1XTOA

Crystal structure of the coenzyme pqq synthesis protein (pqqb) from pseudomonas putida, northeast structural genomics target ppr6
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
304
structure length
304
Chain Sequence
MYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIALSDDGVHWILCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLREGCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFPLRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLLVDGTLWEDDEMQRRGVGTRTGREMGHLAQNGPGGMLEVLDGFPRQRKVLIHINNTNPILDENSPERAEVLRRGVEVAFDGMSIELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coenzyme PQQ synthesis protein B
publication title Crystal Structure of the Coenzyme PQQ Synthesis Protein (PqqB) from Pseudomonas putida, Northeast Structural Genomics Target PpR6
rcsb
source organism Pseudomonas putida
molecule tags Structural genomics, unknown function
total genus 78
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2004-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1xtoA00
4EXYA 1E5DA 4ZO3A 4GCWA 2QJSA 4TYTA 2R2DA 4ZNBA 2HB9A 5K0WA 3VPEA 5K4MA 2OHJA 4WD6A 1SMLA 5EVKA 5KIKA 4EFZA 2Y87A 2BGAA 2QEDA 3SFPA 2P4ZA 4EYLA 4PVTA 3RKKA 2I7VA 4RM5A 3Q6VA 4TZ9A 5HISA 2QINA 4NQ6A 2ZWRA 3DHCA 5ACWA 2YZ3A 4Z60A 3SRXA 3I15A 5B15A 2YNWA 5IQKA 4F6HA 4XWTA 4EY2A 2I7XA 4XUKA 4C09A 4C1HA 3DHAA 3T3NA 3P2UA 4NQ4A 2YNUA 2QDTA 2GKLA 4YSBA 5ACQA 5AEBA 5HH5A 2Q0JA 2OHIA 2AZ4A 5DPXA 2WRSA 3KNRA 4CHLA 5A5ZA 5ACRA 5HH4A 2Q0IA 2XF4A 3X2XA 2ZO4A 4D1VA 1VMEA 1K07A 3ZNBA 1YCFA 2WYMA 2P97A 3AF6A 4DIKA 1P9EA 2BC2A 1JJTA 1BMCA 1ZKPA 2BG8A 4NQ2A 1HLKA 2Y8BA 3SW3A 2BFZB 3LVZA 3I11A 3FAIA 1A8TA 4J5FA 4AWZA 3IEMA 4P62A 4O98A 2GFKA 1ZTCA 3AJ3A 4EXSA 4KEPA 2BFLA 4HL2A 3ZR9A 5LLDA 4C1CA 4B87A 2GMNA 5KILA 3ESHA 4BZ3A 5EVDA 2BG8B 4RAMA 1ZNBA 4NQ5A 5EHTA 3T3OA 3IDZA 2M5DA 1WUOA 2I7TA 5FQCA 4UBQA 3BV6A 2DOOA 1Y44A 5HIOA 3VQZA 3ZQ4A 4EYFA 4C1FA 5FQBA 2FU9A 2H6AA 3BK2A 2FU8A 1JJEA 3H3EA 3IE0A 2E7YA 3IEKA 5AXOA 2BR6A 3MD7A 5A0TA 1BVTA 1QH3A 3F9OA 2Q9UA 4Z5ZA 4J5HA 3I13A 3SBLA 3JXPA 3FCZA 5ACVA 2CBNA 3QH8A 2BFZA 2GCUA 2WHGA 1M2XA 1X8IA 3DHBA 3I0VA 4TYFA 5K4KA 3X2YA 2BFKA 4XWWA 4D1UA 2FK6A 4ZEJA 3PG4A 4UAMA 4DILA 4ZO2A 3SD9A 1XTOA 3R2UA 4TZBA 3T9MA 5AXRA 5A87A 1BC2A 4Z67A 2A7MA 5ACSA 4YSLA 1KR3A 2Q42A 4C1DA 1X8HA 3RPCA 1YCGA 2BTNA 4U4LA 3BC2A 5LSCA 5ACUA 4RBSA 4F6ZA 3IOGA 1DXKA 4FR7A 2FU6A 3L6NA 2YNTB 2UYXA 4FEKA 3DH8A 2DKFA 1MQOA 4V0HA 4RL2A 2XR1A 3BK1A 3I14A 4Z7RA 4UA4A 2WYMC 5FQAA 3AF5A 5AYAA 3KL7A 4HL1A 1VGNA 2BG2A 4BP0A 3G1PA 5LCHA 4GYUA 5K4NA 2AIOA 5A0VA 5ACTA 3SPUA 5LS3A 2ZZIA 4AD9A 4TZFA 1DD6A 2BIBA 2NZFA 1L9YA 2BG6A 2VW8A 4HKYA 4RAWA 2P18A 4Z5YA 3A4YA 5AHOA 3RKJA 3ADRA 5LM6A 2FHXB 3WXCA 4UWSB 5LCFA 2GFJA 4UWRB 3TP9A 2YNVB 5EWAA 3PY5A 4AX1B 3IE1A 1DDKA 1YCHA 4C1EA 4KEQA 1WW1A 3IELA 5EW0A 2FU7A 5LCAA 2M5CA 2QDSA 2P1EA 2YNTA 4EYBA 2FM6A 5ACXA 2OHHA 2BG7A 4H0DA 3X2ZA 5ACPA 4TZEA 3ZWFA 1X8GA 2ZNBA 5HH6A 4UWPB 4GYQA 4JO0A 4AWYB 4D1WA 4UWOB 2NZEA 5HIQA 4PVOA 3IE2A 5B3RA 2WYLA 5EH9A 5EVBA 5LMCA 5LE1A 5B1UA 5HIPA 3S0ZA 2YCBA 5AHRA 1KO2A 4RL0A 4YSKA 1KO3A 3IOFA 4Z6XA 1WRAA 1WUPA 2NYPA 5EV8A 1VJNA 1A7TA 4LE6A 5EV6A 3X30A 2NXAA 3PY6A 3KNSA 2BMIA 4D02A 2FHXA 2Y8AA 1JT1A 1XM8A 4C1GA 4FSBA 2YNVA 4AX0B 1QH5A 4D1TA
chains in the Genus database with same CATH superfamily
4EXYA 1E5DA 4ZO3A 4GCWA 2QJSA 4TYTA 2R2DA 4ZNBA 2HB9A 5K0WA 3VPEA 5K4MA 2OHJA 4WD6A 1SMLA 5EVKA 5KIKA 4EFZA 2Y87A 2BGAA 2QEDA 3SFPA 2P4ZA 4EYLA 4PVTA 3RKKA 2I7VA 4RM5A 3Q6VA 4TZ9A 5HISA 2QINA 4NQ6A 2ZWRA 3DHCA 5ACWA 2YZ3A 4Z60A 3SRXA 4AV7A 3I15A 5B15A 2YNWA 5IQKA 4F6HA 4XWTA 4EY2A 2I7XA 4XUKA 4C09A 4C1HA 3DHAA 3T3NA 3P2UA 4NQ4A 2CG3A 2YNUA 2QDTA 2GKLA 4YSBA 5ACQA 5AEBA 5HH5A 2Q0JA 2OHIA 2AZ4A 5DPXA 2WRSA 3KNRA 4CHLA 5A5ZA 5ACRA 5HH4A 2Q0IA 2XF4A 3X2XA 2ZO4A 4D1VA 1VMEA 1K07A 3ZNBA 1YCFA 2WYMA 2P97A 2CFUA 3AF6A 4DIKA 1P9EA 2BC2A 1JJTA 1BMCA 1ZKPA 2BG8A 4NQ2A 1HLKA 2Y8BA 3SW3A 2BFZB 3LVZA 3I11A 3FAIA 1A8TA 4J5FA 4AWZA 3IEMA 4P62A 4O98A 2GFKA 1ZTCA 3AJ3A 4EXSA 4KEPA 4NURA 2BFLA 4HL2A 3ZR9A 5LLDA 4C1CA 5AJLA 4B87A 2GMNA 5KILA 3ESHA 4BZ3A 5EVDA 2BG8B 4RAMA 1ZNBA 4NQ5A 5EHTA 3T3OA 3IDZA 2M5DA 1WUOA 2I7TA 5FQCA 4UBQA 3BV6A 2DOOA 1Y44A 5HIOA 3VQZA 3ZQ4A 4EYFA 4C1FA 5FQBA 2FU9A 2H6AA 3BK2A 2FU8A 1JJEA 3H3EA 3IE0A 2E7YA 3IEKA 5AXOA 2BR6A 3MD7A 5A0TA 1BVTA 1QH3A 3F9OA 2Q9UA 4Z5ZA 4J5HA 3I13A 3SBLA 3JXPA 3FCZA 5ACVA 2CBNA 3QH8A 2BFZA 2GCUA 2WHGA 1M2XA 1X8IA 3DHBA 3I0VA 4TYFA 5K4KA 3X2YA 2BFKA 4XWWA 4D1UA 2FK6A 4ZEJA 3PG4A 4UAMA 4DILA 4ZO2A 3SD9A 1XTOA 3R2UA 4TZBA 3T9MA 5AXRA 5A87A 1BC2A 4Z67A 2A7MA 5ACSA 4YSLA 1KR3A 2Q42A 4C1DA 1X8HA 3RPCA 1YCGA 2BTNA 4U4LA 3BC2A 5AIJA 5A23A 5LSCA 5ACUA 4RBSA 4F6ZA 3IOGA 1DXKA 4FR7A 2FU6A 3L6NA 2YNTB 2UYXA 4FEKA 3DH8A 2DKFA 1MQOA 4V0HA 4RL2A 2XR1A 3BK1A 3I14A 4Z7RA 4UA4A 2WYMC 5FQAA 3AF5A 5AYAA 2CFZA 3KL7A 4HL1A 1VGNA 2BG2A 4BP0A 3G1PA 5LCHA 4GYUA 5K4NA 2AIOA 5A0VA 5ACTA 3SPUA 5LS3A 2ZZIA 4AD9A 4TZFA 1DD6A 2BIBA 2NZFA 1L9YA 2BG6A 2VW8A 4HKYA 4RAWA 2P18A 4Z5YA 3A4YA 5AHOA 3RKJA 3ADRA 5LM6A 2FHXB 3WXCA 4UWSB 5LCFA 2GFJA 2CG2A 4UWRB 3TP9A 2YNVB 5EWAA 3PY5A 4AX1B 3IE1A 1DDKA 1YCHA 4C1EA 4KEQA 1WW1A 3IELA 5EW0A 2FU7A 5LCAA 2M5CA 2QDSA 2P1EA 2YNTA 4EYBA 2FM6A 5ACXA 2OHHA 2BG7A 4H0DA 3X2ZA 5ACPA 4TZEA 3ZWFA 1X8GA 2ZNBA 2YHEA 5HH6A 4UWPB 4GYQA 4JO0A 4AWYB 4D1WA 4UWOB 2NZEA 5HIQA 4PVOA 3IE2A 5B3RA 2WYLA 5EH9A 5EVBA 5LMCA 5LE1A 5B1UA 5HIPA 3S0ZA 2YCBA 5AHRA 1KO2A 4RL0A 4YSKA 1KO3A 3IOFA 4Z6XA 1WRAA 1WUPA 2NYPA 5EV8A 4PDXA 1VJNA 1A7TA 4LE6A 5EV6A 3X30A 2NXAA 3PY6A 3KNSA 2BMIA 4D02A 2FHXA 4AXHA 2Y8AA 1JT1A 1XM8A 4C1GA 4FSBA 2YNVA 4AX0B 1QH5A 4D1TA
chains in the Genus database with same CATH topology
4EXYA 1E5DA 4ZO3A 4GCWA 2QJSA 4TYTA 2R2DA 4ZNBA 2HB9A 5K0WA 3VPEA 5K4MA 2OHJA 4WD6A 1SMLA 5EVKA 5KIKA 4EFZA 2Y87A 2BGAA 2QEDA 3SFPA 2P4ZA 4EYLA 4PVTA 3RKKA 2I7VA 4RM5A 3Q6VA 4TZ9A 5HISA 2QINA 4NQ6A 2ZWRA 3DHCA 5ACWA 2YZ3A 4Z60A 3SRXA 3I15A 5B15A 2YNWA 5IQKA 4F6HA 4XWTA 4EY2A 2I7XA 4XUKA 4C09A 4C1HA 3DHAA 3T3NA 3P2UA 4NQ4A 2YNUA 2QDTA 2GKLA 4YSBA 5ACQA 5AEBA 5HH5A 2Q0JA 2OHIA 2AZ4A 5DPXA 2WRSA 3KNRA 4CHLA 5A5ZA 5ACRA 5HH4A 2Q0IA 2XF4A 3X2XA 2ZO4A 4D1VA 1VMEA 1K07A 3ZNBA 1YCFA 2WYMA 2P97A 3AF6A 4DIKA 1P9EA 2BC2A 1JJTA 1BMCA 1ZKPA 2BG8A 4NQ2A 1HLKA 2Y8BA 3SW3A 2BFZB 3LVZA 3I11A 3FAIA 1A8TA 4J5FA 4AWZA 3IEMA 4P62A 4O98A 2GFKA 1ZTCA 3AJ3A 4EXSA 4KEPA 2BFLA 4HL2A 3ZR9A 5LLDA 4C1CA 4B87A 2GMNA 5KILA 3ESHA 4BZ3A 5EVDA 2BG8B 4RAMA 1ZNBA 4NQ5A 5EHTA 3T3OA 3IDZA 2M5DA 1WUOA 2I7TA 5FQCA 4UBQA 3BV6A 2DOOA 1Y44A 5HIOA 3VQZA 3ZQ4A 4EYFA 4C1FA 5FQBA 2FU9A 2H6AA 3BK2A 2FU8A 1JJEA 3H3EA 3IE0A 2E7YA 3IEKA 5AXOA 2BR6A 3MD7A 5A0TA 1BVTA 1QH3A 3F9OA 2Q9UA 4Z5ZA 4J5HA 3I13A 3SBLA 3JXPA 3FCZA 5ACVA 2CBNA 3QH8A 2BFZA 2GCUA 2WHGA 1M2XA 1X8IA 3DHBA 3I0VA 4TYFA 5K4KA 3X2YA 2BFKA 4XWWA 4D1UA 2FK6A 4ZEJA 3PG4A 4UAMA 4DILA 4ZO2A 3SD9A 1XTOA 3R2UA 4TZBA 3T9MA 5AXRA 5A87A 1BC2A 4Z67A 2A7MA 5ACSA 4YSLA 1KR3A 2Q42A 4C1DA 1X8HA 3RPCA 1YCGA 2BTNA 4U4LA 3BC2A 5LSCA 5ACUA 4RBSA 4F6ZA 3IOGA 1DXKA 4FR7A 2FU6A 3L6NA 2YNTB 2UYXA 4FEKA 3DH8A 2DKFA 1MQOA 4V0HA 4RL2A 2XR1A 3BK1A 3I14A 4Z7RA 4UA4A 2WYMC 5FQAA 3AF5A 5AYAA 3KL7A 4HL1A 1VGNA 2BG2A 4BP0A 3G1PA 5LCHA 4GYUA 5K4NA 2AIOA 5A0VA 5ACTA 3SPUA 5LS3A 2ZZIA 4AD9A 4TZFA 1DD6A 2BIBA 2NZFA 1L9YA 2BG6A 2VW8A 4HKYA 4RAWA 2P18A 4Z5YA 3A4YA 5AHOA 3RKJA 3ADRA 5LM6A 2FHXB 3WXCA 4UWSB 5LCFA 2GFJA 4UWRB 3TP9A 2YNVB 5EWAA 3PY5A 4AX1B 3IE1A 1DDKA 1YCHA 4C1EA 4KEQA 1WW1A 3IELA 5EW0A 2FU7A 5LCAA 2M5CA 2QDSA 2P1EA 2YNTA 4EYBA 2FM6A 5ACXA 2OHHA 2BG7A 4H0DA 3X2ZA 5ACPA 4TZEA 3ZWFA 1X8GA 2ZNBA 5HH6A 4UWPB 4GYQA 4JO0A 4AWYB 4D1WA 4UWOB 2NZEA 5HIQA 4PVOA 3IE2A 5B3RA 2WYLA 5EH9A 5EVBA 5LMCA 5LE1A 5B1UA 5HIPA 3S0ZA 2YCBA 5AHRA 1KO2A 4RL0A 4YSKA 1KO3A 3IOFA 4Z6XA 1WRAA 1WUPA 2NYPA 5EV8A 1VJNA 1A7TA 4LE6A 5EV6A 3X30A 2NXAA 3PY6A 3KNSA 2BMIA 4D02A 2FHXA 2Y8AA 1JT1A 1XM8A 4C1GA 4FSBA 2YNVA 4AX0B 1QH5A 4D1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EXY A;  1E5D A;  4ZO3 A;  4GCW A;  2QJS A;  4TYT A;  2R2D A;  4ZNB A;  2HB9 A;  5K0W A;  3VPE A;  5K4M A;  2OHJ A;  4WD6 A;  1SML A;  5EVK A;  5KIK A;  4EFZ A;  2Y87 A;  2BGA A;  2QED A;  3SFP A;  2P4Z A;  4EYL A;  4PVT A;  3RKK A;  2I7V A;  4RM5 A;  3Q6V A;  4TZ9 A;  5HIS A;  2QIN A;  4NQ6 A;  2ZWR A;  3DHC A;  5ACW A;  2YZ3 A;  4Z60 A;  3SRX A;  3I15 A;  5B15 A;  2YNW A;  5IQK A;  4F6H A;  4XWT A;  4EY2 A;  2I7X A;  4XUK A;  4C09 A;  4C1H A;  3DHA A;  3T3N A;  3P2U A;  4NQ4 A;  2YNU A;  2QDT A;  2GKL A;  4YSB A;  5ACQ A;  5AEB A;  5HH5 A;  2Q0J A;  2OHI A;  2AZ4 A;  5DPX A;  2WRS A;  3KNR A;  4CHL A;  5A5Z A;  5ACR A;  5HH4 A;  2Q0I A;  2XF4 A;  3X2X A;  2ZO4 A;  4D1V A;  1VME A;  1K07 A;  3ZNB A;  1YCF A;  2WYM A;  2P97 A;  3AF6 A;  4DIK A;  1P9E A;  2BC2 A;  1JJT A;  1BMC A;  1ZKP A;  2BG8 A;  4NQ2 A;  1HLK A;  2Y8B A;  3SW3 A;  2BFZ B;  3LVZ A;  3I11 A;  3FAI A;  1A8T A;  4J5F A;  4AWZ A;  3IEM A;  4P62 A;  4O98 A;  2GFK A;  1ZTC A;  3AJ3 A;  4EXS A;  4KEP A;  2BFL A;  4HL2 A;  3ZR9 A;  5LLD A;  4C1C A;  4B87 A;  2GMN A;  5KIL A;  3ESH A;  4BZ3 A;  5EVD A;  2BG8 B;  4RAM A;  1ZNB A;  4NQ5 A;  5EHT A;  3T3O A;  3IDZ A;  2M5D A;  1WUO A;  2I7T A;  5FQC A;  4UBQ A;  3BV6 A;  2DOO A;  1Y44 A;  5HIO A;  3VQZ A;  3ZQ4 A;  4EYF A;  4C1F A;  5FQB A;  2FU9 A;  2H6A A;  3BK2 A;  2FU8 A;  1JJE A;  3H3E A;  3IE0 A;  2E7Y A;  3IEK A;  5AXO A;  2BR6 A;  3MD7 A;  5A0T A;  1BVT A;  1QH3 A;  3F9O A;  2Q9U A;  4Z5Z A;  4J5H A;  3I13 A;  3SBL A;  3JXP A;  3FCZ A;  5ACV A;  2CBN A;  3QH8 A;  2BFZ A;  2GCU A;  2WHG A;  1M2X A;  1X8I A;  3DHB A;  3I0V A;  4TYF A;  5K4K A;  3X2Y A;  2BFK A;  4XWW A;  4D1U A;  2FK6 A;  4ZEJ A;  3PG4 A;  4UAM A;  4DIL A;  4ZO2 A;  3SD9 A;  1XTO A;  3R2U A;  4TZB A;  3T9M A;  5AXR A;  5A87 A;  1BC2 A;  4Z67 A;  2A7M A;  5ACS A;  4YSL A;  1KR3 A;  2Q42 A;  4C1D A;  1X8H A;  3RPC A;  1YCG A;  2BTN A;  4U4L A;  3BC2 A;  5LSC A;  5ACU A;  4RBS A;  4F6Z A;  3IOG A;  1DXK A;  4FR7 A;  2FU6 A;  3L6N A;  2YNT B;  2UYX A;  4FEK A;  3DH8 A;  2DKF A;  1MQO A;  4V0H A;  4RL2 A;  2XR1 A;  3BK1 A;  3I14 A;  4Z7R A;  4UA4 A;  2WYM C;  5FQA A;  3AF5 A;  5AYA A;  3KL7 A;  4HL1 A;  1VGN A;  2BG2 A;  4BP0 A;  3G1P A;  5LCH A;  4GYU A;  5K4N A;  2AIO A;  5A0V A;  5ACT A;  3SPU A;  5LS3 A;  2ZZI A;  4AD9 A;  4TZF A;  1DD6 A;  2BIB A;  2NZF A;  1L9Y A;  2BG6 A;  2VW8 A;  4HKY A;  4RAW A;  2P18 A;  4Z5Y A;  3A4Y A;  5AHO A;  3RKJ A;  3ADR A;  5LM6 A;  2FHX B;  3WXC A;  4UWS B;  5LCF A;  2GFJ A;  4UWR B;  3TP9 A;  2YNV B;  5EWA A;  3PY5 A;  4AX1 B;  3IE1 A;  1DDK A;  1YCH A;  4C1E A;  4KEQ A;  1WW1 A;  3IEL A;  5EW0 A;  2FU7 A;  5LCA A;  2M5C A;  2QDS A;  2P1E A;  2YNT A;  4EYB A;  2FM6 A;  5ACX A;  2OHH A;  2BG7 A;  4H0D A;  3X2Z A;  5ACP A;  4TZE A;  3ZWF A;  1X8G A;  2ZNB A;  5HH6 A;  4UWP B;  4GYQ A;  4JO0 A;  4AWY B;  4D1W A;  4UWO B;  2NZE A;  5HIQ A;  4PVO A;  3IE2 A;  5B3R A;  2WYL A;  5EH9 A;  5EVB A;  5LMC A;  5LE1 A;  5B1U A;  5HIP A;  3S0Z A;  2YCB A;  5AHR A;  1KO2 A;  4RL0 A;  4YSK A;  1KO3 A;  3IOF A;  4Z6X A;  1WRA A;  1WUP A;  2NYP A;  5EV8 A;  1VJN A;  1A7T A;  4LE6 A;  5EV6 A;  3X30 A;  2NXA A;  3PY6 A;  3KNS A;  2BMI A;  4D02 A;  2FHX A;  2Y8A A;  1JT1 A;  1XM8 A;  4C1G A;  4FSB A;  2YNV A;  4AX0 B;  1QH5 A;  4D1T A; 
#chains in the Genus database with same CATH topology
 4EXY A;  1E5D A;  4ZO3 A;  4GCW A;  2QJS A;  4TYT A;  2R2D A;  4ZNB A;  2HB9 A;  5K0W A;  3VPE A;  5K4M A;  2OHJ A;  4WD6 A;  1SML A;  5EVK A;  5KIK A;  4EFZ A;  2Y87 A;  2BGA A;  2QED A;  3SFP A;  2P4Z A;  4EYL A;  4PVT A;  3RKK A;  2I7V A;  4RM5 A;  3Q6V A;  4TZ9 A;  5HIS A;  2QIN A;  4NQ6 A;  2ZWR A;  3DHC A;  5ACW A;  2YZ3 A;  4Z60 A;  3SRX A;  4AV7 A;  3I15 A;  5B15 A;  2YNW A;  5IQK A;  4F6H A;  4XWT A;  4EY2 A;  2I7X A;  4XUK A;  4C09 A;  4C1H A;  3DHA A;  3T3N A;  3P2U A;  4NQ4 A;  2CG3 A;  2YNU A;  2QDT A;  2GKL A;  4YSB A;  5ACQ A;  5AEB A;  5HH5 A;  2Q0J A;  2OHI A;  2AZ4 A;  5DPX A;  2WRS A;  3KNR A;  4CHL A;  5A5Z A;  5ACR A;  5HH4 A;  2Q0I A;  2XF4 A;  3X2X A;  2ZO4 A;  4D1V A;  1VME A;  1K07 A;  3ZNB A;  1YCF A;  2WYM A;  2P97 A;  2CFU A;  3AF6 A;  4DIK A;  1P9E A;  2BC2 A;  1JJT A;  1BMC A;  1ZKP A;  2BG8 A;  4NQ2 A;  1HLK A;  2Y8B A;  3SW3 A;  2BFZ B;  3LVZ A;  3I11 A;  3FAI A;  1A8T A;  4J5F A;  4AWZ A;  3IEM A;  4P62 A;  4O98 A;  2GFK A;  1ZTC A;  3AJ3 A;  4EXS A;  4KEP A;  4NUR A;  2BFL A;  4HL2 A;  3ZR9 A;  5LLD A;  4C1C A;  5AJL A;  4B87 A;  2GMN A;  5KIL A;  3ESH A;  4BZ3 A;  5EVD A;  2BG8 B;  4RAM A;  1ZNB A;  4NQ5 A;  5EHT A;  3T3O A;  3IDZ A;  2M5D A;  1WUO A;  2I7T A;  5FQC A;  4UBQ A;  3BV6 A;  2DOO A;  1Y44 A;  5HIO A;  3VQZ A;  3ZQ4 A;  4EYF A;  4C1F A;  5FQB A;  2FU9 A;  2H6A A;  3BK2 A;  2FU8 A;  1JJE A;  3H3E A;  3IE0 A;  2E7Y A;  3IEK A;  5AXO A;  2BR6 A;  3MD7 A;  5A0T A;  1BVT A;  1QH3 A;  3F9O A;  2Q9U A;  4Z5Z A;  4J5H A;  3I13 A;  3SBL A;  3JXP A;  3FCZ A;  5ACV A;  2CBN A;  3QH8 A;  2BFZ A;  2GCU A;  2WHG A;  1M2X A;  1X8I A;  3DHB A;  3I0V A;  4TYF A;  5K4K A;  3X2Y A;  2BFK A;  4XWW A;  4D1U A;  2FK6 A;  4ZEJ A;  3PG4 A;  4UAM A;  4DIL A;  4ZO2 A;  3SD9 A;  1XTO A;  3R2U A;  4TZB A;  3T9M A;  5AXR A;  5A87 A;  1BC2 A;  4Z67 A;  2A7M A;  5ACS A;  4YSL A;  1KR3 A;  2Q42 A;  4C1D A;  1X8H A;  3RPC A;  1YCG A;  2BTN A;  4U4L A;  3BC2 A;  5AIJ A;  5A23 A;  5LSC A;  5ACU A;  4RBS A;  4F6Z A;  3IOG A;  1DXK A;  4FR7 A;  2FU6 A;  3L6N A;  2YNT B;  2UYX A;  4FEK A;  3DH8 A;  2DKF A;  1MQO A;  4V0H A;  4RL2 A;  2XR1 A;  3BK1 A;  3I14 A;  4Z7R A;  4UA4 A;  2WYM C;  5FQA A;  3AF5 A;  5AYA A;  2CFZ A;  3KL7 A;  4HL1 A;  1VGN A;  2BG2 A;  4BP0 A;  3G1P A;  5LCH A;  4GYU A;  5K4N A;  2AIO A;  5A0V A;  5ACT A;  3SPU A;  5LS3 A;  2ZZI A;  4AD9 A;  4TZF A;  1DD6 A;  2BIB A;  2NZF A;  1L9Y A;  2BG6 A;  2VW8 A;  4HKY A;  4RAW A;  2P18 A;  4Z5Y A;  3A4Y A;  5AHO A;  3RKJ A;  3ADR A;  5LM6 A;  2FHX B;  3WXC A;  4UWS B;  5LCF A;  2GFJ A;  2CG2 A;  4UWR B;  3TP9 A;  2YNV B;  5EWA A;  3PY5 A;  4AX1 B;  3IE1 A;  1DDK A;  1YCH A;  4C1E A;  4KEQ A;  1WW1 A;  3IEL A;  5EW0 A;  2FU7 A;  5LCA A;  2M5C A;  2QDS A;  2P1E A;  2YNT A;  4EYB A;  2FM6 A;  5ACX A;  2OHH A;  2BG7 A;  4H0D A;  3X2Z A;  5ACP A;  4TZE A;  3ZWF A;  1X8G A;  2ZNB A;  2YHE A;  5HH6 A;  4UWP B;  4GYQ A;  4JO0 A;  4AWY B;  4D1W A;  4UWO B;  2NZE A;  5HIQ A;  4PVO A;  3IE2 A;  5B3R A;  2WYL A;  5EH9 A;  5EVB A;  5LMC A;  5LE1 A;  5B1U A;  5HIP A;  3S0Z A;  2YCB A;  5AHR A;  1KO2 A;  4RL0 A;  4YSK A;  1KO3 A;  3IOF A;  4Z6X A;  1WRA A;  1WUP A;  2NYP A;  5EV8 A;  4PDX A;  1VJN A;  1A7T A;  4LE6 A;  5EV6 A;  3X30 A;  2NXA A;  3PY6 A;  3KNS A;  2BMI A;  4D02 A;  2FHX A;  4AXH A;  2Y8A A;  1JT1 A;  1XM8 A;  4C1G A;  4FSB A;  2YNV A;  4AX0 B;  1QH5 A;  4D1T A; 
#chains in the Genus database with same CATH homology
 4EXY A;  1E5D A;  4ZO3 A;  4GCW A;  2QJS A;  4TYT A;  2R2D A;  4ZNB A;  2HB9 A;  5K0W A;  3VPE A;  5K4M A;  2OHJ A;  4WD6 A;  1SML A;  5EVK A;  5KIK A;  4EFZ A;  2Y87 A;  2BGA A;  2QED A;  3SFP A;  2P4Z A;  4EYL A;  4PVT A;  3RKK A;  2I7V A;  4RM5 A;  3Q6V A;  4TZ9 A;  5HIS A;  2QIN A;  4NQ6 A;  2ZWR A;  3DHC A;  5ACW A;  2YZ3 A;  4Z60 A;  3SRX A;  3I15 A;  5B15 A;  2YNW A;  5IQK A;  4F6H A;  4XWT A;  4EY2 A;  2I7X A;  4XUK A;  4C09 A;  4C1H A;  3DHA A;  3T3N A;  3P2U A;  4NQ4 A;  2YNU A;  2QDT A;  2GKL A;  4YSB A;  5ACQ A;  5AEB A;  5HH5 A;  2Q0J A;  2OHI A;  2AZ4 A;  5DPX A;  2WRS A;  3KNR A;  4CHL A;  5A5Z A;  5ACR A;  5HH4 A;  2Q0I A;  2XF4 A;  3X2X A;  2ZO4 A;  4D1V A;  1VME A;  1K07 A;  3ZNB A;  1YCF A;  2WYM A;  2P97 A;  3AF6 A;  4DIK A;  1P9E A;  2BC2 A;  1JJT A;  1BMC A;  1ZKP A;  2BG8 A;  4NQ2 A;  1HLK A;  2Y8B A;  3SW3 A;  2BFZ B;  3LVZ A;  3I11 A;  3FAI A;  1A8T A;  4J5F A;  4AWZ A;  3IEM A;  4P62 A;  4O98 A;  2GFK A;  1ZTC A;  3AJ3 A;  4EXS A;  4KEP A;  2BFL A;  4HL2 A;  3ZR9 A;  5LLD A;  4C1C A;  4B87 A;  2GMN A;  5KIL A;  3ESH A;  4BZ3 A;  5EVD A;  2BG8 B;  4RAM A;  1ZNB A;  4NQ5 A;  5EHT A;  3T3O A;  3IDZ A;  2M5D A;  1WUO A;  2I7T A;  5FQC A;  4UBQ A;  3BV6 A;  2DOO A;  1Y44 A;  5HIO A;  3VQZ A;  3ZQ4 A;  4EYF A;  4C1F A;  5FQB A;  2FU9 A;  2H6A A;  3BK2 A;  2FU8 A;  1JJE A;  3H3E A;  3IE0 A;  2E7Y A;  3IEK A;  5AXO A;  2BR6 A;  3MD7 A;  5A0T A;  1BVT A;  1QH3 A;  3F9O A;  2Q9U A;  4Z5Z A;  4J5H A;  3I13 A;  3SBL A;  3JXP A;  3FCZ A;  5ACV A;  2CBN A;  3QH8 A;  2BFZ A;  2GCU A;  2WHG A;  1M2X A;  1X8I A;  3DHB A;  3I0V A;  4TYF A;  5K4K A;  3X2Y A;  2BFK A;  4XWW A;  4D1U A;  2FK6 A;  4ZEJ A;  3PG4 A;  4UAM A;  4DIL A;  4ZO2 A;  3SD9 A;  1XTO A;  3R2U A;  4TZB A;  3T9M A;  5AXR A;  5A87 A;  1BC2 A;  4Z67 A;  2A7M A;  5ACS A;  4YSL A;  1KR3 A;  2Q42 A;  4C1D A;  1X8H A;  3RPC A;  1YCG A;  2BTN A;  4U4L A;  3BC2 A;  5LSC A;  5ACU A;  4RBS A;  4F6Z A;  3IOG A;  1DXK A;  4FR7 A;  2FU6 A;  3L6N A;  2YNT B;  2UYX A;  4FEK A;  3DH8 A;  2DKF A;  1MQO A;  4V0H A;  4RL2 A;  2XR1 A;  3BK1 A;  3I14 A;  4Z7R A;  4UA4 A;  2WYM C;  5FQA A;  3AF5 A;  5AYA A;  3KL7 A;  4HL1 A;  1VGN A;  2BG2 A;  4BP0 A;  3G1P A;  5LCH A;  4GYU A;  5K4N A;  2AIO A;  5A0V A;  5ACT A;  3SPU A;  5LS3 A;  2ZZI A;  4AD9 A;  4TZF A;  1DD6 A;  2BIB A;  2NZF A;  1L9Y A;  2BG6 A;  2VW8 A;  4HKY A;  4RAW A;  2P18 A;  4Z5Y A;  3A4Y A;  5AHO A;  3RKJ A;  3ADR A;  5LM6 A;  2FHX B;  3WXC A;  4UWS B;  5LCF A;  2GFJ A;  4UWR B;  3TP9 A;  2YNV B;  5EWA A;  3PY5 A;  4AX1 B;  3IE1 A;  1DDK A;  1YCH A;  4C1E A;  4KEQ A;  1WW1 A;  3IEL A;  5EW0 A;  2FU7 A;  5LCA A;  2M5C A;  2QDS A;  2P1E A;  2YNT A;  4EYB A;  2FM6 A;  5ACX A;  2OHH A;  2BG7 A;  4H0D A;  3X2Z A;  5ACP A;  4TZE A;  3ZWF A;  1X8G A;  2ZNB A;  5HH6 A;  4UWP B;  4GYQ A;  4JO0 A;  4AWY B;  4D1W A;  4UWO B;  2NZE A;  5HIQ A;  4PVO A;  3IE2 A;  5B3R A;  2WYL A;  5EH9 A;  5EVB A;  5LMC A;  5LE1 A;  5B1U A;  5HIP A;  3S0Z A;  2YCB A;  5AHR A;  1KO2 A;  4RL0 A;  4YSK A;  1KO3 A;  3IOF A;  4Z6X A;  1WRA A;  1WUP A;  2NYP A;  5EV8 A;  1VJN A;  1A7T A;  4LE6 A;  5EV6 A;  3X30 A;  2NXA A;  3PY6 A;  3KNS A;  2BMI A;  4D02 A;  2FHX A;  2Y8A A;  1JT1 A;  1XM8 A;  4C1G A;  4FSB A;  2YNV A;  4AX0 B;  1QH5 A;  4D1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...