1XTOA

Crystal structure of the coenzyme pqq synthesis protein (pqqb) from pseudomonas putida, northeast structural genomics target ppr6
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
304
structure length
304
Chain Sequence
MYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIALSDDGVHWILCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLREGCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFPLRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLLVDGTLWEDDEMQRRGVGTRTGREMGHLAQNGPGGMLEVLDGFPRQRKVLIHINNTNPILDENSPERAEVLRRGVEVAFDGMSIELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coenzyme PQQ synthesis protein B
publication title Crystal Structure of the Coenzyme PQQ Synthesis Protein (PqqB) from Pseudomonas putida, Northeast Structural Genomics Target PpR6
rcsb
source organism Pseudomonas putida
molecule tags Structural genomics, unknown function
total genus 78
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2004-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1xtoA00
2QDTA 2QINA 1WW1A 1VMEA 2R2DA 4RL2A 5LMCA 2NYPA 4UWSB 2WHGA 2YNWA 2ZNBA 5LCFA 4O98A 5LLDA 4GCWA 2BFLA 2ZO4A 5LCHA 5A87A 4Z5YA 2P18A 4UA4A 5IQKA 1YCFA 2Q0IA 4NQ2A 4TZEA 4EFZA 1VGNA 1XTOA 5KILA 3I0VA 3SRXA 5DPXA 4XWTA 2E7YA 5K0WA 1YCHA 4UBQA 3PY6A 4NQ6A 3KNRA 1X8IA 3IEMA 5ACPA 1DDKA 1YCGA 4EYBA 5LCAA 2Q9UA 3KL7A 4XWWA 4NQ5A 4ZO2A 5FQAA 1X8HA 3I15A 4EXYA 2WYLA 5ACXA 4DIKA 2YCBA 5KIKA 5EVDA 4Z6XA 2FHXB 3JXPA 2QEDA 2YZ3A 3X2XA 4P62A 4C1FA 5LE1A 3BC2A 1VJNA 4AWZA 1MQOA 4YSLA 2BR6A 2AIOA 4AX0B 5ACTA 3IELA 5LS3A 4RM5A 4JO0A 3L6NA 2BFKA 3I14A 1P9EA 4GYUA 5K4KA 5HH5A 4D1VA 2AZ4A 2ZWRA 5HH6A 4D1WA 2OHIA 5AXRA 1JJTA 4WD6A 4UWRB 3X2ZA 3IOGA 4PVOA 4ZNBA 3T3NA 2Q0JA 2YNVB 4J5HA 4U4LA 3F9OA 3ZR9A 2BFZB 3AF5A 4TYFA 1KR3A 1L9YA 1A8TA 1E5DA 4XUKA 3H3EA 1X8GA 2BG7A 3I11A 4HL1A 5AHOA 4F6HA 1JJEA 2FHXA 2BMIA 5AEBA 5A5ZA 4F6ZA 5K4NA 2DKFA 4H0DA 2YNUA 5AHRA 4DILA 2P1EA 1M2XA 4Z5ZA 2BGAA 4AWYB 4FSBA 2FU7A 2YNTB 4UWOB 2Q42A 2I7VA 4Z60A 1DD6A 5LSCA 5HISA 4TYTA 2NZFA 4ZEJA 4C1EA 2Y8AA 2FU6A 4D1UA 5HIOA 2YNVA 3AF6A 5ACQA 4HL2A 4PVTA 2BFZA 2Y8BA 2FM6A 3DHBA 2BTNA 2I7XA 5AYAA 5HH4A 5B1UA 3SW3A 1A7TA 1SMLA 5ACUA 2VW8A 5EHTA 4RAWA 3G1PA 4LE6A 3TP9A 1ZNBA 1QH3A 2GMNA 1HLKA 4CHLA 4YSBA 4EYLA 4B87A 4NQ4A 3RKJA 4EXSA 5FQCA 4KEPA 2M5DA 2WYMC 2BIBA 1WUOA 3RKKA 5A0TA 2BG8B 3ESHA 2FK6A 2P97A 3Q6VA 3S0ZA 2YNTA 5AXOA 2NZEA 3PY5A 1KO3A 2M5CA 3IEKA 1K07A 3I13A 3IOFA 3T9MA 3QH8A 3DH8A 4D02A 4BP0A 1Y44A 4TZ9A 2ZZIA 4D1TA 5EW0A 4FEKA 3ZQ4A 3SPUA 3DHCA 5B15A 3IDZA 4GYQA 3FCZA 3T3OA 3RPCA 4YSKA 4AX1B 3X30A 1BMCA 5LM6A 4KEQA 5HIQA 5ACWA 2BC2A 2GKLA 3AJ3A 2XR1A 2WYMA 1WRAA 2H6AA 3IE2A 2P4ZA 5EVBA 3BV6A 3IE0A 1BC2A 4RL0A 2XF4A 5EH9A 3ZWFA 2BG8A 2I7TA 1DXKA 3BK2A 4RBSA 3P2UA 2GCUA 4C09A 3BK1A 4HKYA 1QH5A 2FU9A 4C1HA 4UWPB 3SFPA 5HIPA 2WRSA 5EWAA 4RAMA 5ACSA 3IE1A 2CBNA 4Z67A 2NXAA 3VPEA 4TZBA 4AD9A 2QDSA 1KO2A 4TZFA 3X2YA 5EV8A 2GFJA 4J5FA 1ZTCA 5K4MA 3PG4A 2BG2A 4FR7A 4C1CA 5A0VA 4C1GA 5ACRA 2GFKA 4Z7RA 4UAMA 3SD9A 3MD7A 3DHAA 2A7MA 3A4YA 5EVKA 3FAIA 4ZO3A 2FU8A 3VQZA 1WUPA 3SBLA 3LVZA 3WXCA 2QJSA 4BZ3A 1JT1A 5ACVA 3ZNBA 3R2UA 2OHHA 1ZKPA 2DOOA 5FQBA 1BVTA 4EYFA 3KNSA 5B3RA 1XM8A 2BG6A 5EV6A 2UYXA 2HB9A 4EY2A 4V0HA 2OHJA 4C1DA 3ADRA 2Y87A
chains in the Genus database with same CATH superfamily
2QDTA 2QINA 1WW1A 1VMEA 2R2DA 4RL2A 5LMCA 2NYPA 4UWSB 2WHGA 2YNWA 2ZNBA 5LCFA 4O98A 5LLDA 4GCWA 2BFLA 2ZO4A 5LCHA 5A87A 4Z5YA 2P18A 4UA4A 5IQKA 1YCFA 2Q0IA 4NQ2A 4TZEA 4EFZA 1VGNA 1XTOA 5A23A 5KILA 3I0VA 3SRXA 5DPXA 4XWTA 4AV7A 2E7YA 2CFUA 5K0WA 4PDXA 1YCHA 4UBQA 3PY6A 4NQ6A 3KNRA 1X8IA 3IEMA 5ACPA 1DDKA 1YCGA 4EYBA 5LCAA 2Q9UA 3KL7A 4XWWA 4NQ5A 4ZO2A 5FQAA 5AJLA 1X8HA 3I15A 4EXYA 2WYLA 5ACXA 4DIKA 2YCBA 5KIKA 2YHEA 5EVDA 4Z6XA 2FHXB 3JXPA 2QEDA 2YZ3A 3X2XA 4P62A 4C1FA 5LE1A 3BC2A 1VJNA 4AWZA 1MQOA 4YSLA 2BR6A 2AIOA 4AX0B 4NURA 3IELA 5ACTA 5LS3A 4RM5A 4JO0A 3L6NA 2BFKA 3I14A 1P9EA 4GYUA 5K4KA 5HH5A 4D1VA 2AZ4A 2ZWRA 5HH6A 4D1WA 2OHIA 5AXRA 1JJTA 4WD6A 4UWRB 3X2ZA 3IOGA 2CFZA 4PVOA 4ZNBA 3T3NA 2Q0JA 2YNVB 4J5HA 4U4LA 3F9OA 3ZR9A 2BFZB 3AF5A 4TYFA 1KR3A 1L9YA 1A8TA 1E5DA 4XUKA 3H3EA 1X8GA 2BG7A 3I11A 4HL1A 5AHOA 4F6HA 1JJEA 2FHXA 2BMIA 5AEBA 5A5ZA 4F6ZA 5K4NA 2DKFA 4H0DA 2YNUA 5AHRA 4DILA 2P1EA 1M2XA 4Z5ZA 2BGAA 4AWYB 4FSBA 2FU7A 2YNTB 4UWOB 2Q42A 2I7VA 4Z60A 1DD6A 5LSCA 5HISA 4TYTA 2NZFA 4ZEJA 4C1EA 2Y8AA 2FU6A 4D1UA 5HIOA 4AXHA 2YNVA 3AF6A 5ACQA 4HL2A 4PVTA 2BFZA 2Y8BA 2FM6A 3DHBA 2BTNA 2I7XA 5AYAA 5HH4A 5B1UA 3SW3A 1A7TA 1SMLA 5ACUA 2VW8A 5EHTA 4RAWA 3G1PA 4LE6A 3TP9A 1ZNBA 1QH3A 2GMNA 1HLKA 4CHLA 4YSBA 4EYLA 4B87A 4NQ4A 3RKJA 4EXSA 5FQCA 4KEPA 2M5DA 2WYMC 2BIBA 1WUOA 3RKKA 5A0TA 2BG8B 3ESHA 2FK6A 2P97A 3Q6VA 3S0ZA 2YNTA 5AXOA 2NZEA 3PY5A 1KO3A 2M5CA 3IEKA 1K07A 3I13A 3IOFA 3T9MA 3QH8A 3DH8A 4D02A 4BP0A 1Y44A 4TZ9A 2ZZIA 4D1TA 5EW0A 4FEKA 3ZQ4A 3SPUA 3DHCA 5B15A 3IDZA 4GYQA 3FCZA 3T3OA 3RPCA 2CG3A 4YSKA 4AX1B 3X30A 1BMCA 5LM6A 4KEQA 5HIQA 5ACWA 2BC2A 2GKLA 3AJ3A 2XR1A 2WYMA 1WRAA 2H6AA 3IE2A 2P4ZA 5EVBA 3BV6A 3IE0A 1BC2A 4RL0A 2XF4A 5EH9A 3ZWFA 2BG8A 2I7TA 1DXKA 3BK2A 4RBSA 3P2UA 2GCUA 4C09A 3BK1A 4HKYA 1QH5A 2FU9A 4C1HA 4UWPB 3SFPA 5HIPA 2WRSA 5EWAA 4RAMA 5ACSA 3IE1A 2CBNA 5AIJA 4Z67A 2NXAA 3VPEA 4TZBA 4AD9A 2QDSA 1KO2A 4TZFA 3X2YA 5EV8A 2GFJA 4J5FA 1ZTCA 5K4MA 3PG4A 2BG2A 4FR7A 4C1CA 5A0VA 4C1GA 5ACRA 2GFKA 4Z7RA 4UAMA 3SD9A 3MD7A 3DHAA 2A7MA 3A4YA 5EVKA 3FAIA 4ZO3A 2FU8A 3VQZA 1WUPA 3SBLA 3LVZA 3WXCA 2QJSA 4BZ3A 1JT1A 5ACVA 3ZNBA 3R2UA 2OHHA 1ZKPA 2DOOA 5FQBA 1BVTA 4EYFA 3KNSA 5B3RA 1XM8A 2BG6A 5EV6A 2UYXA 2HB9A 4EY2A 2CG2A 4V0HA 2OHJA 4C1DA 3ADRA 2Y87A
chains in the Genus database with same CATH topology
2QDTA 2QINA 1WW1A 1VMEA 2R2DA 4RL2A 5LMCA 2NYPA 4UWSB 2WHGA 2YNWA 2ZNBA 5LCFA 4O98A 5LLDA 4GCWA 2BFLA 2ZO4A 5LCHA 5A87A 4Z5YA 2P18A 4UA4A 5IQKA 1YCFA 2Q0IA 4NQ2A 4TZEA 4EFZA 1VGNA 1XTOA 5KILA 3I0VA 3SRXA 5DPXA 4XWTA 2E7YA 5K0WA 1YCHA 4UBQA 3PY6A 4NQ6A 3KNRA 1X8IA 3IEMA 5ACPA 1DDKA 1YCGA 4EYBA 5LCAA 2Q9UA 3KL7A 4XWWA 4NQ5A 4ZO2A 5FQAA 1X8HA 3I15A 4EXYA 2WYLA 5ACXA 4DIKA 2YCBA 5KIKA 5EVDA 4Z6XA 2FHXB 3JXPA 2QEDA 2YZ3A 3X2XA 4P62A 4C1FA 5LE1A 3BC2A 1VJNA 4AWZA 1MQOA 4YSLA 2BR6A 2AIOA 4AX0B 5ACTA 3IELA 5LS3A 4RM5A 4JO0A 3L6NA 2BFKA 3I14A 1P9EA 4GYUA 5K4KA 5HH5A 4D1VA 2AZ4A 2ZWRA 5HH6A 4D1WA 2OHIA 5AXRA 1JJTA 4WD6A 4UWRB 3X2ZA 3IOGA 4PVOA 4ZNBA 3T3NA 2Q0JA 2YNVB 4J5HA 4U4LA 3F9OA 3ZR9A 2BFZB 3AF5A 4TYFA 1KR3A 1L9YA 1A8TA 1E5DA 4XUKA 3H3EA 1X8GA 2BG7A 3I11A 4HL1A 5AHOA 4F6HA 1JJEA 2FHXA 2BMIA 5AEBA 5A5ZA 4F6ZA 5K4NA 2DKFA 4H0DA 2YNUA 5AHRA 4DILA 2P1EA 1M2XA 4Z5ZA 2BGAA 4AWYB 4FSBA 2FU7A 2YNTB 4UWOB 2Q42A 2I7VA 4Z60A 1DD6A 5LSCA 5HISA 4TYTA 2NZFA 4ZEJA 4C1EA 2Y8AA 2FU6A 4D1UA 5HIOA 2YNVA 3AF6A 5ACQA 4HL2A 4PVTA 2BFZA 2Y8BA 2FM6A 3DHBA 2BTNA 2I7XA 5AYAA 5HH4A 5B1UA 3SW3A 1A7TA 1SMLA 5ACUA 2VW8A 5EHTA 4RAWA 3G1PA 4LE6A 3TP9A 1ZNBA 1QH3A 2GMNA 1HLKA 4CHLA 4YSBA 4EYLA 4B87A 4NQ4A 3RKJA 4EXSA 5FQCA 4KEPA 2M5DA 2WYMC 2BIBA 1WUOA 3RKKA 5A0TA 2BG8B 3ESHA 2FK6A 2P97A 3Q6VA 3S0ZA 2YNTA 5AXOA 2NZEA 3PY5A 1KO3A 2M5CA 3IEKA 1K07A 3I13A 3IOFA 3T9MA 3QH8A 3DH8A 4D02A 4BP0A 1Y44A 4TZ9A 2ZZIA 4D1TA 5EW0A 4FEKA 3ZQ4A 3SPUA 3DHCA 5B15A 3IDZA 4GYQA 3FCZA 3T3OA 3RPCA 4YSKA 4AX1B 3X30A 1BMCA 5LM6A 4KEQA 5HIQA 5ACWA 2BC2A 2GKLA 3AJ3A 2XR1A 2WYMA 1WRAA 2H6AA 3IE2A 2P4ZA 5EVBA 3BV6A 3IE0A 1BC2A 4RL0A 2XF4A 5EH9A 3ZWFA 2BG8A 2I7TA 1DXKA 3BK2A 4RBSA 3P2UA 2GCUA 4C09A 3BK1A 4HKYA 1QH5A 2FU9A 4C1HA 4UWPB 3SFPA 5HIPA 2WRSA 5EWAA 4RAMA 5ACSA 3IE1A 2CBNA 4Z67A 2NXAA 3VPEA 4TZBA 4AD9A 2QDSA 1KO2A 4TZFA 3X2YA 5EV8A 2GFJA 4J5FA 1ZTCA 5K4MA 3PG4A 2BG2A 4FR7A 4C1CA 5A0VA 4C1GA 5ACRA 2GFKA 4Z7RA 4UAMA 3SD9A 3MD7A 3DHAA 2A7MA 3A4YA 5EVKA 3FAIA 4ZO3A 2FU8A 3VQZA 1WUPA 3SBLA 3LVZA 3WXCA 2QJSA 4BZ3A 1JT1A 5ACVA 3ZNBA 3R2UA 2OHHA 1ZKPA 2DOOA 5FQBA 1BVTA 4EYFA 3KNSA 5B3RA 1XM8A 2BG6A 5EV6A 2UYXA 2HB9A 4EY2A 4V0HA 2OHJA 4C1DA 3ADRA 2Y87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QDT A;  2QIN A;  1WW1 A;  1VME A;  2R2D A;  4RL2 A;  5LMC A;  2NYP A;  4UWS B;  2WHG A;  2YNW A;  2ZNB A;  5LCF A;  4O98 A;  5LLD A;  4GCW A;  2BFL A;  2ZO4 A;  5LCH A;  5A87 A;  4Z5Y A;  2P18 A;  4UA4 A;  5IQK A;  1YCF A;  2Q0I A;  4NQ2 A;  4TZE A;  4EFZ A;  1VGN A;  1XTO A;  5KIL A;  3I0V A;  3SRX A;  5DPX A;  4XWT A;  2E7Y A;  5K0W A;  1YCH A;  4UBQ A;  3PY6 A;  4NQ6 A;  3KNR A;  1X8I A;  3IEM A;  5ACP A;  1DDK A;  1YCG A;  4EYB A;  5LCA A;  2Q9U A;  3KL7 A;  4XWW A;  4NQ5 A;  4ZO2 A;  5FQA A;  1X8H A;  3I15 A;  4EXY A;  2WYL A;  5ACX A;  4DIK A;  2YCB A;  5KIK A;  5EVD A;  4Z6X A;  2FHX B;  3JXP A;  2QED A;  2YZ3 A;  3X2X A;  4P62 A;  4C1F A;  5LE1 A;  3BC2 A;  1VJN A;  4AWZ A;  1MQO A;  4YSL A;  2BR6 A;  2AIO A;  4AX0 B;  5ACT A;  3IEL A;  5LS3 A;  4RM5 A;  4JO0 A;  3L6N A;  2BFK A;  3I14 A;  1P9E A;  4GYU A;  5K4K A;  5HH5 A;  4D1V A;  2AZ4 A;  2ZWR A;  5HH6 A;  4D1W A;  2OHI A;  5AXR A;  1JJT A;  4WD6 A;  4UWR B;  3X2Z A;  3IOG A;  4PVO A;  4ZNB A;  3T3N A;  2Q0J A;  2YNV B;  4J5H A;  4U4L A;  3F9O A;  3ZR9 A;  2BFZ B;  3AF5 A;  4TYF A;  1KR3 A;  1L9Y A;  1A8T A;  1E5D A;  4XUK A;  3H3E A;  1X8G A;  2BG7 A;  3I11 A;  4HL1 A;  5AHO A;  4F6H A;  1JJE A;  2FHX A;  2BMI A;  5AEB A;  5A5Z A;  4F6Z A;  5K4N A;  2DKF A;  4H0D A;  2YNU A;  5AHR A;  4DIL A;  2P1E A;  1M2X A;  4Z5Z A;  2BGA A;  4AWY B;  4FSB A;  2FU7 A;  2YNT B;  4UWO B;  2Q42 A;  2I7V A;  4Z60 A;  1DD6 A;  5LSC A;  5HIS A;  4TYT A;  2NZF A;  4ZEJ A;  4C1E A;  2Y8A A;  2FU6 A;  4D1U A;  5HIO A;  2YNV A;  3AF6 A;  5ACQ A;  4HL2 A;  4PVT A;  2BFZ A;  2Y8B A;  2FM6 A;  3DHB A;  2BTN A;  2I7X A;  5AYA A;  5HH4 A;  5B1U A;  3SW3 A;  1A7T A;  1SML A;  5ACU A;  2VW8 A;  5EHT A;  4RAW A;  3G1P A;  4LE6 A;  3TP9 A;  1ZNB A;  1QH3 A;  2GMN A;  1HLK A;  4CHL A;  4YSB A;  4EYL A;  4B87 A;  4NQ4 A;  3RKJ A;  4EXS A;  5FQC A;  4KEP A;  2M5D A;  2WYM C;  2BIB A;  1WUO A;  3RKK A;  5A0T A;  2BG8 B;  3ESH A;  2FK6 A;  2P97 A;  3Q6V A;  3S0Z A;  2YNT A;  5AXO A;  2NZE A;  3PY5 A;  1KO3 A;  2M5C A;  3IEK A;  1K07 A;  3I13 A;  3IOF A;  3T9M A;  3QH8 A;  3DH8 A;  4D02 A;  4BP0 A;  1Y44 A;  4TZ9 A;  2ZZI A;  4D1T A;  5EW0 A;  4FEK A;  3ZQ4 A;  3SPU A;  3DHC A;  5B15 A;  3IDZ A;  4GYQ A;  3FCZ A;  3T3O A;  3RPC A;  4YSK A;  4AX1 B;  3X30 A;  1BMC A;  5LM6 A;  4KEQ A;  5HIQ A;  5ACW A;  2BC2 A;  2GKL A;  3AJ3 A;  2XR1 A;  2WYM A;  1WRA A;  2H6A A;  3IE2 A;  2P4Z A;  5EVB A;  3BV6 A;  3IE0 A;  1BC2 A;  4RL0 A;  2XF4 A;  5EH9 A;  3ZWF A;  2BG8 A;  2I7T A;  1DXK A;  3BK2 A;  4RBS A;  3P2U A;  2GCU A;  4C09 A;  3BK1 A;  4HKY A;  1QH5 A;  2FU9 A;  4C1H A;  4UWP B;  3SFP A;  5HIP A;  2WRS A;  5EWA A;  4RAM A;  5ACS A;  3IE1 A;  2CBN A;  4Z67 A;  2NXA A;  3VPE A;  4TZB A;  4AD9 A;  2QDS A;  1KO2 A;  4TZF A;  3X2Y A;  5EV8 A;  2GFJ A;  4J5F A;  1ZTC A;  5K4M A;  3PG4 A;  2BG2 A;  4FR7 A;  4C1C A;  5A0V A;  4C1G A;  5ACR A;  2GFK A;  4Z7R A;  4UAM A;  3SD9 A;  3MD7 A;  3DHA A;  2A7M A;  3A4Y A;  5EVK A;  3FAI A;  4ZO3 A;  2FU8 A;  3VQZ A;  1WUP A;  3SBL A;  3LVZ A;  3WXC A;  2QJS A;  4BZ3 A;  1JT1 A;  5ACV A;  3ZNB A;  3R2U A;  2OHH A;  1ZKP A;  2DOO A;  5FQB A;  1BVT A;  4EYF A;  3KNS A;  5B3R A;  1XM8 A;  2BG6 A;  5EV6 A;  2UYX A;  2HB9 A;  4EY2 A;  4V0H A;  2OHJ A;  4C1D A;  3ADR A;  2Y87 A; 
#chains in the Genus database with same CATH topology
 2QDT A;  2QIN A;  1WW1 A;  1VME A;  2R2D A;  4RL2 A;  5LMC A;  2NYP A;  4UWS B;  2WHG A;  2YNW A;  2ZNB A;  5LCF A;  4O98 A;  5LLD A;  4GCW A;  2BFL A;  2ZO4 A;  5LCH A;  5A87 A;  4Z5Y A;  2P18 A;  4UA4 A;  5IQK A;  1YCF A;  2Q0I A;  4NQ2 A;  4TZE A;  4EFZ A;  1VGN A;  1XTO A;  5A23 A;  5KIL A;  3I0V A;  3SRX A;  5DPX A;  4XWT A;  4AV7 A;  2E7Y A;  2CFU A;  5K0W A;  4PDX A;  1YCH A;  4UBQ A;  3PY6 A;  4NQ6 A;  3KNR A;  1X8I A;  3IEM A;  5ACP A;  1DDK A;  1YCG A;  4EYB A;  5LCA A;  2Q9U A;  3KL7 A;  4XWW A;  4NQ5 A;  4ZO2 A;  5FQA A;  5AJL A;  1X8H A;  3I15 A;  4EXY A;  2WYL A;  5ACX A;  4DIK A;  2YCB A;  5KIK A;  2YHE A;  5EVD A;  4Z6X A;  2FHX B;  3JXP A;  2QED A;  2YZ3 A;  3X2X A;  4P62 A;  4C1F A;  5LE1 A;  3BC2 A;  1VJN A;  4AWZ A;  1MQO A;  4YSL A;  2BR6 A;  2AIO A;  4AX0 B;  4NUR A;  3IEL A;  5ACT A;  5LS3 A;  4RM5 A;  4JO0 A;  3L6N A;  2BFK A;  3I14 A;  1P9E A;  4GYU A;  5K4K A;  5HH5 A;  4D1V A;  2AZ4 A;  2ZWR A;  5HH6 A;  4D1W A;  2OHI A;  5AXR A;  1JJT A;  4WD6 A;  4UWR B;  3X2Z A;  3IOG A;  2CFZ A;  4PVO A;  4ZNB A;  3T3N A;  2Q0J A;  2YNV B;  4J5H A;  4U4L A;  3F9O A;  3ZR9 A;  2BFZ B;  3AF5 A;  4TYF A;  1KR3 A;  1L9Y A;  1A8T A;  1E5D A;  4XUK A;  3H3E A;  1X8G A;  2BG7 A;  3I11 A;  4HL1 A;  5AHO A;  4F6H A;  1JJE A;  2FHX A;  2BMI A;  5AEB A;  5A5Z A;  4F6Z A;  5K4N A;  2DKF A;  4H0D A;  2YNU A;  5AHR A;  4DIL A;  2P1E A;  1M2X A;  4Z5Z A;  2BGA A;  4AWY B;  4FSB A;  2FU7 A;  2YNT B;  4UWO B;  2Q42 A;  2I7V A;  4Z60 A;  1DD6 A;  5LSC A;  5HIS A;  4TYT A;  2NZF A;  4ZEJ A;  4C1E A;  2Y8A A;  2FU6 A;  4D1U A;  5HIO A;  4AXH A;  2YNV A;  3AF6 A;  5ACQ A;  4HL2 A;  4PVT A;  2BFZ A;  2Y8B A;  2FM6 A;  3DHB A;  2BTN A;  2I7X A;  5AYA A;  5HH4 A;  5B1U A;  3SW3 A;  1A7T A;  1SML A;  5ACU A;  2VW8 A;  5EHT A;  4RAW A;  3G1P A;  4LE6 A;  3TP9 A;  1ZNB A;  1QH3 A;  2GMN A;  1HLK A;  4CHL A;  4YSB A;  4EYL A;  4B87 A;  4NQ4 A;  3RKJ A;  4EXS A;  5FQC A;  4KEP A;  2M5D A;  2WYM C;  2BIB A;  1WUO A;  3RKK A;  5A0T A;  2BG8 B;  3ESH A;  2FK6 A;  2P97 A;  3Q6V A;  3S0Z A;  2YNT A;  5AXO A;  2NZE A;  3PY5 A;  1KO3 A;  2M5C A;  3IEK A;  1K07 A;  3I13 A;  3IOF A;  3T9M A;  3QH8 A;  3DH8 A;  4D02 A;  4BP0 A;  1Y44 A;  4TZ9 A;  2ZZI A;  4D1T A;  5EW0 A;  4FEK A;  3ZQ4 A;  3SPU A;  3DHC A;  5B15 A;  3IDZ A;  4GYQ A;  3FCZ A;  3T3O A;  3RPC A;  2CG3 A;  4YSK A;  4AX1 B;  3X30 A;  1BMC A;  5LM6 A;  4KEQ A;  5HIQ A;  5ACW A;  2BC2 A;  2GKL A;  3AJ3 A;  2XR1 A;  2WYM A;  1WRA A;  2H6A A;  3IE2 A;  2P4Z A;  5EVB A;  3BV6 A;  3IE0 A;  1BC2 A;  4RL0 A;  2XF4 A;  5EH9 A;  3ZWF A;  2BG8 A;  2I7T A;  1DXK A;  3BK2 A;  4RBS A;  3P2U A;  2GCU A;  4C09 A;  3BK1 A;  4HKY A;  1QH5 A;  2FU9 A;  4C1H A;  4UWP B;  3SFP A;  5HIP A;  2WRS A;  5EWA A;  4RAM A;  5ACS A;  3IE1 A;  2CBN A;  5AIJ A;  4Z67 A;  2NXA A;  3VPE A;  4TZB A;  4AD9 A;  2QDS A;  1KO2 A;  4TZF A;  3X2Y A;  5EV8 A;  2GFJ A;  4J5F A;  1ZTC A;  5K4M A;  3PG4 A;  2BG2 A;  4FR7 A;  4C1C A;  5A0V A;  4C1G A;  5ACR A;  2GFK A;  4Z7R A;  4UAM A;  3SD9 A;  3MD7 A;  3DHA A;  2A7M A;  3A4Y A;  5EVK A;  3FAI A;  4ZO3 A;  2FU8 A;  3VQZ A;  1WUP A;  3SBL A;  3LVZ A;  3WXC A;  2QJS A;  4BZ3 A;  1JT1 A;  5ACV A;  3ZNB A;  3R2U A;  2OHH A;  1ZKP A;  2DOO A;  5FQB A;  1BVT A;  4EYF A;  3KNS A;  5B3R A;  1XM8 A;  2BG6 A;  5EV6 A;  2UYX A;  2HB9 A;  4EY2 A;  2CG2 A;  4V0H A;  2OHJ A;  4C1D A;  3ADR A;  2Y87 A; 
#chains in the Genus database with same CATH homology
 2QDT A;  2QIN A;  1WW1 A;  1VME A;  2R2D A;  4RL2 A;  5LMC A;  2NYP A;  4UWS B;  2WHG A;  2YNW A;  2ZNB A;  5LCF A;  4O98 A;  5LLD A;  4GCW A;  2BFL A;  2ZO4 A;  5LCH A;  5A87 A;  4Z5Y A;  2P18 A;  4UA4 A;  5IQK A;  1YCF A;  2Q0I A;  4NQ2 A;  4TZE A;  4EFZ A;  1VGN A;  1XTO A;  5KIL A;  3I0V A;  3SRX A;  5DPX A;  4XWT A;  2E7Y A;  5K0W A;  1YCH A;  4UBQ A;  3PY6 A;  4NQ6 A;  3KNR A;  1X8I A;  3IEM A;  5ACP A;  1DDK A;  1YCG A;  4EYB A;  5LCA A;  2Q9U A;  3KL7 A;  4XWW A;  4NQ5 A;  4ZO2 A;  5FQA A;  1X8H A;  3I15 A;  4EXY A;  2WYL A;  5ACX A;  4DIK A;  2YCB A;  5KIK A;  5EVD A;  4Z6X A;  2FHX B;  3JXP A;  2QED A;  2YZ3 A;  3X2X A;  4P62 A;  4C1F A;  5LE1 A;  3BC2 A;  1VJN A;  4AWZ A;  1MQO A;  4YSL A;  2BR6 A;  2AIO A;  4AX0 B;  5ACT A;  3IEL A;  5LS3 A;  4RM5 A;  4JO0 A;  3L6N A;  2BFK A;  3I14 A;  1P9E A;  4GYU A;  5K4K A;  5HH5 A;  4D1V A;  2AZ4 A;  2ZWR A;  5HH6 A;  4D1W A;  2OHI A;  5AXR A;  1JJT A;  4WD6 A;  4UWR B;  3X2Z A;  3IOG A;  4PVO A;  4ZNB A;  3T3N A;  2Q0J A;  2YNV B;  4J5H A;  4U4L A;  3F9O A;  3ZR9 A;  2BFZ B;  3AF5 A;  4TYF A;  1KR3 A;  1L9Y A;  1A8T A;  1E5D A;  4XUK A;  3H3E A;  1X8G A;  2BG7 A;  3I11 A;  4HL1 A;  5AHO A;  4F6H A;  1JJE A;  2FHX A;  2BMI A;  5AEB A;  5A5Z A;  4F6Z A;  5K4N A;  2DKF A;  4H0D A;  2YNU A;  5AHR A;  4DIL A;  2P1E A;  1M2X A;  4Z5Z A;  2BGA A;  4AWY B;  4FSB A;  2FU7 A;  2YNT B;  4UWO B;  2Q42 A;  2I7V A;  4Z60 A;  1DD6 A;  5LSC A;  5HIS A;  4TYT A;  2NZF A;  4ZEJ A;  4C1E A;  2Y8A A;  2FU6 A;  4D1U A;  5HIO A;  2YNV A;  3AF6 A;  5ACQ A;  4HL2 A;  4PVT A;  2BFZ A;  2Y8B A;  2FM6 A;  3DHB A;  2BTN A;  2I7X A;  5AYA A;  5HH4 A;  5B1U A;  3SW3 A;  1A7T A;  1SML A;  5ACU A;  2VW8 A;  5EHT A;  4RAW A;  3G1P A;  4LE6 A;  3TP9 A;  1ZNB A;  1QH3 A;  2GMN A;  1HLK A;  4CHL A;  4YSB A;  4EYL A;  4B87 A;  4NQ4 A;  3RKJ A;  4EXS A;  5FQC A;  4KEP A;  2M5D A;  2WYM C;  2BIB A;  1WUO A;  3RKK A;  5A0T A;  2BG8 B;  3ESH A;  2FK6 A;  2P97 A;  3Q6V A;  3S0Z A;  2YNT A;  5AXO A;  2NZE A;  3PY5 A;  1KO3 A;  2M5C A;  3IEK A;  1K07 A;  3I13 A;  3IOF A;  3T9M A;  3QH8 A;  3DH8 A;  4D02 A;  4BP0 A;  1Y44 A;  4TZ9 A;  2ZZI A;  4D1T A;  5EW0 A;  4FEK A;  3ZQ4 A;  3SPU A;  3DHC A;  5B15 A;  3IDZ A;  4GYQ A;  3FCZ A;  3T3O A;  3RPC A;  4YSK A;  4AX1 B;  3X30 A;  1BMC A;  5LM6 A;  4KEQ A;  5HIQ A;  5ACW A;  2BC2 A;  2GKL A;  3AJ3 A;  2XR1 A;  2WYM A;  1WRA A;  2H6A A;  3IE2 A;  2P4Z A;  5EVB A;  3BV6 A;  3IE0 A;  1BC2 A;  4RL0 A;  2XF4 A;  5EH9 A;  3ZWF A;  2BG8 A;  2I7T A;  1DXK A;  3BK2 A;  4RBS A;  3P2U A;  2GCU A;  4C09 A;  3BK1 A;  4HKY A;  1QH5 A;  2FU9 A;  4C1H A;  4UWP B;  3SFP A;  5HIP A;  2WRS A;  5EWA A;  4RAM A;  5ACS A;  3IE1 A;  2CBN A;  4Z67 A;  2NXA A;  3VPE A;  4TZB A;  4AD9 A;  2QDS A;  1KO2 A;  4TZF A;  3X2Y A;  5EV8 A;  2GFJ A;  4J5F A;  1ZTC A;  5K4M A;  3PG4 A;  2BG2 A;  4FR7 A;  4C1C A;  5A0V A;  4C1G A;  5ACR A;  2GFK A;  4Z7R A;  4UAM A;  3SD9 A;  3MD7 A;  3DHA A;  2A7M A;  3A4Y A;  5EVK A;  3FAI A;  4ZO3 A;  2FU8 A;  3VQZ A;  1WUP A;  3SBL A;  3LVZ A;  3WXC A;  2QJS A;  4BZ3 A;  1JT1 A;  5ACV A;  3ZNB A;  3R2U A;  2OHH A;  1ZKP A;  2DOO A;  5FQB A;  1BVT A;  4EYF A;  3KNS A;  5B3R A;  1XM8 A;  2BG6 A;  5EV6 A;  2UYX A;  2HB9 A;  4EY2 A;  4V0H A;  2OHJ A;  4C1D A;  3ADR A;  2Y87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...