1XTOA

Crystal structure of the coenzyme pqq synthesis protein (pqqb) from pseudomonas putida, northeast structural genomics target ppr6
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
304
structure length
304
Chain Sequence
MYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIALSDDGVHWILCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLREGCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFPLRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLLVDGTLWEDDEMQRRGVGTRTGREMGHLAQNGPGGMLEVLDGFPRQRKVLIHINNTNPILDENSPERAEVLRRGVEVAFDGMSIELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Coenzyme PQQ Synthesis Protein (PqqB) from Pseudomonas putida, Northeast Structural Genomics Target PpR6
rcsb
source organism Pseudomonas putida
molecule tags Structural genomics, unknown function
molecule keywords Coenzyme PQQ synthesis protein B
total genus 78
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2004-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1xtoA00
3DH8A 4D1WA 4FR7A 2P97A 4UWRB 4C1CA 2H6AA 3VQZA 5A0TA 5K0WA 4DILA 1K07A 1BMCA 2A7MA 3T3NA 2YNTB 3P2UA 4RL2A 2YNVA 4XWWA 3IEMA 1M2XA 2FU8A 4AD9A 2I7TA 3S0ZA 2Y8BA 2Y87A 4C1GA 3T9MA 4H0DA 2FU9A 5ACVA 2WRSA 2XR1A 4LE6A 5EW0A 1BVTA 4RAMA 3F9OA 1YCHA 2BR6A 2BG7A 1QH5A 2VW8A 1QH3A 2YNUA 3KNRA 4HKYA 4XWTA 4TYFA 5FQBA 3I14A 3BV6A 4TZBA 2GMNA 2M5CA 1WRAA 4J5FA 2E7YA 3AJ3A 4Z60A 2ZWRA 4GYUA 2FM6A 5AHRA 3T3OA 3FAIA 4FEKA 4HL1A 2YCBA 5ACTA 3ZQ4A 3R2UA 4EYFA 4RAWA 3VPEA 3IDZA 3A4YA 3QH8A 2QEDA 5KILA 4UWSB 4C1HA 3SBLA 5AEBA 1DXKA 1VJNA 5FQAA 4TYTA 3SRXA 2ZNBA 4Z7RA 5LCFA 2OHHA 4J5HA 3SW3A 2YNVB 2GFJA 4DIKA 1A7TA 1JT1A 2Q0JA 4RBSA 4CHLA 2FU7A 3RKJA 1X8HA 2BFZA 4EFZA 5LM6A 1BC2A 2BTNA 3IE2A 4RL0A 4AX1B 1ZNBA 2P4ZA 2FHXB 5B1UA 2ZO4A 3BC2A 4UWOB 4PVTA 4JO0A 3G1PA 4UAMA 3RKKA 5HH5A 5LE1A 5KIKA 1KO2A 5EHTA 3I0VA 4C1DA 5EVDA 4KEQA 1WUPA 4C1EA 2BMIA 2XF4A 1X8IA 2BG8A 1KR3A 2BC2A 2Y8AA 5ACPA 2OHJA 3I13A 3I15A 5EVBA 3BK1A 5A5ZA 5K4NA 4YSKA 1JJTA 4B87A 2DOOA 2NZFA 2WYMC 2YNTA 1E5DA 3Q6VA 2WHGA 5HIOA 5AXOA 5EV6A 2AIOA 5A0VA 2P18A 1VMEA 4C09A 5LLDA 2NZEA 5K4MA 4EXSA 3DHAA 4D1VA 2FU6A 2CBNA 3IEKA 3SFPA 2I7XA 2Q42A 1JJEA 5LS3A 3H3EA 2OHIA 3RPCA 1DDKA 1HLKA 2DKFA 2BFKA 2QDSA 3IE0A 5B3RA 3SD9A 4AWZA 2M5DA 2WYLA 3PG4A 4O98A 2BFZB 5A87A 5EV8A 3AF5A 4NQ2A 2GFKA 4ZO3A 2BGAA 1X8GA 2Q0IA 4P62A 4TZ9A 3ESHA 2YNWA 4BP0A 1XTOA 5HIQA 4U4LA 3IELA 4GCWA 4UWPB 4UA4A 4Z67A 3BK2A 2AZ4A 4ZEJA 3L6NA 5FQCA 4EXYA 1Y44A 2HB9A 4GYQA 3KNSA 5B15A 5K4KA 1A8TA 2BG8B 2BG6A 1YCGA 4PVOA 2BG2A 3IE1A 5EWAA 5AHOA 3X2XA 3MD7A 5LCHA 4BZ3A 5ACSA 5EH9A 4XUKA 4FSBA 1MQOA 5LMCA 2QJSA 5AYAA 4EYBA 1P9EA 1SMLA 4ZO2A 4AX0B 2NYPA 4WD6A 2WYMA 5LCAA 1WW1A 5ACRA 1YCFA 2BIBA 3LVZA 4RM5A 3X2YA 2FHXA 2I7VA 1L9YA 3SPUA 3PY5A 4F6HA 4AWYB 4KEPA 3DHCA 3ZNBA 3ADRA 5HH6A 4YSLA 4NQ4A 4D1TA 5IQKA 4Z5YA 2FK6A 4HL2A 3DHBA 2BFLA 3KL7A 5DPXA 3FCZA 3X30A 3PY6A 2UYXA 3IOFA 4NQ6A 3X2ZA 1ZTCA 1DD6A 4D1UA 4D02A 5HISA 4V0HA 2QINA 3ZR9A 2P1EA 3AF6A 2GCUA 2QDTA 4NQ5A 4TZFA 1ZKPA 1XM8A 5AXRA 4F6ZA 1VGNA 1KO3A 4YSBA 2YZ3A 5HIPA 2NXAA 5ACXA 3JXPA 4ZNBA 3IOGA 4C1FA 2GKLA 4TZEA 5HH4A 2Q9UA 5ACWA 2ZZIA 3WXCA 4EY2A 2R2DA 1WUOA 3I11A 3ZWFA 4UBQA 5LSCA 5ACQA 4Z6XA 4Z5ZA 4EYLA 5EVKA 5ACUA 3TP9A
chains in the Genus database with same CATH superfamily
3DH8A 4D1WA 5AIJA 4FR7A 2P97A 4UWRB 4C1CA 2H6AA 3VQZA 5A0TA 5K0WA 4DILA 1K07A 1BMCA 2A7MA 3T3NA 2YNTB 3P2UA 4RL2A 2CG3A 2YNVA 4XWWA 3IEMA 1M2XA 2FU8A 4AD9A 2I7TA 3S0ZA 2Y8BA 2Y87A 4C1GA 3T9MA 4H0DA 2FU9A 5ACVA 2WRSA 2XR1A 4LE6A 5EW0A 1BVTA 4RAMA 3F9OA 1YCHA 2BR6A 2BG7A 1QH5A 2VW8A 1QH3A 2YNUA 3KNRA 4HKYA 4XWTA 4TYFA 5FQBA 3I14A 3BV6A 4TZBA 2GMNA 2M5CA 1WRAA 4J5FA 2E7YA 3AJ3A 4Z60A 2ZWRA 4GYUA 2FM6A 5AHRA 3T3OA 3FAIA 4PDXA 4FEKA 4HL1A 2YCBA 5ACTA 3ZQ4A 3R2UA 4EYFA 4RAWA 3VPEA 3IDZA 3A4YA 3QH8A 2QEDA 5KILA 4UWSB 4C1HA 3SBLA 5AEBA 1DXKA 1VJNA 5FQAA 4TYTA 3SRXA 2ZNBA 4Z7RA 5LCFA 2OHHA 4J5HA 3SW3A 2YNVB 2GFJA 4DIKA 1A7TA 1JT1A 2Q0JA 4RBSA 4CHLA 2FU7A 3RKJA 1X8HA 2BFZA 4EFZA 5LM6A 1BC2A 2BTNA 3IE2A 4RL0A 4AX1B 1ZNBA 2P4ZA 2FHXB 5B1UA 2ZO4A 5A23A 3BC2A 4UWOB 4PVTA 4JO0A 3G1PA 4UAMA 3RKKA 5HH5A 5LE1A 5KIKA 1KO2A 5EHTA 3I0VA 4C1DA 5EVDA 4KEQA 1WUPA 4C1EA 2BMIA 2XF4A 1X8IA 2BG8A 1KR3A 2BC2A 2Y8AA 5ACPA 2OHJA 3I13A 3I15A 5EVBA 2CFUA 3BK1A 5A5ZA 5K4NA 4YSKA 1JJTA 4B87A 2DOOA 2NZFA 2WYMC 2YNTA 1E5DA 3Q6VA 2WHGA 5HIOA 5AXOA 5EV6A 2CG2A 2AIOA 5A0VA 2P18A 1VMEA 4NURA 4C09A 5LLDA 2NZEA 5K4MA 4EXSA 3DHAA 4D1VA 2FU6A 2CBNA 3IEKA 3SFPA 2I7XA 2Q42A 1JJEA 5LS3A 3H3EA 2OHIA 3RPCA 1DDKA 1HLKA 2DKFA 2BFKA 2QDSA 3IE0A 5B3RA 3SD9A 4AWZA 2M5DA 2WYLA 3PG4A 4O98A 2BFZB 5A87A 5EV8A 3AF5A 4NQ2A 2GFKA 4ZO3A 2BGAA 1X8GA 2Q0IA 4P62A 4TZ9A 3ESHA 2YNWA 4BP0A 1XTOA 5HIQA 4U4LA 3IELA 4AV7A 4GCWA 4UWPB 2CFZA 4UA4A 4Z67A 3BK2A 2AZ4A 4ZEJA 3L6NA 5FQCA 4EXYA 1Y44A 2HB9A 4GYQA 3KNSA 5B15A 5K4KA 1A8TA 2BG8B 2BG6A 1YCGA 4PVOA 2BG2A 3IE1A 5EWAA 5AHOA 3X2XA 3MD7A 5LCHA 4BZ3A 5ACSA 5EH9A 4XUKA 4FSBA 1MQOA 5LMCA 2QJSA 5AYAA 4EYBA 1P9EA 1SMLA 4ZO2A 4AX0B 2NYPA 4WD6A 2WYMA 5LCAA 1WW1A 5ACRA 1YCFA 2BIBA 3LVZA 4RM5A 3X2YA 2FHXA 2I7VA 1L9YA 3SPUA 3PY5A 4F6HA 4AWYB 4KEPA 3DHCA 3ZNBA 3ADRA 5HH6A 4YSLA 4NQ4A 4D1TA 5AJLA 4AXHA 5IQKA 4Z5YA 2FK6A 4HL2A 3DHBA 2BFLA 3KL7A 5DPXA 3FCZA 3X30A 3PY6A 2UYXA 3IOFA 4NQ6A 3X2ZA 1ZTCA 1DD6A 4D1UA 4D02A 5HISA 4V0HA 2QINA 3ZR9A 2P1EA 3AF6A 2GCUA 2QDTA 4NQ5A 4TZFA 1ZKPA 1XM8A 5AXRA 4F6ZA 1VGNA 1KO3A 4YSBA 2YZ3A 5HIPA 2NXAA 5ACXA 3JXPA 4ZNBA 3IOGA 4C1FA 2GKLA 4TZEA 5HH4A 2Q9UA 5ACWA 2ZZIA 3WXCA 4EY2A 2R2DA 1WUOA 3I11A 3ZWFA 4UBQA 2YHEA 5LSCA 5ACQA 4Z6XA 4Z5ZA 4EYLA 5EVKA 5ACUA 3TP9A
chains in the Genus database with same CATH topology
3DH8A 4D1WA 4FR7A 2P97A 4UWRB 4C1CA 2H6AA 3VQZA 5A0TA 5K0WA 4DILA 1K07A 1BMCA 2A7MA 3T3NA 2YNTB 3P2UA 4RL2A 2YNVA 4XWWA 3IEMA 1M2XA 2FU8A 4AD9A 2I7TA 3S0ZA 2Y8BA 2Y87A 4C1GA 3T9MA 4H0DA 2FU9A 5ACVA 2WRSA 2XR1A 4LE6A 5EW0A 1BVTA 4RAMA 3F9OA 1YCHA 2BR6A 2BG7A 1QH5A 2VW8A 1QH3A 2YNUA 3KNRA 4HKYA 4XWTA 4TYFA 5FQBA 3I14A 3BV6A 4TZBA 2GMNA 2M5CA 1WRAA 4J5FA 2E7YA 3AJ3A 4Z60A 2ZWRA 4GYUA 2FM6A 5AHRA 3T3OA 3FAIA 4FEKA 4HL1A 2YCBA 5ACTA 3ZQ4A 3R2UA 4EYFA 4RAWA 3VPEA 3IDZA 3A4YA 3QH8A 2QEDA 5KILA 4UWSB 4C1HA 3SBLA 5AEBA 1DXKA 1VJNA 5FQAA 4TYTA 3SRXA 2ZNBA 4Z7RA 5LCFA 2OHHA 4J5HA 3SW3A 2YNVB 2GFJA 4DIKA 1A7TA 1JT1A 2Q0JA 4RBSA 4CHLA 2FU7A 3RKJA 1X8HA 2BFZA 4EFZA 5LM6A 1BC2A 2BTNA 3IE2A 4RL0A 4AX1B 1ZNBA 2P4ZA 2FHXB 5B1UA 2ZO4A 3BC2A 4UWOB 4PVTA 4JO0A 3G1PA 4UAMA 3RKKA 5HH5A 5LE1A 5KIKA 1KO2A 5EHTA 3I0VA 4C1DA 5EVDA 4KEQA 1WUPA 4C1EA 2BMIA 2XF4A 1X8IA 2BG8A 1KR3A 2BC2A 2Y8AA 5ACPA 2OHJA 3I13A 3I15A 5EVBA 3BK1A 5A5ZA 5K4NA 4YSKA 1JJTA 4B87A 2DOOA 2NZFA 2WYMC 2YNTA 1E5DA 3Q6VA 2WHGA 5HIOA 5AXOA 5EV6A 2AIOA 5A0VA 2P18A 1VMEA 4C09A 5LLDA 2NZEA 5K4MA 4EXSA 3DHAA 4D1VA 2FU6A 2CBNA 3IEKA 3SFPA 2I7XA 2Q42A 1JJEA 5LS3A 3H3EA 2OHIA 3RPCA 1DDKA 1HLKA 2DKFA 2BFKA 2QDSA 3IE0A 5B3RA 3SD9A 4AWZA 2M5DA 2WYLA 3PG4A 4O98A 2BFZB 5A87A 5EV8A 3AF5A 4NQ2A 2GFKA 4ZO3A 2BGAA 1X8GA 2Q0IA 4P62A 4TZ9A 3ESHA 2YNWA 4BP0A 1XTOA 5HIQA 4U4LA 3IELA 4GCWA 4UWPB 4UA4A 4Z67A 3BK2A 2AZ4A 4ZEJA 3L6NA 5FQCA 4EXYA 1Y44A 2HB9A 4GYQA 3KNSA 5B15A 5K4KA 1A8TA 2BG8B 2BG6A 1YCGA 4PVOA 2BG2A 3IE1A 5EWAA 5AHOA 3X2XA 3MD7A 5LCHA 4BZ3A 5ACSA 5EH9A 4XUKA 4FSBA 1MQOA 5LMCA 2QJSA 5AYAA 4EYBA 1P9EA 1SMLA 4ZO2A 4AX0B 2NYPA 4WD6A 2WYMA 5LCAA 1WW1A 5ACRA 1YCFA 2BIBA 3LVZA 4RM5A 3X2YA 2FHXA 2I7VA 1L9YA 3SPUA 3PY5A 4F6HA 4AWYB 4KEPA 3DHCA 3ZNBA 3ADRA 5HH6A 4YSLA 4NQ4A 4D1TA 5IQKA 4Z5YA 2FK6A 4HL2A 3DHBA 2BFLA 3KL7A 5DPXA 3FCZA 3X30A 3PY6A 2UYXA 3IOFA 4NQ6A 3X2ZA 1ZTCA 1DD6A 4D1UA 4D02A 5HISA 4V0HA 2QINA 3ZR9A 2P1EA 3AF6A 2GCUA 2QDTA 4NQ5A 4TZFA 1ZKPA 1XM8A 5AXRA 4F6ZA 1VGNA 1KO3A 4YSBA 2YZ3A 5HIPA 2NXAA 5ACXA 3JXPA 4ZNBA 3IOGA 4C1FA 2GKLA 4TZEA 5HH4A 2Q9UA 5ACWA 2ZZIA 3WXCA 4EY2A 2R2DA 1WUOA 3I11A 3ZWFA 4UBQA 5LSCA 5ACQA 4Z6XA 4Z5ZA 4EYLA 5EVKA 5ACUA 3TP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DH8 A;  4D1W A;  4FR7 A;  2P97 A;  4UWR B;  4C1C A;  2H6A A;  3VQZ A;  5A0T A;  5K0W A;  4DIL A;  1K07 A;  1BMC A;  2A7M A;  3T3N A;  2YNT B;  3P2U A;  4RL2 A;  2YNV A;  4XWW A;  3IEM A;  1M2X A;  2FU8 A;  4AD9 A;  2I7T A;  3S0Z A;  2Y8B A;  2Y87 A;  4C1G A;  3T9M A;  4H0D A;  2FU9 A;  5ACV A;  2WRS A;  2XR1 A;  4LE6 A;  5EW0 A;  1BVT A;  4RAM A;  3F9O A;  1YCH A;  2BR6 A;  2BG7 A;  1QH5 A;  2VW8 A;  1QH3 A;  2YNU A;  3KNR A;  4HKY A;  4XWT A;  4TYF A;  5FQB A;  3I14 A;  3BV6 A;  4TZB A;  2GMN A;  2M5C A;  1WRA A;  4J5F A;  2E7Y A;  3AJ3 A;  4Z60 A;  2ZWR A;  4GYU A;  2FM6 A;  5AHR A;  3T3O A;  3FAI A;  4FEK A;  4HL1 A;  2YCB A;  5ACT A;  3ZQ4 A;  3R2U A;  4EYF A;  4RAW A;  3VPE A;  3IDZ A;  3A4Y A;  3QH8 A;  2QED A;  5KIL A;  4UWS B;  4C1H A;  3SBL A;  5AEB A;  1DXK A;  1VJN A;  5FQA A;  4TYT A;  3SRX A;  2ZNB A;  4Z7R A;  5LCF A;  2OHH A;  4J5H A;  3SW3 A;  2YNV B;  2GFJ A;  4DIK A;  1A7T A;  1JT1 A;  2Q0J A;  4RBS A;  4CHL A;  2FU7 A;  3RKJ A;  1X8H A;  2BFZ A;  4EFZ A;  5LM6 A;  1BC2 A;  2BTN A;  3IE2 A;  4RL0 A;  4AX1 B;  1ZNB A;  2P4Z A;  2FHX B;  5B1U A;  2ZO4 A;  3BC2 A;  4UWO B;  4PVT A;  4JO0 A;  3G1P A;  4UAM A;  3RKK A;  5HH5 A;  5LE1 A;  5KIK A;  1KO2 A;  5EHT A;  3I0V A;  4C1D A;  5EVD A;  4KEQ A;  1WUP A;  4C1E A;  2BMI A;  2XF4 A;  1X8I A;  2BG8 A;  1KR3 A;  2BC2 A;  2Y8A A;  5ACP A;  2OHJ A;  3I13 A;  3I15 A;  5EVB A;  3BK1 A;  5A5Z A;  5K4N A;  4YSK A;  1JJT A;  4B87 A;  2DOO A;  2NZF A;  2WYM C;  2YNT A;  1E5D A;  3Q6V A;  2WHG A;  5HIO A;  5AXO A;  5EV6 A;  2AIO A;  5A0V A;  2P18 A;  1VME A;  4C09 A;  5LLD A;  2NZE A;  5K4M A;  4EXS A;  3DHA A;  4D1V A;  2FU6 A;  2CBN A;  3IEK A;  3SFP A;  2I7X A;  2Q42 A;  1JJE A;  5LS3 A;  3H3E A;  2OHI A;  3RPC A;  1DDK A;  1HLK A;  2DKF A;  2BFK A;  2QDS A;  3IE0 A;  5B3R A;  3SD9 A;  4AWZ A;  2M5D A;  2WYL A;  3PG4 A;  4O98 A;  2BFZ B;  5A87 A;  5EV8 A;  3AF5 A;  4NQ2 A;  2GFK A;  4ZO3 A;  2BGA A;  1X8G A;  2Q0I A;  4P62 A;  4TZ9 A;  3ESH A;  2YNW A;  4BP0 A;  1XTO A;  5HIQ A;  4U4L A;  3IEL A;  4GCW A;  4UWP B;  4UA4 A;  4Z67 A;  3BK2 A;  2AZ4 A;  4ZEJ A;  3L6N A;  5FQC A;  4EXY A;  1Y44 A;  2HB9 A;  4GYQ A;  3KNS A;  5B15 A;  5K4K A;  1A8T A;  2BG8 B;  2BG6 A;  1YCG A;  4PVO A;  2BG2 A;  3IE1 A;  5EWA A;  5AHO A;  3X2X A;  3MD7 A;  5LCH A;  4BZ3 A;  5ACS A;  5EH9 A;  4XUK A;  4FSB A;  1MQO A;  5LMC A;  2QJS A;  5AYA A;  4EYB A;  1P9E A;  1SML A;  4ZO2 A;  4AX0 B;  2NYP A;  4WD6 A;  2WYM A;  5LCA A;  1WW1 A;  5ACR A;  1YCF A;  2BIB A;  3LVZ A;  4RM5 A;  3X2Y A;  2FHX A;  2I7V A;  1L9Y A;  3SPU A;  3PY5 A;  4F6H A;  4AWY B;  4KEP A;  3DHC A;  3ZNB A;  3ADR A;  5HH6 A;  4YSL A;  4NQ4 A;  4D1T A;  5IQK A;  4Z5Y A;  2FK6 A;  4HL2 A;  3DHB A;  2BFL A;  3KL7 A;  5DPX A;  3FCZ A;  3X30 A;  3PY6 A;  2UYX A;  3IOF A;  4NQ6 A;  3X2Z A;  1ZTC A;  1DD6 A;  4D1U A;  4D02 A;  5HIS A;  4V0H A;  2QIN A;  3ZR9 A;  2P1E A;  3AF6 A;  2GCU A;  2QDT A;  4NQ5 A;  4TZF A;  1ZKP A;  1XM8 A;  5AXR A;  4F6Z A;  1VGN A;  1KO3 A;  4YSB A;  2YZ3 A;  5HIP A;  2NXA A;  5ACX A;  3JXP A;  4ZNB A;  3IOG A;  4C1F A;  2GKL A;  4TZE A;  5HH4 A;  2Q9U A;  5ACW A;  2ZZI A;  3WXC A;  4EY2 A;  2R2D A;  1WUO A;  3I11 A;  3ZWF A;  4UBQ A;  5LSC A;  5ACQ A;  4Z6X A;  4Z5Z A;  4EYL A;  5EVK A;  5ACU A;  3TP9 A; 
#chains in the Genus database with same CATH topology
 3DH8 A;  4D1W A;  5AIJ A;  4FR7 A;  2P97 A;  4UWR B;  4C1C A;  2H6A A;  3VQZ A;  5A0T A;  5K0W A;  4DIL A;  1K07 A;  1BMC A;  2A7M A;  3T3N A;  2YNT B;  3P2U A;  4RL2 A;  2CG3 A;  2YNV A;  4XWW A;  3IEM A;  1M2X A;  2FU8 A;  4AD9 A;  2I7T A;  3S0Z A;  2Y8B A;  2Y87 A;  4C1G A;  3T9M A;  4H0D A;  2FU9 A;  5ACV A;  2WRS A;  2XR1 A;  4LE6 A;  5EW0 A;  1BVT A;  4RAM A;  3F9O A;  1YCH A;  2BR6 A;  2BG7 A;  1QH5 A;  2VW8 A;  1QH3 A;  2YNU A;  3KNR A;  4HKY A;  4XWT A;  4TYF A;  5FQB A;  3I14 A;  3BV6 A;  4TZB A;  2GMN A;  2M5C A;  1WRA A;  4J5F A;  2E7Y A;  3AJ3 A;  4Z60 A;  2ZWR A;  4GYU A;  2FM6 A;  5AHR A;  3T3O A;  3FAI A;  4PDX A;  4FEK A;  4HL1 A;  2YCB A;  5ACT A;  3ZQ4 A;  3R2U A;  4EYF A;  4RAW A;  3VPE A;  3IDZ A;  3A4Y A;  3QH8 A;  2QED A;  5KIL A;  4UWS B;  4C1H A;  3SBL A;  5AEB A;  1DXK A;  1VJN A;  5FQA A;  4TYT A;  3SRX A;  2ZNB A;  4Z7R A;  5LCF A;  2OHH A;  4J5H A;  3SW3 A;  2YNV B;  2GFJ A;  4DIK A;  1A7T A;  1JT1 A;  2Q0J A;  4RBS A;  4CHL A;  2FU7 A;  3RKJ A;  1X8H A;  2BFZ A;  4EFZ A;  5LM6 A;  1BC2 A;  2BTN A;  3IE2 A;  4RL0 A;  4AX1 B;  1ZNB A;  2P4Z A;  2FHX B;  5B1U A;  2ZO4 A;  5A23 A;  3BC2 A;  4UWO B;  4PVT A;  4JO0 A;  3G1P A;  4UAM A;  3RKK A;  5HH5 A;  5LE1 A;  5KIK A;  1KO2 A;  5EHT A;  3I0V A;  4C1D A;  5EVD A;  4KEQ A;  1WUP A;  4C1E A;  2BMI A;  2XF4 A;  1X8I A;  2BG8 A;  1KR3 A;  2BC2 A;  2Y8A A;  5ACP A;  2OHJ A;  3I13 A;  3I15 A;  5EVB A;  2CFU A;  3BK1 A;  5A5Z A;  5K4N A;  4YSK A;  1JJT A;  4B87 A;  2DOO A;  2NZF A;  2WYM C;  2YNT A;  1E5D A;  3Q6V A;  2WHG A;  5HIO A;  5AXO A;  5EV6 A;  2CG2 A;  2AIO A;  5A0V A;  2P18 A;  1VME A;  4NUR A;  4C09 A;  5LLD A;  2NZE A;  5K4M A;  4EXS A;  3DHA A;  4D1V A;  2FU6 A;  2CBN A;  3IEK A;  3SFP A;  2I7X A;  2Q42 A;  1JJE A;  5LS3 A;  3H3E A;  2OHI A;  3RPC A;  1DDK A;  1HLK A;  2DKF A;  2BFK A;  2QDS A;  3IE0 A;  5B3R A;  3SD9 A;  4AWZ A;  2M5D A;  2WYL A;  3PG4 A;  4O98 A;  2BFZ B;  5A87 A;  5EV8 A;  3AF5 A;  4NQ2 A;  2GFK A;  4ZO3 A;  2BGA A;  1X8G A;  2Q0I A;  4P62 A;  4TZ9 A;  3ESH A;  2YNW A;  4BP0 A;  1XTO A;  5HIQ A;  4U4L A;  3IEL A;  4AV7 A;  4GCW A;  4UWP B;  2CFZ A;  4UA4 A;  4Z67 A;  3BK2 A;  2AZ4 A;  4ZEJ A;  3L6N A;  5FQC A;  4EXY A;  1Y44 A;  2HB9 A;  4GYQ A;  3KNS A;  5B15 A;  5K4K A;  1A8T A;  2BG8 B;  2BG6 A;  1YCG A;  4PVO A;  2BG2 A;  3IE1 A;  5EWA A;  5AHO A;  3X2X A;  3MD7 A;  5LCH A;  4BZ3 A;  5ACS A;  5EH9 A;  4XUK A;  4FSB A;  1MQO A;  5LMC A;  2QJS A;  5AYA A;  4EYB A;  1P9E A;  1SML A;  4ZO2 A;  4AX0 B;  2NYP A;  4WD6 A;  2WYM A;  5LCA A;  1WW1 A;  5ACR A;  1YCF A;  2BIB A;  3LVZ A;  4RM5 A;  3X2Y A;  2FHX A;  2I7V A;  1L9Y A;  3SPU A;  3PY5 A;  4F6H A;  4AWY B;  4KEP A;  3DHC A;  3ZNB A;  3ADR A;  5HH6 A;  4YSL A;  4NQ4 A;  4D1T A;  5AJL A;  4AXH A;  5IQK A;  4Z5Y A;  2FK6 A;  4HL2 A;  3DHB A;  2BFL A;  3KL7 A;  5DPX A;  3FCZ A;  3X30 A;  3PY6 A;  2UYX A;  3IOF A;  4NQ6 A;  3X2Z A;  1ZTC A;  1DD6 A;  4D1U A;  4D02 A;  5HIS A;  4V0H A;  2QIN A;  3ZR9 A;  2P1E A;  3AF6 A;  2GCU A;  2QDT A;  4NQ5 A;  4TZF A;  1ZKP A;  1XM8 A;  5AXR A;  4F6Z A;  1VGN A;  1KO3 A;  4YSB A;  2YZ3 A;  5HIP A;  2NXA A;  5ACX A;  3JXP A;  4ZNB A;  3IOG A;  4C1F A;  2GKL A;  4TZE A;  5HH4 A;  2Q9U A;  5ACW A;  2ZZI A;  3WXC A;  4EY2 A;  2R2D A;  1WUO A;  3I11 A;  3ZWF A;  4UBQ A;  2YHE A;  5LSC A;  5ACQ A;  4Z6X A;  4Z5Z A;  4EYL A;  5EVK A;  5ACU A;  3TP9 A; 
#chains in the Genus database with same CATH homology
 3DH8 A;  4D1W A;  4FR7 A;  2P97 A;  4UWR B;  4C1C A;  2H6A A;  3VQZ A;  5A0T A;  5K0W A;  4DIL A;  1K07 A;  1BMC A;  2A7M A;  3T3N A;  2YNT B;  3P2U A;  4RL2 A;  2YNV A;  4XWW A;  3IEM A;  1M2X A;  2FU8 A;  4AD9 A;  2I7T A;  3S0Z A;  2Y8B A;  2Y87 A;  4C1G A;  3T9M A;  4H0D A;  2FU9 A;  5ACV A;  2WRS A;  2XR1 A;  4LE6 A;  5EW0 A;  1BVT A;  4RAM A;  3F9O A;  1YCH A;  2BR6 A;  2BG7 A;  1QH5 A;  2VW8 A;  1QH3 A;  2YNU A;  3KNR A;  4HKY A;  4XWT A;  4TYF A;  5FQB A;  3I14 A;  3BV6 A;  4TZB A;  2GMN A;  2M5C A;  1WRA A;  4J5F A;  2E7Y A;  3AJ3 A;  4Z60 A;  2ZWR A;  4GYU A;  2FM6 A;  5AHR A;  3T3O A;  3FAI A;  4FEK A;  4HL1 A;  2YCB A;  5ACT A;  3ZQ4 A;  3R2U A;  4EYF A;  4RAW A;  3VPE A;  3IDZ A;  3A4Y A;  3QH8 A;  2QED A;  5KIL A;  4UWS B;  4C1H A;  3SBL A;  5AEB A;  1DXK A;  1VJN A;  5FQA A;  4TYT A;  3SRX A;  2ZNB A;  4Z7R A;  5LCF A;  2OHH A;  4J5H A;  3SW3 A;  2YNV B;  2GFJ A;  4DIK A;  1A7T A;  1JT1 A;  2Q0J A;  4RBS A;  4CHL A;  2FU7 A;  3RKJ A;  1X8H A;  2BFZ A;  4EFZ A;  5LM6 A;  1BC2 A;  2BTN A;  3IE2 A;  4RL0 A;  4AX1 B;  1ZNB A;  2P4Z A;  2FHX B;  5B1U A;  2ZO4 A;  3BC2 A;  4UWO B;  4PVT A;  4JO0 A;  3G1P A;  4UAM A;  3RKK A;  5HH5 A;  5LE1 A;  5KIK A;  1KO2 A;  5EHT A;  3I0V A;  4C1D A;  5EVD A;  4KEQ A;  1WUP A;  4C1E A;  2BMI A;  2XF4 A;  1X8I A;  2BG8 A;  1KR3 A;  2BC2 A;  2Y8A A;  5ACP A;  2OHJ A;  3I13 A;  3I15 A;  5EVB A;  3BK1 A;  5A5Z A;  5K4N A;  4YSK A;  1JJT A;  4B87 A;  2DOO A;  2NZF A;  2WYM C;  2YNT A;  1E5D A;  3Q6V A;  2WHG A;  5HIO A;  5AXO A;  5EV6 A;  2AIO A;  5A0V A;  2P18 A;  1VME A;  4C09 A;  5LLD A;  2NZE A;  5K4M A;  4EXS A;  3DHA A;  4D1V A;  2FU6 A;  2CBN A;  3IEK A;  3SFP A;  2I7X A;  2Q42 A;  1JJE A;  5LS3 A;  3H3E A;  2OHI A;  3RPC A;  1DDK A;  1HLK A;  2DKF A;  2BFK A;  2QDS A;  3IE0 A;  5B3R A;  3SD9 A;  4AWZ A;  2M5D A;  2WYL A;  3PG4 A;  4O98 A;  2BFZ B;  5A87 A;  5EV8 A;  3AF5 A;  4NQ2 A;  2GFK A;  4ZO3 A;  2BGA A;  1X8G A;  2Q0I A;  4P62 A;  4TZ9 A;  3ESH A;  2YNW A;  4BP0 A;  1XTO A;  5HIQ A;  4U4L A;  3IEL A;  4GCW A;  4UWP B;  4UA4 A;  4Z67 A;  3BK2 A;  2AZ4 A;  4ZEJ A;  3L6N A;  5FQC A;  4EXY A;  1Y44 A;  2HB9 A;  4GYQ A;  3KNS A;  5B15 A;  5K4K A;  1A8T A;  2BG8 B;  2BG6 A;  1YCG A;  4PVO A;  2BG2 A;  3IE1 A;  5EWA A;  5AHO A;  3X2X A;  3MD7 A;  5LCH A;  4BZ3 A;  5ACS A;  5EH9 A;  4XUK A;  4FSB A;  1MQO A;  5LMC A;  2QJS A;  5AYA A;  4EYB A;  1P9E A;  1SML A;  4ZO2 A;  4AX0 B;  2NYP A;  4WD6 A;  2WYM A;  5LCA A;  1WW1 A;  5ACR A;  1YCF A;  2BIB A;  3LVZ A;  4RM5 A;  3X2Y A;  2FHX A;  2I7V A;  1L9Y A;  3SPU A;  3PY5 A;  4F6H A;  4AWY B;  4KEP A;  3DHC A;  3ZNB A;  3ADR A;  5HH6 A;  4YSL A;  4NQ4 A;  4D1T A;  5IQK A;  4Z5Y A;  2FK6 A;  4HL2 A;  3DHB A;  2BFL A;  3KL7 A;  5DPX A;  3FCZ A;  3X30 A;  3PY6 A;  2UYX A;  3IOF A;  4NQ6 A;  3X2Z A;  1ZTC A;  1DD6 A;  4D1U A;  4D02 A;  5HIS A;  4V0H A;  2QIN A;  3ZR9 A;  2P1E A;  3AF6 A;  2GCU A;  2QDT A;  4NQ5 A;  4TZF A;  1ZKP A;  1XM8 A;  5AXR A;  4F6Z A;  1VGN A;  1KO3 A;  4YSB A;  2YZ3 A;  5HIP A;  2NXA A;  5ACX A;  3JXP A;  4ZNB A;  3IOG A;  4C1F A;  2GKL A;  4TZE A;  5HH4 A;  2Q9U A;  5ACW A;  2ZZI A;  3WXC A;  4EY2 A;  2R2D A;  1WUO A;  3I11 A;  3ZWF A;  4UBQ A;  5LSC A;  5ACQ A;  4Z6X A;  4Z5Z A;  4EYL A;  5EVK A;  5ACU A;  3TP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...