  2YNW A;  2CBN A;  2GFK A;  3I14 A;  5EWA A;  5ACS A;  1HLK A;  2FU8 A;  4HL1 A;  2ZZI A;  1DD6 A;  2BG8 B;  3ZR9 A;  3FCZ A;  2Y87 A;  5K4N A;  3AJ3 A;  3RKJ A;  1WUP A;  4AWY B;  5EHT A;  3IE1 A;  2CG2 A;  4Z6X A;  4UA4 A;  2CFZ A;  4C1C A;  3SFP A;  4C1H A;  2BGA A;  3DH8 A;  3SBL A;  3F9O A;  4NQ6 A;  2GCU A;  4Z7R A;  5ACX A;  2YNU A;  3IOF A;  1JJE A;  2NZE A;  4NQ5 A;  1Y44 A;  3PY5 A;  4XWW A;  2BTN A;  2QDS A;  3SRX A;  4Z67 A;  4JO0 A;  5LCA A;  1XM8 A;  2R2D A;  4UBQ A; 
#chains in the Genus database with same CATH homology
 4GYQ A;  3WXC A;  4O98 A;  4C1F A;  4C1G A;  5EH9 A;  5A0T A;  1XTO A;  4TYF A;  4D1W A;  2OHH A;  2Q0J A;  4EYF A;  1DXK A;  3IOG A;  2FK6 A;  3T9M A;  5A0V A;  2FU9 A;  4HKY A;  5EV6 A;  5ACP A;  4TYT A;  4FEK A;  4UWR B;  2WRS A;  3ZQ4 A;  4Z60 A;  1MQO A;  5HIQ A;  1ZTC A;  1ZNB A;  5ACV A;  1A7T A;  2QDT A;  4HL2 A;  3Q6V A;  2BG8 A;  4Z5Y A;  4EFZ A;  2P1E A;  1X8H A;  5HH6 A;  3R2U A;  3SW3 A;  4CHL A;  1QH3 A;  1KO2 A;  2Y8A A;  2YNV B;  3PG4 A;  4U4L A;  5ACT A;  2YCB A;  1YCF A;  5A87 A;  2DOO A;  3IE2 A;  4KEP A;  4AX0 B;  4TZF A;  4WD6 A;  1ZKP A;  5K0W A;  2YNT B;  5LLD A;  4RL0 A;  4B87 A;  1VME A;  2GKL A;  4KEQ A;  4P62 A;  2WHG A;  2GFJ A;  4BP0 A;  2M5D A;  3I11 A;  3X2X A;  2P97 A;  4LE6 A;  3A4Y A;  2ZNB A;  1WUO A;  2XF4 A;  4Z5Z A;  2WYM A;  3T3N A;  4TZ9 A;  5LCH A;  3JXP A;  2YZ3 A;  4DIK A;  5HIS A;  4YSB A;  5LCF A;  4XUK A;  3VQZ A;  1VGN A;  1YCG A;  3ZNB A;  2VW8 A;  4EXY A;  3X30 A;  4EY2 A;  5B15 A;  3RKK A;  2Q9U A;  4AX1 B;  5EVB A;  3DHA A;  4D02 A;  1X8G A;  1SML A;  2OHI A;  3L6N A;  1L9Y A;  3LVZ A;  1BC2 A;  1P9E A;  5ACW A;  5KIL A;  1E5D A;  4ZO2 A;  4GCW A;  2QIN A;  2I7T A;  4TZB A;  2Q0I A;  2YNV A;  1YCH A;  1A8T A;  5ACU A;  3H3E A;  4J5F A;  1X8I A;  2DKF A;  2YNT A;  4FSB A;  1WW1 A;  2GMN A;  5DPX A;  3TP9 A;  3SPU A;  2BR6 A;  5LE1 A;  3AF6 A;  2AZ4 A;  5AHO A;  4RL2 A;  4D1V A;  4XWT A;  4C09 A;  2WYL A;  3BV6 A;  1DDK A;  5ACQ A;  2H6A A;  1WRA A;  4FR7 A;  2P4Z A;  2UYX A;  5FQA A;  3I15 A;  2XR1 A;  2BIB A;  5EV8 A;  4PVT A;  4NQ4 A;  5HIO A;  2I7X A;  3P2U A;  3X2Y A;  4YSK A;  5FQB A;  2OHJ A;  2BG7 A;  4RAW A;  4F6Z A;  2Q42 A;  3G1P A;  3AF5 A;  2BC2 A;  4RAM A;  5K4M A;  3I13 A;  4UWP B;  3DHB A;  5A5Z A;  2FU7 A;  4EXS A;  5KIK A;  3S0Z A;  4D1T A;  5B1U A;  3ZWF A;  1BMC A;  2M5C A;  3FAI A;  2FU6 A;  3KL7 A;  5AEB A;  2NXA A;  4UAM A;  5EW0 A;  5K4K A;  4UWS B;  3RPC A;  2FM6 A;  3BK2 A;  2FHX B;  4AWZ A;  2BFZ B;  2Y8B A;  1K07 A;  4ZO3 A;  3SD9 A;  4RBS A;  2BG2 A;  5LM6 A;  3MD7 A;  3IDZ A;  4PVO A;  2WYM C;  4D1U A;  4EYL A;  4EYB A;  5IQK A;  3T3O A;  3VPE A;  2BFK A;  4AD9 A;  3PY6 A;  4V0H A;  4DIL A;  1JJT A;  1BVT A;  3KNR A;  5FQC A;  2BMI A;  4ZEJ A;  3BK1 A;  3DHC A;  5AXO A;  3IE0 A;  4H0D A;  4J5H A;  3ADR A;  2ZO4 A;  5LSC A;  1VJN A;  4GYU A;  5EVD A;  5LMC A;  3IEK A;  5HIP A;  3ESH A;  4BZ3 A;  1KO3 A;  2HB9 A;  2E7Y A;  2NYP A;  4F6H A;  4TZE A;  5LS3 A;  4C1E A;  2ZWR A;  2QJS A;  3IEM A;  4YSL A;  5AYA A;  1QH5 A;  5HH4 A;  3KNS A;  5AXR A;  1M2X A;  2A7M A;  3IEL A;  1JT1 A;  4UWO B;  4NQ2 A;  4C1D A;  2NZF A;  3BC2 A;  3X2Z A;  5EVK A;  2QED A;  2P18 A;  5B3R A;  5AHR A;  2AIO A;  3I0V A;  4ZNB A;  4RM5 A;  1KR3 A;  3QH8 A;  2BFL A;  2FHX A;  2BG6 A;  5HH5 A;  2I7V A;  2BFZ A;  5ACR A;  2YNW A;  2CBN A;  2GFK A;  3I14 A;  5EWA A;  5ACS A;  1HLK A;  2FU8 A;  4HL1 A;  2ZZI A;  1DD6 A;  2BG8 B;  3ZR9 A;  3FCZ A;  2Y87 A;  5K4N A;  3AJ3 A;  3RKJ A;  1WUP A;  4AWY B;  5EHT A;  3IE1 A;  4Z6X A;  4UA4 A;  4C1C A;  3SFP A;  4C1H A;  2BGA A;  3DH8 A;  3SBL A;  3F9O A;  4NQ6 A;  2GCU A;  4Z7R A;  5ACX A;  2YNU A;  3IOF A;  1JJE A;  2NZE A;  4NQ5 A;  1Y44 A;  3PY5 A;  4XWW A;  2BTN A;  2QDS A;  3SRX A;  4Z67 A;  4JO0 A;  5LCA A;  1XM8 A;  2R2D A;  4UBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...