5EV8A

Crystal structure of the metallo-beta-lactamase imp-1 in complex with the bisthiazolidine inhibitor d-cs319
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
219
structure length
219
Chain Sequence
SLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase IMP-1
publication title Cross-class metallo-beta-lactamase inhibition by bisthiazolidines reveals multiple binding modes.
pubmed doi rcsb
source organism Serratia marcescens
total genus 71
structure length 219
sequence length 219
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5ev8A00
2BR6A 5AXRA 5LE1A 5LCFA 4BP0A 1WUOA 2QINA 5AYAA 3FCZA 4YSKA 3AJ3A 2E7YA 5LM6A 1WRAA 3R2UA 3T3NA 5HIQA 1M2XA 5B1UA 5AXOA 4FEKA 1X8GA 5A87A 4C1DA 4CHLA 4Z5ZA 4U4LA 3SBLA 3I15A 3VQZA 3SPUA 4H0DA 4DIKA 2BTNA 2P18A 5EWAA 4EYFA 5HIPA 4TYTA 5LCHA 3SFPA 3PY6A 4PVTA 4B87A 2ZZIA 1BVTA 5LLDA 5AEBA 2Q0IA 2Q9UA 4C1CA 4UWRB 2R2DA 2AZ4A 2GCUA 4JO0A 3SRXA 4FR7A 1Y44A 3JXPA 3RPCA 5ACPA 2BFZA 4C1FA 4DILA 3RKJA 3RKKA 1XTOA 4XWTA 4EFZA 1DDKA 4EXYA 5ACUA 4D1TA 3LVZA 3TP9A 2QDTA 5A0TA 4UAMA 3KNSA 4D1WA 2BG6A 5HIOA 2P97A 3P2UA 2YCBA 3PY5A 4LE6A 3G1PA 5ACQA 2YNUA 2BFZB 3IE2A 3MD7A 4XWWA 4UA4A 5K4MA 4RAWA 4O98A 3KL7A 3IEMA 4ZEJA 4TZ9A 5HISA 2YNVB 4D1UA 3X30A 4ZNBA 4V0HA 2GKLA 4HKYA 1MQOA 5HH6A 4F6HA 2XF4A 2I7VA 1WUPA 4FSBA 1QH3A 5KIKA 3BV6A 2WYLA 2HB9A 4GYQA 4UWOB 4Z6XA 4HL1A 2Y8BA 3FAIA 4NQ6A 5AHRA 2BG2A 4EYLA 2GFKA 2XR1A 1JT1A 2NXAA 3IDZA 2WYMA 5K4NA 2QEDA 4Z67A 5DPXA 3BK1A 2M5DA 4Z7RA 4WD6A 3SW3A 3A4YA 2ZWRA 3WXCA 2I7TA 5LS3A 1X8HA 3ADRA 3KNRA 1VMEA 2Q42A 3ZQ4A 4YSBA 4AX1B 2DOOA 3X2YA 5FQBA 4PVOA 4C1HA 4TZFA 5EV6A 5A0VA 3ESHA 3F9OA 4Z60A 4EY2A 4TYFA 1ZNBA 1SMLA 3I11A 4UWSB 1KO2A 4NQ2A 4NQ4A 1ZTCA 4YSLA 4EXSA 1BMCA 4RL2A 3ZNBA 4J5HA 2FK6A 3AF5A 4D02A 3DHBA 1VJNA 2BG8A 2QJSA 5EVBA 2NYPA 2M5CA 2FHXA 2Y8AA 3BC2A 2OHIA 1K07A 3DH8A 5FQAA 4RAMA 5LSCA 4ZO3A 2OHHA 1X8IA 3PG4A 2YNTA 2VW8A 5EV8A 2CBNA 4AWZA 2WRSA 4Z5YA 2YNWA 3DHCA 2FU7A 3QH8A 2QDSA 2BG8B 1BC2A 1DD6A 5FQCA 2GFJA 3H3EA 5EVKA 3AF6A 3T9MA 4C09A 4AWYB 5ACXA 5EVDA 1DXKA 3I0VA 5ACSA 3IOFA 3IOGA 3I14A 4P62A 3DHAA 2BMIA 2YNTB 2BGAA 3SD9A 2FU9A 4KEPA 4D1VA 1JJTA 2H6AA 2I7XA 4C1EA 1XM8A 3IE0A 1YCHA 2DKFA 2NZFA 2P4ZA 4KEQA 1YCGA 5LMCA 1JJEA 2FM6A 4NQ5A 5HH5A 5EH9A 4RBSA 1A8TA 3T3OA 4AX0B 4BZ3A 5AHOA 2BIBA 4UBQA 1KR3A 2WYMC 5ACTA 3S0ZA 4J5FA 5B3RA 2Y87A 1VGNA 1QH5A 3IELA 2FU6A 1A7TA 2FU8A 1WW1A 4EYBA 5K4KA 4TZBA 4XUKA 2AIOA 3I13A 3ZR9A 5ACRA 5A5ZA 2GMNA 4GCWA 2NZEA 3IEKA 4AD9A 5B15A 2BFKA 2OHJA 5EHTA 3X2XA 4TZEA 5HH4A 3L6NA 2Q0JA 4ZO2A 3Q6VA 2YNVA 1YCFA 2ZO4A 4F6ZA 4GYUA 3VPEA 2BC2A 2ZNBA 1HLKA 4C1GA 1P9EA 1KO3A 2WHGA 1E5DA 2UYXA 2YZ3A 3BK2A 2FHXB 4RM5A 3ZWFA 4RL0A 5IQKA 3IE1A 1L9YA 5LCAA 5ACWA 4HL2A 5KILA 1ZKPA 2A7MA 5K0WA 2BFLA 4UWPB 3X2ZA 5EW0A 5ACVA 2P1EA 2BG7A
chains in the Genus database with same CATH superfamily
2BR6A 5AXRA 5LE1A 5LCFA 4BP0A 1WUOA 2QINA 5AYAA 3FCZA 4YSKA 3AJ3A 2E7YA 5LM6A 1WRAA 3R2UA 3T3NA 5HIQA 1M2XA 5B1UA 5AXOA 4FEKA 4PDXA 1X8GA 5A87A 4C1DA 4CHLA 4Z5ZA 4U4LA 3SBLA 3I15A 3VQZA 3SPUA 4H0DA 2CFZA 4DIKA 2BTNA 2P18A 5EWAA 4EYFA 5HIPA 4TYTA 5LCHA 3SFPA 3PY6A 4PVTA 4B87A 2ZZIA 1BVTA 5LLDA 5AEBA 2Q0IA 2Q9UA 4C1CA 4UWRB 2R2DA 2AZ4A 2GCUA 4JO0A 3SRXA 4FR7A 1Y44A 3JXPA 3RPCA 5ACPA 2BFZA 4C1FA 4DILA 3RKJA 3RKKA 1XTOA 2YHEA 4XWTA 4EFZA 1DDKA 4EXYA 5ACUA 4D1TA 3LVZA 3TP9A 2QDTA 5A0TA 4AV7A 4UAMA 3KNSA 4D1WA 2BG6A 5HIOA 2P97A 3P2UA 2YCBA 3PY5A 4LE6A 3G1PA 5ACQA 5AJLA 2YNUA 2BFZB 3IE2A 3MD7A 4XWWA 4UA4A 5K4MA 4RAWA 4O98A 3KL7A 3IEMA 4ZEJA 4TZ9A 5A23A 5HISA 2YNVB 4D1UA 3X30A 4ZNBA 4V0HA 2GKLA 4HKYA 1MQOA 5HH6A 4F6HA 2XF4A 2I7VA 1WUPA 4FSBA 1QH3A 5KIKA 3BV6A 2WYLA 2HB9A 4GYQA 4UWOB 4Z6XA 4HL1A 2Y8BA 3FAIA 4NQ6A 5AHRA 2CG3A 2BG2A 4EYLA 2GFKA 2XR1A 1JT1A 2NXAA 3IDZA 2WYMA 5K4NA 2QEDA 4Z67A 5DPXA 3BK1A 2M5DA 4Z7RA 4WD6A 3SW3A 3A4YA 2ZWRA 3WXCA 2I7TA 5LS3A 1X8HA 3ADRA 3KNRA 1VMEA 2Q42A 3ZQ4A 4YSBA 4AX1B 2DOOA 3X2YA 5FQBA 4PVOA 4C1HA 4TZFA 5EV6A 4NURA 5A0VA 3ESHA 3F9OA 4Z60A 4EY2A 4TYFA 1ZNBA 1SMLA 3I11A 4UWSB 1KO2A 4NQ2A 4NQ4A 1ZTCA 4YSLA 4EXSA 1BMCA 4RL2A 3ZNBA 4J5HA 2FK6A 3AF5A 4D02A 3DHBA 5AIJA 1VJNA 2BG8A 2QJSA 5EVBA 2NYPA 2M5CA 2FHXA 2Y8AA 3BC2A 2OHIA 1K07A 3DH8A 5FQAA 4RAMA 5LSCA 4ZO3A 2OHHA 1X8IA 3PG4A 2YNTA 2VW8A 5EV8A 2CBNA 4AWZA 2WRSA 4Z5YA 4AXHA 2YNWA 3DHCA 2FU7A 3QH8A 2QDSA 2BG8B 1BC2A 1DD6A 5FQCA 2GFJA 3H3EA 5EVKA 3AF6A 3T9MA 4C09A 4AWYB 5ACXA 5EVDA 1DXKA 3I0VA 5ACSA 3IOFA 3IOGA 3I14A 4P62A 3DHAA 2BMIA 2YNTB 2BGAA 3SD9A 2FU9A 4KEPA 4D1VA 2CFUA 1JJTA 2H6AA 2I7XA 4C1EA 1XM8A 3IE0A 1YCHA 2DKFA 2NZFA 2P4ZA 4KEQA 1YCGA 5LMCA 1JJEA 2FM6A 4NQ5A 5HH5A 2CG2A 5EH9A 4RBSA 1A8TA 3T3OA 4AX0B 4BZ3A 5AHOA 2BIBA 4UBQA 1KR3A 2WYMC 5ACTA 3S0ZA 4J5FA 5B3RA 2Y87A 1VGNA 1QH5A 3IELA 2FU6A 1A7TA 2FU8A 1WW1A 4EYBA 5K4KA 4TZBA 4XUKA 2AIOA 3I13A 3ZR9A 5ACRA 5A5ZA 2GMNA 4GCWA 2NZEA 3IEKA 4AD9A 5B15A 2BFKA 2OHJA 5EHTA 3X2XA 4TZEA 5HH4A 3L6NA 2Q0JA 4ZO2A 3Q6VA 2YNVA 1YCFA 2ZO4A 4F6ZA 4GYUA 3VPEA 2BC2A 2ZNBA 1HLKA 4C1GA 1P9EA 1KO3A 2WHGA 1E5DA 2UYXA 2YZ3A 3BK2A 2FHXB 4RM5A 3ZWFA 4RL0A 5IQKA 3IE1A 1L9YA 5LCAA 5ACWA 4HL2A 5KILA 1ZKPA 2A7MA 5K0WA 2BFLA 4UWPB 3X2ZA 5EW0A 5ACVA 2P1EA 2BG7A
chains in the Genus database with same CATH topology
2BR6A 5AXRA 5LE1A 5LCFA 4BP0A 1WUOA 2QINA 5AYAA 3FCZA 4YSKA 3AJ3A 2E7YA 5LM6A 1WRAA 3R2UA 3T3NA 5HIQA 1M2XA 5B1UA 5AXOA 4FEKA 1X8GA 5A87A 4C1DA 4CHLA 4Z5ZA 4U4LA 3SBLA 3I15A 3VQZA 3SPUA 4H0DA 4DIKA 2BTNA 2P18A 5EWAA 4EYFA 5HIPA 4TYTA 5LCHA 3SFPA 3PY6A 4PVTA 4B87A 2ZZIA 1BVTA 5LLDA 5AEBA 2Q0IA 2Q9UA 4C1CA 4UWRB 2R2DA 2AZ4A 2GCUA 4JO0A 3SRXA 4FR7A 1Y44A 3JXPA 3RPCA 5ACPA 2BFZA 4C1FA 4DILA 3RKJA 3RKKA 1XTOA 4XWTA 4EFZA 1DDKA 4EXYA 5ACUA 4D1TA 3LVZA 3TP9A 2QDTA 5A0TA 4UAMA 3KNSA 4D1WA 2BG6A 5HIOA 2P97A 3P2UA 2YCBA 3PY5A 4LE6A 3G1PA 5ACQA 2YNUA 2BFZB 3IE2A 3MD7A 4XWWA 4UA4A 5K4MA 4RAWA 4O98A 3KL7A 3IEMA 4ZEJA 4TZ9A 5HISA 2YNVB 4D1UA 3X30A 4ZNBA 4V0HA 2GKLA 4HKYA 1MQOA 5HH6A 4F6HA 2XF4A 2I7VA 1WUPA 4FSBA 1QH3A 5KIKA 3BV6A 2WYLA 2HB9A 4GYQA 4UWOB 4Z6XA 4HL1A 2Y8BA 3FAIA 4NQ6A 5AHRA 2BG2A 4EYLA 2GFKA 2XR1A 1JT1A 2NXAA 3IDZA 2WYMA 5K4NA 2QEDA 4Z67A 5DPXA 3BK1A 2M5DA 4Z7RA 4WD6A 3SW3A 3A4YA 2ZWRA 3WXCA 2I7TA 5LS3A 1X8HA 3ADRA 3KNRA 1VMEA 2Q42A 3ZQ4A 4YSBA 4AX1B 2DOOA 3X2YA 5FQBA 4PVOA 4C1HA 4TZFA 5EV6A 5A0VA 3ESHA 3F9OA 4Z60A 4EY2A 4TYFA 1ZNBA 1SMLA 3I11A 4UWSB 1KO2A 4NQ2A 4NQ4A 1ZTCA 4YSLA 4EXSA 1BMCA 4RL2A 3ZNBA 4J5HA 2FK6A 3AF5A 4D02A 3DHBA 1VJNA 2BG8A 2QJSA 5EVBA 2NYPA 2M5CA 2FHXA 2Y8AA 3BC2A 2OHIA 1K07A 3DH8A 5FQAA 4RAMA 5LSCA 4ZO3A 2OHHA 1X8IA 3PG4A 2YNTA 2VW8A 5EV8A 2CBNA 4AWZA 2WRSA 4Z5YA 2YNWA 3DHCA 2FU7A 3QH8A 2QDSA 2BG8B 1BC2A 1DD6A 5FQCA 2GFJA 3H3EA 5EVKA 3AF6A 3T9MA 4C09A 4AWYB 5ACXA 5EVDA 1DXKA 3I0VA 5ACSA 3IOFA 3IOGA 3I14A 4P62A 3DHAA 2BMIA 2YNTB 2BGAA 3SD9A 2FU9A 4KEPA 4D1VA 1JJTA 2H6AA 2I7XA 4C1EA 1XM8A 3IE0A 1YCHA 2DKFA 2NZFA 2P4ZA 4KEQA 1YCGA 5LMCA 1JJEA 2FM6A 4NQ5A 5HH5A 5EH9A 4RBSA 1A8TA 3T3OA 4AX0B 4BZ3A 5AHOA 2BIBA 4UBQA 1KR3A 2WYMC 5ACTA 3S0ZA 4J5FA 5B3RA 2Y87A 1VGNA 1QH5A 3IELA 2FU6A 1A7TA 2FU8A 1WW1A 4EYBA 5K4KA 4TZBA 4XUKA 2AIOA 3I13A 3ZR9A 5ACRA 5A5ZA 2GMNA 4GCWA 2NZEA 3IEKA 4AD9A 5B15A 2BFKA 2OHJA 5EHTA 3X2XA 4TZEA 5HH4A 3L6NA 2Q0JA 4ZO2A 3Q6VA 2YNVA 1YCFA 2ZO4A 4F6ZA 4GYUA 3VPEA 2BC2A 2ZNBA 1HLKA 4C1GA 1P9EA 1KO3A 2WHGA 1E5DA 2UYXA 2YZ3A 3BK2A 2FHXB 4RM5A 3ZWFA 4RL0A 5IQKA 3IE1A 1L9YA 5LCAA 5ACWA 4HL2A 5KILA 1ZKPA 2A7MA 5K0WA 2BFLA 4UWPB 3X2ZA 5EW0A 5ACVA 2P1EA 2BG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BR6 A;  5AXR A;  5LE1 A;  5LCF A;  4BP0 A;  1WUO A;  2QIN A;  5AYA A;  3FCZ A;  4YSK A;  3AJ3 A;  2E7Y A;  5LM6 A;  1WRA A;  3R2U A;  3T3N A;  5HIQ A;  1M2X A;  5B1U A;  5AXO A;  4FEK A;  1X8G A;  5A87 A;  4C1D A;  4CHL A;  4Z5Z A;  4U4L A;  3SBL A;  3I15 A;  3VQZ A;  3SPU A;  4H0D A;  4DIK A;  2BTN A;  2P18 A;  5EWA A;  4EYF A;  5HIP A;  4TYT A;  5LCH A;  3SFP A;  3PY6 A;  4PVT A;  4B87 A;  2ZZI A;  1BVT A;  5LLD A;  5AEB A;  2Q0I A;  2Q9U A;  4C1C A;  4UWR B;  2R2D A;  2AZ4 A;  2GCU A;  4JO0 A;  3SRX A;  4FR7 A;  1Y44 A;  3JXP A;  3RPC A;  5ACP A;  2BFZ A;  4C1F A;  4DIL A;  3RKJ A;  3RKK A;  1XTO A;  4XWT A;  4EFZ A;  1DDK A;  4EXY A;  5ACU A;  4D1T A;  3LVZ A;  3TP9 A;  2QDT A;  5A0T A;  4UAM A;  3KNS A;  4D1W A;  2BG6 A;  5HIO A;  2P97 A;  3P2U A;  2YCB A;  3PY5 A;  4LE6 A;  3G1P A;  5ACQ A;  2YNU A;  2BFZ B;  3IE2 A;  3MD7 A;  4XWW A;  4UA4 A;  5K4M A;  4RAW A;  4O98 A;  3KL7 A;  3IEM A;  4ZEJ A;  4TZ9 A;  5HIS A;  2YNV B;  4D1U A;  3X30 A;  4ZNB A;  4V0H A;  2GKL A;  4HKY A;  1MQO A;  5HH6 A;  4F6H A;  2XF4 A;  2I7V A;  1WUP A;  4FSB A;  1QH3 A;  5KIK A;  3BV6 A;  2WYL A;  2HB9 A;  4GYQ A;  4UWO B;  4Z6X A;  4HL1 A;  2Y8B A;  3FAI A;  4NQ6 A;  5AHR A;  2BG2 A;  4EYL A;  2GFK A;  2XR1 A;  1JT1 A;  2NXA A;  3IDZ A;  2WYM A;  5K4N A;  2QED A;  4Z67 A;  5DPX A;  3BK1 A;  2M5D A;  4Z7R A;  4WD6 A;  3SW3 A;  3A4Y A;  2ZWR A;  3WXC A;  2I7T A;  5LS3 A;  1X8H A;  3ADR A;  3KNR A;  1VME A;  2Q42 A;  3ZQ4 A;  4YSB A;  4AX1 B;  2DOO A;  3X2Y A;  5FQB A;  4PVO A;  4C1H A;  4TZF A;  5EV6 A;  5A0V A;  3ESH A;  3F9O A;  4Z60 A;  4EY2 A;  4TYF A;  1ZNB A;  1SML A;  3I11 A;  4UWS B;  1KO2 A;  4NQ2 A;  4NQ4 A;  1ZTC A;  4YSL A;  4EXS A;  1BMC A;  4RL2 A;  3ZNB A;  4J5H A;  2FK6 A;  3AF5 A;  4D02 A;  3DHB A;  1VJN A;  2BG8 A;  2QJS A;  5EVB A;  2NYP A;  2M5C A;  2FHX A;  2Y8A A;  3BC2 A;  2OHI A;  1K07 A;  3DH8 A;  5FQA A;  4RAM A;  5LSC A;  4ZO3 A;  2OHH A;  1X8I A;  3PG4 A;  2YNT A;  2VW8 A;  5EV8 A;  2CBN A;  4AWZ A;  2WRS A;  4Z5Y A;  2YNW A;  3DHC A;  2FU7 A;  3QH8 A;  2QDS A;  2BG8 B;  1BC2 A;  1DD6 A;  5FQC A;  2GFJ A;  3H3E A;  5EVK A;  3AF6 A;  3T9M A;  4C09 A;  4AWY B;  5ACX A;  5EVD A;  1DXK A;  3I0V A;  5ACS A;  3IOF A;  3IOG A;  3I14 A;  4P62 A;  3DHA A;  2BMI A;  2YNT B;  2BGA A;  3SD9 A;  2FU9 A;  4KEP A;  4D1V A;  1JJT A;  2H6A A;  2I7X A;  4C1E A;  1XM8 A;  3IE0 A;  1YCH A;  2DKF A;  2NZF A;  2P4Z A;  4KEQ A;  1YCG A;  5LMC A;  1JJE A;  2FM6 A;  4NQ5 A;  5HH5 A;  5EH9 A;  4RBS A;  1A8T A;  3T3O A;  4AX0 B;  4BZ3 A;  5AHO A;  2BIB A;  4UBQ A;  1KR3 A;  2WYM C;  5ACT A;  3S0Z A;  4J5F A;  5B3R A;  2Y87 A;  1VGN A;  1QH5 A;  3IEL A;  2FU6 A;  1A7T A;  2FU8 A;  1WW1 A;  4EYB A;  5K4K A;  4TZB A;  4XUK A;  2AIO A;  3I13 A;  3ZR9 A;  5ACR A;  5A5Z A;  2GMN A;  4GCW A;  2NZE A;  3IEK A;  4AD9 A;  5B15 A;  2BFK A;  2OHJ A;  5EHT A;  3X2X A;  4TZE A;  5HH4 A;  3L6N A;  2Q0J A;  4ZO2 A;  3Q6V A;  2YNV A;  1YCF A;  2ZO4 A;  4F6Z A;  4GYU A;  3VPE A;  2BC2 A;  2ZNB A;  1HLK A;  4C1G A;  1P9E A;  1KO3 A;  2WHG A;  1E5D A;  2UYX A;  2YZ3 A;  3BK2 A;  2FHX B;  4RM5 A;  3ZWF A;  4RL0 A;  5IQK A;  3IE1 A;  1L9Y A;  5LCA A;  5ACW A;  4HL2 A;  5KIL A;  1ZKP A;  2A7M A;  5K0W A;  2BFL A;  4UWP B;  3X2Z A;  5EW0 A;  5ACV A;  2P1E A;  2BG7 A; 
#chains in the Genus database with same CATH topology
 2BR6 A;  5AXR A;  5LE1 A;  5LCF A;  4BP0 A;  1WUO A;  2QIN A;  5AYA A;  3FCZ A;  4YSK A;  3AJ3 A;  2E7Y A;  5LM6 A;  1WRA A;  3R2U A;  3T3N A;  5HIQ A;  1M2X A;  5B1U A;  5AXO A;  4FEK A;  4PDX A;  1X8G A;  5A87 A;  4C1D A;  4CHL A;  4Z5Z A;  4U4L A;  3SBL A;  3I15 A;  3VQZ A;  3SPU A;  4H0D A;  2CFZ A;  4DIK A;  2BTN A;  2P18 A;  5EWA A;  4EYF A;  5HIP A;  4TYT A;  5LCH A;  3SFP A;  3PY6 A;  4PVT A;  4B87 A;  2ZZI A;  1BVT A;  5LLD A;  5AEB A;  2Q0I A;  2Q9U A;  4C1C A;  4UWR B;  2R2D A;  2AZ4 A;  2GCU A;  4JO0 A;  3SRX A;  4FR7 A;  1Y44 A;  3JXP A;  3RPC A;  5ACP A;  2BFZ A;  4C1F A;  4DIL A;  3RKJ A;  3RKK A;  1XTO A;  2YHE A;  4XWT A;  4EFZ A;  1DDK A;  4EXY A;  5ACU A;  4D1T A;  3LVZ A;  3TP9 A;  2QDT A;  5A0T A;  4AV7 A;  4UAM A;  3KNS A;  4D1W A;  2BG6 A;  5HIO A;  2P97 A;  3P2U A;  2YCB A;  3PY5 A;  4LE6 A;  3G1P A;  5ACQ A;  5AJL A;  2YNU A;  2BFZ B;  3IE2 A;  3MD7 A;  4XWW A;  4UA4 A;  5K4M A;  4RAW A;  4O98 A;  3KL7 A;  3IEM A;  4ZEJ A;  4TZ9 A;  5A23 A;  5HIS A;  2YNV B;  4D1U A;  3X30 A;  4ZNB A;  4V0H A;  2GKL A;  4HKY A;  1MQO A;  5HH6 A;  4F6H A;  2XF4 A;  2I7V A;  1WUP A;  4FSB A;  1QH3 A;  5KIK A;  3BV6 A;  2WYL A;  2HB9 A;  4GYQ A;  4UWO B;  4Z6X A;  4HL1 A;  2Y8B A;  3FAI A;  4NQ6 A;  5AHR A;  2CG3 A;  2BG2 A;  4EYL A;  2GFK A;  2XR1 A;  1JT1 A;  2NXA A;  3IDZ A;  2WYM A;  5K4N A;  2QED A;  4Z67 A;  5DPX A;  3BK1 A;  2M5D A;  4Z7R A;  4WD6 A;  3SW3 A;  3A4Y A;  2ZWR A;  3WXC A;  2I7T A;  5LS3 A;  1X8H A;  3ADR A;  3KNR A;  1VME A;  2Q42 A;  3ZQ4 A;  4YSB A;  4AX1 B;  2DOO A;  3X2Y A;  5FQB A;  4PVO A;  4C1H A;  4TZF A;  5EV6 A;  4NUR A;  5A0V A;  3ESH A;  3F9O A;  4Z60 A;  4EY2 A;  4TYF A;  1ZNB A;  1SML A;  3I11 A;  4UWS B;  1KO2 A;  4NQ2 A;  4NQ4 A;  1ZTC A;  4YSL A;  4EXS A;  1BMC A;  4RL2 A;  3ZNB A;  4J5H A;  2FK6 A;  3AF5 A;  4D02 A;  3DHB A;  5AIJ A;  1VJN A;  2BG8 A;  2QJS A;  5EVB A;  2NYP A;  2M5C A;  2FHX A;  2Y8A A;  3BC2 A;  2OHI A;  1K07 A;  3DH8 A;  5FQA A;  4RAM A;  5LSC A;  4ZO3 A;  2OHH A;  1X8I A;  3PG4 A;  2YNT A;  2VW8 A;  5EV8 A;  2CBN A;  4AWZ A;  2WRS A;  4Z5Y A;  4AXH A;  2YNW A;  3DHC A;  2FU7 A;  3QH8 A;  2QDS A;  2BG8 B;  1BC2 A;  1DD6 A;  5FQC A;  2GFJ A;  3H3E A;  5EVK A;  3AF6 A;  3T9M A;  4C09 A;  4AWY B;  5ACX A;  5EVD A;  1DXK A;  3I0V A;  5ACS A;  3IOF A;  3IOG A;  3I14 A;  4P62 A;  3DHA A;  2BMI A;  2YNT B;  2BGA A;  3SD9 A;  2FU9 A;  4KEP A;  4D1V A;  2CFU A;  1JJT A;  2H6A A;  2I7X A;  4C1E A;  1XM8 A;  3IE0 A;  1YCH A;  2DKF A;  2NZF A;  2P4Z A;  4KEQ A;  1YCG A;  5LMC A;  1JJE A;  2FM6 A;  4NQ5 A;  5HH5 A;  2CG2 A;  5EH9 A;  4RBS A;  1A8T A;  3T3O A;  4AX0 B;  4BZ3 A;  5AHO A;  2BIB A;  4UBQ A;  1KR3 A;  2WYM C;  5ACT A;  3S0Z A;  4J5F A;  5B3R A;  2Y87 A;  1VGN A;  1QH5 A;  3IEL A;  2FU6 A;  1A7T A;  2FU8 A;  1WW1 A;  4EYB A;  5K4K A;  4TZB A;  4XUK A;  2AIO A;  3I13 A;  3ZR9 A;  5ACR A;  5A5Z A;  2GMN A;  4GCW A;  2NZE A;  3IEK A;  4AD9 A;  5B15 A;  2BFK A;  2OHJ A;  5EHT A;  3X2X A;  4TZE A;  5HH4 A;  3L6N A;  2Q0J A;  4ZO2 A;  3Q6V A;  2YNV A;  1YCF A;  2ZO4 A;  4F6Z A;  4GYU A;  3VPE A;  2BC2 A;  2ZNB A;  1HLK A;  4C1G A;  1P9E A;  1KO3 A;  2WHG A;  1E5D A;  2UYX A;  2YZ3 A;  3BK2 A;  2FHX B;  4RM5 A;  3ZWF A;  4RL0 A;  5IQK A;  3IE1 A;  1L9Y A;  5LCA A;  5ACW A;  4HL2 A;  5KIL A;  1ZKP A;  2A7M A;  5K0W A;  2BFL A;  4UWP B;  3X2Z A;  5EW0 A;  5ACV A;  2P1E A;  2BG7 A; 
#chains in the Genus database with same CATH homology
 2BR6 A;  5AXR A;  5LE1 A;  5LCF A;  4BP0 A;  1WUO A;  2QIN A;  5AYA A;  3FCZ A;  4YSK A;  3AJ3 A;  2E7Y A;  5LM6 A;  1WRA A;  3R2U A;  3T3N A;  5HIQ A;  1M2X A;  5B1U A;  5AXO A;  4FEK A;  1X8G A;  5A87 A;  4C1D A;  4CHL A;  4Z5Z A;  4U4L A;  3SBL A;  3I15 A;  3VQZ A;  3SPU A;  4H0D A;  4DIK A;  2BTN A;  2P18 A;  5EWA A;  4EYF A;  5HIP A;  4TYT A;  5LCH A;  3SFP A;  3PY6 A;  4PVT A;  4B87 A;  2ZZI A;  1BVT A;  5LLD A;  5AEB A;  2Q0I A;  2Q9U A;  4C1C A;  4UWR B;  2R2D A;  2AZ4 A;  2GCU A;  4JO0 A;  3SRX A;  4FR7 A;  1Y44 A;  3JXP A;  3RPC A;  5ACP A;  2BFZ A;  4C1F A;  4DIL A;  3RKJ A;  3RKK A;  1XTO A;  4XWT A;  4EFZ A;  1DDK A;  4EXY A;  5ACU A;  4D1T A;  3LVZ A;  3TP9 A;  2QDT A;  5A0T A;  4UAM A;  3KNS A;  4D1W A;  2BG6 A;  5HIO A;  2P97 A;  3P2U A;  2YCB A;  3PY5 A;  4LE6 A;  3G1P A;  5ACQ A;  2YNU A;  2BFZ B;  3IE2 A;  3MD7 A;  4XWW A;  4UA4 A;  5K4M A;  4RAW A;  4O98 A;  3KL7 A;  3IEM A;  4ZEJ A;  4TZ9 A;  5HIS A;  2YNV B;  4D1U A;  3X30 A;  4ZNB A;  4V0H A;  2GKL A;  4HKY A;  1MQO A;  5HH6 A;  4F6H A;  2XF4 A;  2I7V A;  1WUP A;  4FSB A;  1QH3 A;  5KIK A;  3BV6 A;  2WYL A;  2HB9 A;  4GYQ A;  4UWO B;  4Z6X A;  4HL1 A;  2Y8B A;  3FAI A;  4NQ6 A;  5AHR A;  2BG2 A;  4EYL A;  2GFK A;  2XR1 A;  1JT1 A;  2NXA A;  3IDZ A;  2WYM A;  5K4N A;  2QED A;  4Z67 A;  5DPX A;  3BK1 A;  2M5D A;  4Z7R A;  4WD6 A;  3SW3 A;  3A4Y A;  2ZWR A;  3WXC A;  2I7T A;  5LS3 A;  1X8H A;  3ADR A;  3KNR A;  1VME A;  2Q42 A;  3ZQ4 A;  4YSB A;  4AX1 B;  2DOO A;  3X2Y A;  5FQB A;  4PVO A;  4C1H A;  4TZF A;  5EV6 A;  5A0V A;  3ESH A;  3F9O A;  4Z60 A;  4EY2 A;  4TYF A;  1ZNB A;  1SML A;  3I11 A;  4UWS B;  1KO2 A;  4NQ2 A;  4NQ4 A;  1ZTC A;  4YSL A;  4EXS A;  1BMC A;  4RL2 A;  3ZNB A;  4J5H A;  2FK6 A;  3AF5 A;  4D02 A;  3DHB A;  1VJN A;  2BG8 A;  2QJS A;  5EVB A;  2NYP A;  2M5C A;  2FHX A;  2Y8A A;  3BC2 A;  2OHI A;  1K07 A;  3DH8 A;  5FQA A;  4RAM A;  5LSC A;  4ZO3 A;  2OHH A;  1X8I A;  3PG4 A;  2YNT A;  2VW8 A;  5EV8 A;  2CBN A;  4AWZ A;  2WRS A;  4Z5Y A;  2YNW A;  3DHC A;  2FU7 A;  3QH8 A;  2QDS A;  2BG8 B;  1BC2 A;  1DD6 A;  5FQC A;  2GFJ A;  3H3E A;  5EVK A;  3AF6 A;  3T9M A;  4C09 A;  4AWY B;  5ACX A;  5EVD A;  1DXK A;  3I0V A;  5ACS A;  3IOF A;  3IOG A;  3I14 A;  4P62 A;  3DHA A;  2BMI A;  2YNT B;  2BGA A;  3SD9 A;  2FU9 A;  4KEP A;  4D1V A;  1JJT A;  2H6A A;  2I7X A;  4C1E A;  1XM8 A;  3IE0 A;  1YCH A;  2DKF A;  2NZF A;  2P4Z A;  4KEQ A;  1YCG A;  5LMC A;  1JJE A;  2FM6 A;  4NQ5 A;  5HH5 A;  5EH9 A;  4RBS A;  1A8T A;  3T3O A;  4AX0 B;  4BZ3 A;  5AHO A;  2BIB A;  4UBQ A;  1KR3 A;  2WYM C;  5ACT A;  3S0Z A;  4J5F A;  5B3R A;  2Y87 A;  1VGN A;  1QH5 A;  3IEL A;  2FU6 A;  1A7T A;  2FU8 A;  1WW1 A;  4EYB A;  5K4K A;  4TZB A;  4XUK A;  2AIO A;  3I13 A;  3ZR9 A;  5ACR A;  5A5Z A;  2GMN A;  4GCW A;  2NZE A;  3IEK A;  4AD9 A;  5B15 A;  2BFK A;  2OHJ A;  5EHT A;  3X2X A;  4TZE A;  5HH4 A;  3L6N A;  2Q0J A;  4ZO2 A;  3Q6V A;  2YNV A;  1YCF A;  2ZO4 A;  4F6Z A;  4GYU A;  3VPE A;  2BC2 A;  2ZNB A;  1HLK A;  4C1G A;  1P9E A;  1KO3 A;  2WHG A;  1E5D A;  2UYX A;  2YZ3 A;  3BK2 A;  2FHX B;  4RM5 A;  3ZWF A;  4RL0 A;  5IQK A;  3IE1 A;  1L9Y A;  5LCA A;  5ACW A;  4HL2 A;  5KIL A;  1ZKP A;  2A7M A;  5K0W A;  2BFL A;  4UWP B;  3X2Z A;  5EW0 A;  5ACV A;  2P1E A;  2BG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...