5EV8A

Crystal structure of the metallo-beta-lactamase imp-1 in complex with the bisthiazolidine inhibitor d-cs319
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
219
structure length
219
Chain Sequence
SLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cross-class metallo-beta-lactamase inhibition by bisthiazolidines reveals multiple binding modes.
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Hydrolase
molecule keywords Beta-lactamase IMP-1
total genus 71
structure length 219
sequence length 219
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5ev8A00
2NXAA 5ACVA 2NZEA 3KL7A 2BFZB 3ZR9A 3AF6A 3Q6VA 2M5CA 2BFLA 5LM6A 4P62A 1ZKPA 2NYPA 4UWPB 4NQ2A 1ZTCA 2YNTA 5FQAA 2FK6A 2WHGA 4Z5YA 3IELA 2P1EA 5EHTA 2QDSA 5ACSA 3R2UA 2BG8B 3RKJA 1KR3A 1M2XA 4D1TA 2BR6A 2E7YA 2UYXA 5A0TA 4XWTA 3VQZA 2A7MA 2GCUA 4NQ5A 5LCFA 4U4LA 1WUOA 2BIBA 4TZFA 5B3RA 2FU9A 2WYMC 5DPXA 2FU6A 3DH8A 4H0DA 4RM5A 2YCBA 3BK2A 2AZ4A 2BTNA 2XF4A 3FAIA 4B87A 4AX0B 1XM8A 2AIOA 2BG8A 1KO3A 4ZNBA 2WRSA 4V0HA 2BFKA 2CBNA 3ADRA 4BZ3A 4NQ4A 3IOGA 3DHAA 5EV8A 2VW8A 2FU8A 5AXOA 4C1FA 1A7TA 3AJ3A 4D02A 4UWOB 5KILA 4BP0A 5LLDA 2FU7A 3X2YA 2BMIA 1QH5A 1HLKA 4Z7RA 2I7VA 4JO0A 1VMEA 4Z67A 2P97A 1VJNA 4C1GA 4FEKA 4HKYA 2ZWRA 3BK1A 1XTOA 1BC2A 5IQKA 3SBLA 4EY2A 4XWWA 3IOFA 4EYFA 5ACXA 2FHXA 1YCGA 1E5DA 5K4MA 2YNTB 3F9OA 4D1UA 2OHHA 4TYTA 1YCHA 2BFZA 1DDKA 3IE2A 4NQ6A 4KEQA 5LCAA 3X2XA 5AYAA 3SFPA 4UWSB 4CHLA 2BGAA 4F6ZA 2Y87A 2XR1A 5K0WA 5HIOA 4RAMA 5AHRA 2YNVB 5EVKA 1BMCA 3MD7A 4UA4A 4AWYB 3I14A 4Z5ZA 2P18A 3SRXA 2ZO4A 5HIPA 5A0VA 1X8HA 4AX1B 4TZBA 4XUKA 3ZQ4A 4RAWA 4C1HA 3T3OA 5EH9A 5HH5A 1WUPA 3IE0A 3KNRA 4RL0A 5B15A 5ACPA 4GYQA 3IE1A 2QJSA 3QH8A 4HL1A 4C1CA 4YSLA 3X2ZA 3PY5A 1P9EA 3RKKA 4FR7A 4C09A 1L9YA 4TYFA 3P2UA 4PVTA 2QEDA 4UBQA 3IEKA 3I13A 3DHCA 1KO2A 2ZZIA 2OHJA 2YNWA 4Z6XA 2Y8BA 3A4YA 5EV6A 4PVOA 2NZFA 4C1EA 2QINA 1DXKA 4HL2A 4F6HA 5LS3A 5ACTA 2Q0IA 3TP9A 2GFKA 4GCWA 4EXSA 2DKFA 2FM6A 4YSKA 5KIKA 5HH6A 2YZ3A 3T3NA 1WW1A 5FQBA 3FCZA 3DHBA 5ACWA 4EFZA 5EWAA 5AEBA 1JJEA 1BVTA 5LMCA 1VGNA 1QH3A 5K4KA 5EVDA 5ACUA 3PG4A 1A8TA 2Q42A 4Z60A 1DD6A 3BC2A 4UWRB 4D1VA 5ACRA 3SW3A 2WYLA 3ZNBA 2Q9UA 2BG2A 3X30A 2P4ZA 2BC2A 5FQCA 2GKLA 3IEMA 2Q0JA 3WXCA 3H3EA 4GYUA 3L6NA 3LVZA 2R2DA 5A87A 2YNVA 4RL2A 2WYMA 5K4NA 3G1PA 1MQOA 2QDTA 1SMLA 3T9MA 2YNUA 2Y8AA 2GMNA 1X8GA 2GFJA 1X8IA 4J5FA 4AWZA 2HB9A 4ZEJA 5EW0A 3BV6A 3SPUA 2BG6A 4DILA 5AXRA 3KNSA 3RPCA 4J5HA 1YCFA 5HIQA 4EYBA 3ZWFA 3ESHA 2FHXB 1JT1A 2BG7A 4ZO2A 3I11A 4TZEA 5LE1A 1K07A 5B1UA 4FSBA 2OHIA 3IDZA 1WRAA 4RBSA 2I7TA 4YSBA 1Y44A 4O98A 4UAMA 2DOOA 2M5DA 2ZNBA 4TZ9A 5LCHA 4ZO3A 5AHOA 3SD9A 3I15A 5ACQA 4C1DA 4EXYA 4AD9A 3JXPA 5EVBA 1JJTA 3S0ZA 4WD6A 4KEPA 3PY6A 4D1WA 2I7XA 5A5ZA 5LSCA 3I0VA 5HISA 3VPEA 4LE6A 2H6AA 1ZNBA 4EYLA 4DIKA 3AF5A 5HH4A
chains in the Genus database with same CATH superfamily
2NXAA 5ACVA 2NZEA 3KL7A 2BFZB 3ZR9A 3AF6A 3Q6VA 2M5CA 2BFLA 5LM6A 4P62A 1ZKPA 2NYPA 4UWPB 4NQ2A 1ZTCA 2YNTA 5FQAA 2FK6A 2WHGA 4Z5YA 3IELA 2P1EA 5EHTA 2QDSA 5ACSA 3R2UA 2BG8B 3RKJA 1KR3A 1M2XA 2CFZA 4D1TA 2BR6A 2E7YA 2UYXA 5A0TA 4XWTA 3VQZA 2A7MA 2GCUA 4NQ5A 5LCFA 4U4LA 1WUOA 2BIBA 4TZFA 5B3RA 2FU9A 2WYMC 5DPXA 2FU6A 3DH8A 4H0DA 4RM5A 2YCBA 3BK2A 2AZ4A 2BTNA 2XF4A 3FAIA 4B87A 4AX0B 1XM8A 2AIOA 2BG8A 1KO3A 5AJLA 4ZNBA 2WRSA 4V0HA 2BFKA 2CBNA 3ADRA 2CG2A 4BZ3A 4NQ4A 3IOGA 3DHAA 5EV8A 2VW8A 2FU8A 5AXOA 4C1FA 1A7TA 2CFUA 3AJ3A 4D02A 4UWOB 5KILA 4BP0A 5LLDA 2FU7A 3X2YA 2BMIA 4NURA 1QH5A 1HLKA 4Z7RA 2I7VA 4JO0A 1VMEA 4Z67A 2P97A 1VJNA 4C1GA 4FEKA 4HKYA 2ZWRA 3BK1A 1XTOA 1BC2A 5IQKA 4AV7A 3SBLA 4EY2A 4XWWA 3IOFA 4EYFA 5ACXA 2FHXA 1YCGA 1E5DA 5K4MA 2YNTB 3F9OA 4D1UA 2OHHA 4TYTA 1YCHA 2BFZA 1DDKA 3IE2A 4NQ6A 4KEQA 5LCAA 3X2XA 5AYAA 3SFPA 4UWSB 4CHLA 2BGAA 4F6ZA 2Y87A 2XR1A 5K0WA 5HIOA 4RAMA 5AHRA 2YNVB 5EVKA 1BMCA 3MD7A 4UA4A 4AWYB 3I14A 4Z5ZA 2P18A 3SRXA 2ZO4A 5HIPA 5A0VA 1X8HA 4AX1B 4TZBA 4XUKA 3ZQ4A 4RAWA 4C1HA 3T3OA 5EH9A 5HH5A 1WUPA 3IE0A 3KNRA 4RL0A 5B15A 5ACPA 4GYQA 3IE1A 2QJSA 3QH8A 4HL1A 4C1CA 4YSLA 3X2ZA 3PY5A 1P9EA 3RKKA 4FR7A 4C09A 1L9YA 4TYFA 3P2UA 4PVTA 2QEDA 4UBQA 3IEKA 3I13A 3DHCA 1KO2A 2ZZIA 2OHJA 2YNWA 2YHEA 4Z6XA 2Y8BA 3A4YA 5EV6A 4PVOA 2NZFA 4C1EA 2QINA 1DXKA 4HL2A 4F6HA 5LS3A 5ACTA 2Q0IA 2CG3A 3TP9A 5AIJA 2GFKA 5A23A 4GCWA 4EXSA 2DKFA 2FM6A 4YSKA 5KIKA 5HH6A 2YZ3A 3T3NA 1WW1A 5FQBA 3FCZA 3DHBA 5ACWA 4EFZA 5EWAA 5AEBA 1JJEA 1BVTA 5LMCA 1VGNA 1QH3A 5K4KA 4AXHA 5EVDA 5ACUA 3PG4A 1A8TA 2Q42A 4Z60A 1DD6A 3BC2A 4UWRB 4D1VA 5ACRA 3SW3A 2WYLA 3ZNBA 2Q9UA 2BG2A 3X30A 2P4ZA 2BC2A 5FQCA 2GKLA 3IEMA 2Q0JA 3WXCA 3H3EA 4GYUA 3L6NA 3LVZA 2R2DA 5A87A 2YNVA 4RL2A 2WYMA 5K4NA 3G1PA 1MQOA 2QDTA 1SMLA 3T9MA 2YNUA 2Y8AA 2GMNA 1X8GA 2GFJA 1X8IA 4J5FA 4AWZA 2HB9A 4ZEJA 5EW0A 3BV6A 3SPUA 2BG6A 4DILA 5AXRA 3KNSA 3RPCA 4J5HA 1YCFA 5HIQA 4EYBA 3ZWFA 3ESHA 2FHXB 1JT1A 2BG7A 4PDXA 4ZO2A 3I11A 4TZEA 5LE1A 1K07A 5B1UA 4FSBA 2OHIA 3IDZA 1WRAA 4RBSA 2I7TA 4YSBA 1Y44A 4O98A 4UAMA 2DOOA 2M5DA 2ZNBA 4TZ9A 5LCHA 4ZO3A 5AHOA 3SD9A 3I15A 5ACQA 4C1DA 4EXYA 4AD9A 3JXPA 5EVBA 1JJTA 3S0ZA 4WD6A 4KEPA 3PY6A 4D1WA 2I7XA 5A5ZA 5LSCA 3I0VA 5HISA 3VPEA 4LE6A 2H6AA 1ZNBA 4EYLA 4DIKA 3AF5A 5HH4A
chains in the Genus database with same CATH topology
2NXAA 5ACVA 2NZEA 3KL7A 2BFZB 3ZR9A 3AF6A 3Q6VA 2M5CA 2BFLA 5LM6A 4P62A 1ZKPA 2NYPA 4UWPB 4NQ2A 1ZTCA 2YNTA 5FQAA 2FK6A 2WHGA 4Z5YA 3IELA 2P1EA 5EHTA 2QDSA 5ACSA 3R2UA 2BG8B 3RKJA 1KR3A 1M2XA 4D1TA 2BR6A 2E7YA 2UYXA 5A0TA 4XWTA 3VQZA 2A7MA 2GCUA 4NQ5A 5LCFA 4U4LA 1WUOA 2BIBA 4TZFA 5B3RA 2FU9A 2WYMC 5DPXA 2FU6A 3DH8A 4H0DA 4RM5A 2YCBA 3BK2A 2AZ4A 2BTNA 2XF4A 3FAIA 4B87A 4AX0B 1XM8A 2AIOA 2BG8A 1KO3A 4ZNBA 2WRSA 4V0HA 2BFKA 2CBNA 3ADRA 4BZ3A 4NQ4A 3IOGA 3DHAA 5EV8A 2VW8A 2FU8A 5AXOA 4C1FA 1A7TA 3AJ3A 4D02A 4UWOB 5KILA 4BP0A 5LLDA 2FU7A 3X2YA 2BMIA 1QH5A 1HLKA 4Z7RA 2I7VA 4JO0A 1VMEA 4Z67A 2P97A 1VJNA 4C1GA 4FEKA 4HKYA 2ZWRA 3BK1A 1XTOA 1BC2A 5IQKA 3SBLA 4EY2A 4XWWA 3IOFA 4EYFA 5ACXA 2FHXA 1YCGA 1E5DA 5K4MA 2YNTB 3F9OA 4D1UA 2OHHA 4TYTA 1YCHA 2BFZA 1DDKA 3IE2A 4NQ6A 4KEQA 5LCAA 3X2XA 5AYAA 3SFPA 4UWSB 4CHLA 2BGAA 4F6ZA 2Y87A 2XR1A 5K0WA 5HIOA 4RAMA 5AHRA 2YNVB 5EVKA 1BMCA 3MD7A 4UA4A 4AWYB 3I14A 4Z5ZA 2P18A 3SRXA 2ZO4A 5HIPA 5A0VA 1X8HA 4AX1B 4TZBA 4XUKA 3ZQ4A 4RAWA 4C1HA 3T3OA 5EH9A 5HH5A 1WUPA 3IE0A 3KNRA 4RL0A 5B15A 5ACPA 4GYQA 3IE1A 2QJSA 3QH8A 4HL1A 4C1CA 4YSLA 3X2ZA 3PY5A 1P9EA 3RKKA 4FR7A 4C09A 1L9YA 4TYFA 3P2UA 4PVTA 2QEDA 4UBQA 3IEKA 3I13A 3DHCA 1KO2A 2ZZIA 2OHJA 2YNWA 4Z6XA 2Y8BA 3A4YA 5EV6A 4PVOA 2NZFA 4C1EA 2QINA 1DXKA 4HL2A 4F6HA 5LS3A 5ACTA 2Q0IA 3TP9A 2GFKA 4GCWA 4EXSA 2DKFA 2FM6A 4YSKA 5KIKA 5HH6A 2YZ3A 3T3NA 1WW1A 5FQBA 3FCZA 3DHBA 5ACWA 4EFZA 5EWAA 5AEBA 1JJEA 1BVTA 5LMCA 1VGNA 1QH3A 5K4KA 5EVDA 5ACUA 3PG4A 1A8TA 2Q42A 4Z60A 1DD6A 3BC2A 4UWRB 4D1VA 5ACRA 3SW3A 2WYLA 3ZNBA 2Q9UA 2BG2A 3X30A 2P4ZA 2BC2A 5FQCA 2GKLA 3IEMA 2Q0JA 3WXCA 3H3EA 4GYUA 3L6NA 3LVZA 2R2DA 5A87A 2YNVA 4RL2A 2WYMA 5K4NA 3G1PA 1MQOA 2QDTA 1SMLA 3T9MA 2YNUA 2Y8AA 2GMNA 1X8GA 2GFJA 1X8IA 4J5FA 4AWZA 2HB9A 4ZEJA 5EW0A 3BV6A 3SPUA 2BG6A 4DILA 5AXRA 3KNSA 3RPCA 4J5HA 1YCFA 5HIQA 4EYBA 3ZWFA 3ESHA 2FHXB 1JT1A 2BG7A 4ZO2A 3I11A 4TZEA 5LE1A 1K07A 5B1UA 4FSBA 2OHIA 3IDZA 1WRAA 4RBSA 2I7TA 4YSBA 1Y44A 4O98A 4UAMA 2DOOA 2M5DA 2ZNBA 4TZ9A 5LCHA 4ZO3A 5AHOA 3SD9A 3I15A 5ACQA 4C1DA 4EXYA 4AD9A 3JXPA 5EVBA 1JJTA 3S0ZA 4WD6A 4KEPA 3PY6A 4D1WA 2I7XA 5A5ZA 5LSCA 3I0VA 5HISA 3VPEA 4LE6A 2H6AA 1ZNBA 4EYLA 4DIKA 3AF5A 5HH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NXA A;  5ACV A;  2NZE A;  3KL7 A;  2BFZ B;  3ZR9 A;  3AF6 A;  3Q6V A;  2M5C A;  2BFL A;  5LM6 A;  4P62 A;  1ZKP A;  2NYP A;  4UWP B;  4NQ2 A;  1ZTC A;  2YNT A;  5FQA A;  2FK6 A;  2WHG A;  4Z5Y A;  3IEL A;  2P1E A;  5EHT A;  2QDS A;  5ACS A;  3R2U A;  2BG8 B;  3RKJ A;  1KR3 A;  1M2X A;  4D1T A;  2BR6 A;  2E7Y A;  2UYX A;  5A0T A;  4XWT A;  3VQZ A;  2A7M A;  2GCU A;  4NQ5 A;  5LCF A;  4U4L A;  1WUO A;  2BIB A;  4TZF A;  5B3R A;  2FU9 A;  2WYM C;  5DPX A;  2FU6 A;  3DH8 A;  4H0D A;  4RM5 A;  2YCB A;  3BK2 A;  2AZ4 A;  2BTN A;  2XF4 A;  3FAI A;  4B87 A;  4AX0 B;  1XM8 A;  2AIO A;  2BG8 A;  1KO3 A;  4ZNB A;  2WRS A;  4V0H A;  2BFK A;  2CBN A;  3ADR A;  4BZ3 A;  4NQ4 A;  3IOG A;  3DHA A;  5EV8 A;  2VW8 A;  2FU8 A;  5AXO A;  4C1F A;  1A7T A;  3AJ3 A;  4D02 A;  4UWO B;  5KIL A;  4BP0 A;  5LLD A;  2FU7 A;  3X2Y A;  2BMI A;  1QH5 A;  1HLK A;  4Z7R A;  2I7V A;  4JO0 A;  1VME A;  4Z67 A;  2P97 A;  1VJN A;  4C1G A;  4FEK A;  4HKY A;  2ZWR A;  3BK1 A;  1XTO A;  1BC2 A;  5IQK A;  3SBL A;  4EY2 A;  4XWW A;  3IOF A;  4EYF A;  5ACX A;  2FHX A;  1YCG A;  1E5D A;  5K4M A;  2YNT B;  3F9O A;  4D1U A;  2OHH A;  4TYT A;  1YCH A;  2BFZ A;  1DDK A;  3IE2 A;  4NQ6 A;  4KEQ A;  5LCA A;  3X2X A;  5AYA A;  3SFP A;  4UWS B;  4CHL A;  2BGA A;  4F6Z A;  2Y87 A;  2XR1 A;  5K0W A;  5HIO A;  4RAM A;  5AHR A;  2YNV B;  5EVK A;  1BMC A;  3MD7 A;  4UA4 A;  4AWY B;  3I14 A;  4Z5Z A;  2P18 A;  3SRX A;  2ZO4 A;  5HIP A;  5A0V A;  1X8H A;  4AX1 B;  4TZB A;  4XUK A;  3ZQ4 A;  4RAW A;  4C1H A;  3T3O A;  5EH9 A;  5HH5 A;  1WUP A;  3IE0 A;  3KNR A;  4RL0 A;  5B15 A;  5ACP A;  4GYQ A;  3IE1 A;  2QJS A;  3QH8 A;  4HL1 A;  4C1C A;  4YSL A;  3X2Z A;  3PY5 A;  1P9E A;  3RKK A;  4FR7 A;  4C09 A;  1L9Y A;  4TYF A;  3P2U A;  4PVT A;  2QED A;  4UBQ A;  3IEK A;  3I13 A;  3DHC A;  1KO2 A;  2ZZI A;  2OHJ A;  2YNW A;  4Z6X A;  2Y8B A;  3A4Y A;  5EV6 A;  4PVO A;  2NZF A;  4C1E A;  2QIN A;  1DXK A;  4HL2 A;  4F6H A;  5LS3 A;  5ACT A;  2Q0I A;  3TP9 A;  2GFK A;  4GCW A;  4EXS A;  2DKF A;  2FM6 A;  4YSK A;  5KIK A;  5HH6 A;  2YZ3 A;  3T3N A;  1WW1 A;  5FQB A;  3FCZ A;  3DHB A;  5ACW A;  4EFZ A;  5EWA A;  5AEB A;  1JJE A;  1BVT A;  5LMC A;  1VGN A;  1QH3 A;  5K4K A;  5EVD A;  5ACU A;  3PG4 A;  1A8T A;  2Q42 A;  4Z60 A;  1DD6 A;  3BC2 A;  4UWR B;  4D1V A;  5ACR A;  3SW3 A;  2WYL A;  3ZNB A;  2Q9U A;  2BG2 A;  3X30 A;  2P4Z A;  2BC2 A;  5FQC A;  2GKL A;  3IEM A;  2Q0J A;  3WXC A;  3H3E A;  4GYU A;  3L6N A;  3LVZ A;  2R2D A;  5A87 A;  2YNV A;  4RL2 A;  2WYM A;  5K4N A;  3G1P A;  1MQO A;  2QDT A;  1SML A;  3T9M A;  2YNU A;  2Y8A A;  2GMN A;  1X8G A;  2GFJ A;  1X8I A;  4J5F A;  4AWZ A;  2HB9 A;  4ZEJ A;  5EW0 A;  3BV6 A;  3SPU A;  2BG6 A;  4DIL A;  5AXR A;  3KNS A;  3RPC A;  4J5H A;  1YCF A;  5HIQ A;  4EYB A;  3ZWF A;  3ESH A;  2FHX B;  1JT1 A;  2BG7 A;  4ZO2 A;  3I11 A;  4TZE A;  5LE1 A;  1K07 A;  5B1U A;  4FSB A;  2OHI A;  3IDZ A;  1WRA A;  4RBS A;  2I7T A;  4YSB A;  1Y44 A;  4O98 A;  4UAM A;  2DOO A;  2M5D A;  2ZNB A;  4TZ9 A;  5LCH A;  4ZO3 A;  5AHO A;  3SD9 A;  3I15 A;  5ACQ A;  4C1D A;  4EXY A;  4AD9 A;  3JXP A;  5EVB A;  1JJT A;  3S0Z A;  4WD6 A;  4KEP A;  3PY6 A;  4D1W A;  2I7X A;  5A5Z A;  5LSC A;  3I0V A;  5HIS A;  3VPE A;  4LE6 A;  2H6A A;  1ZNB A;  4EYL A;  4DIK A;  3AF5 A;  5HH4 A; 
#chains in the Genus database with same CATH topology
 2NXA A;  5ACV A;  2NZE A;  3KL7 A;  2BFZ B;  3ZR9 A;  3AF6 A;  3Q6V A;  2M5C A;  2BFL A;  5LM6 A;  4P62 A;  1ZKP A;  2NYP A;  4UWP B;  4NQ2 A;  1ZTC A;  2YNT A;  5FQA A;  2FK6 A;  2WHG A;  4Z5Y A;  3IEL A;  2P1E A;  5EHT A;  2QDS A;  5ACS A;  3R2U A;  2BG8 B;  3RKJ A;  1KR3 A;  1M2X A;  2CFZ A;  4D1T A;  2BR6 A;  2E7Y A;  2UYX A;  5A0T A;  4XWT A;  3VQZ A;  2A7M A;  2GCU A;  4NQ5 A;  5LCF A;  4U4L A;  1WUO A;  2BIB A;  4TZF A;  5B3R A;  2FU9 A;  2WYM C;  5DPX A;  2FU6 A;  3DH8 A;  4H0D A;  4RM5 A;  2YCB A;  3BK2 A;  2AZ4 A;  2BTN A;  2XF4 A;  3FAI A;  4B87 A;  4AX0 B;  1XM8 A;  2AIO A;  2BG8 A;  1KO3 A;  5AJL A;  4ZNB A;  2WRS A;  4V0H A;  2BFK A;  2CBN A;  3ADR A;  2CG2 A;  4BZ3 A;  4NQ4 A;  3IOG A;  3DHA A;  5EV8 A;  2VW8 A;  2FU8 A;  5AXO A;  4C1F A;  1A7T A;  2CFU A;  3AJ3 A;  4D02 A;  4UWO B;  5KIL A;  4BP0 A;  5LLD A;  2FU7 A;  3X2Y A;  2BMI A;  4NUR A;  1QH5 A;  1HLK A;  4Z7R A;  2I7V A;  4JO0 A;  1VME A;  4Z67 A;  2P97 A;  1VJN A;  4C1G A;  4FEK A;  4HKY A;  2ZWR A;  3BK1 A;  1XTO A;  1BC2 A;  5IQK A;  4AV7 A;  3SBL A;  4EY2 A;  4XWW A;  3IOF A;  4EYF A;  5ACX A;  2FHX A;  1YCG A;  1E5D A;  5K4M A;  2YNT B;  3F9O A;  4D1U A;  2OHH A;  4TYT A;  1YCH A;  2BFZ A;  1DDK A;  3IE2 A;  4NQ6 A;  4KEQ A;  5LCA A;  3X2X A;  5AYA A;  3SFP A;  4UWS B;  4CHL A;  2BGA A;  4F6Z A;  2Y87 A;  2XR1 A;  5K0W A;  5HIO A;  4RAM A;  5AHR A;  2YNV B;  5EVK A;  1BMC A;  3MD7 A;  4UA4 A;  4AWY B;  3I14 A;  4Z5Z A;  2P18 A;  3SRX A;  2ZO4 A;  5HIP A;  5A0V A;  1X8H A;  4AX1 B;  4TZB A;  4XUK A;  3ZQ4 A;  4RAW A;  4C1H A;  3T3O A;  5EH9 A;  5HH5 A;  1WUP A;  3IE0 A;  3KNR A;  4RL0 A;  5B15 A;  5ACP A;  4GYQ A;  3IE1 A;  2QJS A;  3QH8 A;  4HL1 A;  4C1C A;  4YSL A;  3X2Z A;  3PY5 A;  1P9E A;  3RKK A;  4FR7 A;  4C09 A;  1L9Y A;  4TYF A;  3P2U A;  4PVT A;  2QED A;  4UBQ A;  3IEK A;  3I13 A;  3DHC A;  1KO2 A;  2ZZI A;  2OHJ A;  2YNW A;  2YHE A;  4Z6X A;  2Y8B A;  3A4Y A;  5EV6 A;  4PVO A;  2NZF A;  4C1E A;  2QIN A;  1DXK A;  4HL2 A;  4F6H A;  5LS3 A;  5ACT A;  2Q0I A;  2CG3 A;  3TP9 A;  5AIJ A;  2GFK A;  5A23 A;  4GCW A;  4EXS A;  2DKF A;  2FM6 A;  4YSK A;  5KIK A;  5HH6 A;  2YZ3 A;  3T3N A;  1WW1 A;  5FQB A;  3FCZ A;  3DHB A;  5ACW A;  4EFZ A;  5EWA A;  5AEB A;  1JJE A;  1BVT A;  5LMC A;  1VGN A;  1QH3 A;  5K4K A;  4AXH A;  5EVD A;  5ACU A;  3PG4 A;  1A8T A;  2Q42 A;  4Z60 A;  1DD6 A;  3BC2 A;  4UWR B;  4D1V A;  5ACR A;  3SW3 A;  2WYL A;  3ZNB A;  2Q9U A;  2BG2 A;  3X30 A;  2P4Z A;  2BC2 A;  5FQC A;  2GKL A;  3IEM A;  2Q0J A;  3WXC A;  3H3E A;  4GYU A;  3L6N A;  3LVZ A;  2R2D A;  5A87 A;  2YNV A;  4RL2 A;  2WYM A;  5K4N A;  3G1P A;  1MQO A;  2QDT A;  1SML A;  3T9M A;  2YNU A;  2Y8A A;  2GMN A;  1X8G A;  2GFJ A;  1X8I A;  4J5F A;  4AWZ A;  2HB9 A;  4ZEJ A;  5EW0 A;  3BV6 A;  3SPU A;  2BG6 A;  4DIL A;  5AXR A;  3KNS A;  3RPC A;  4J5H A;  1YCF A;  5HIQ A;  4EYB A;  3ZWF A;  3ESH A;  2FHX B;  1JT1 A;  2BG7 A;  4PDX A;  4ZO2 A;  3I11 A;  4TZE A;  5LE1 A;  1K07 A;  5B1U A;  4FSB A;  2OHI A;  3IDZ A;  1WRA A;  4RBS A;  2I7T A;  4YSB A;  1Y44 A;  4O98 A;  4UAM A;  2DOO A;  2M5D A;  2ZNB A;  4TZ9 A;  5LCH A;  4ZO3 A;  5AHO A;  3SD9 A;  3I15 A;  5ACQ A;  4C1D A;  4EXY A;  4AD9 A;  3JXP A;  5EVB A;  1JJT A;  3S0Z A;  4WD6 A;  4KEP A;  3PY6 A;  4D1W A;  2I7X A;  5A5Z A;  5LSC A;  3I0V A;  5HIS A;  3VPE A;  4LE6 A;  2H6A A;  1ZNB A;  4EYL A;  4DIK A;  3AF5 A;  5HH4 A; 
#chains in the Genus database with same CATH homology
 2NXA A;  5ACV A;  2NZE A;  3KL7 A;  2BFZ B;  3ZR9 A;  3AF6 A;  3Q6V A;  2M5C A;  2BFL A;  5LM6 A;  4P62 A;  1ZKP A;  2NYP A;  4UWP B;  4NQ2 A;  1ZTC A;  2YNT A;  5FQA A;  2FK6 A;  2WHG A;  4Z5Y A;  3IEL A;  2P1E A;  5EHT A;  2QDS A;  5ACS A;  3R2U A;  2BG8 B;  3RKJ A;  1KR3 A;  1M2X A;  4D1T A;  2BR6 A;  2E7Y A;  2UYX A;  5A0T A;  4XWT A;  3VQZ A;  2A7M A;  2GCU A;  4NQ5 A;  5LCF A;  4U4L A;  1WUO A;  2BIB A;  4TZF A;  5B3R A;  2FU9 A;  2WYM C;  5DPX A;  2FU6 A;  3DH8 A;  4H0D A;  4RM5 A;  2YCB A;  3BK2 A;  2AZ4 A;  2BTN A;  2XF4 A;  3FAI A;  4B87 A;  4AX0 B;  1XM8 A;  2AIO A;  2BG8 A;  1KO3 A;  4ZNB A;  2WRS A;  4V0H A;  2BFK A;  2CBN A;  3ADR A;  4BZ3 A;  4NQ4 A;  3IOG A;  3DHA A;  5EV8 A;  2VW8 A;  2FU8 A;  5AXO A;  4C1F A;  1A7T A;  3AJ3 A;  4D02 A;  4UWO B;  5KIL A;  4BP0 A;  5LLD A;  2FU7 A;  3X2Y A;  2BMI A;  1QH5 A;  1HLK A;  4Z7R A;  2I7V A;  4JO0 A;  1VME A;  4Z67 A;  2P97 A;  1VJN A;  4C1G A;  4FEK A;  4HKY A;  2ZWR A;  3BK1 A;  1XTO A;  1BC2 A;  5IQK A;  3SBL A;  4EY2 A;  4XWW A;  3IOF A;  4EYF A;  5ACX A;  2FHX A;  1YCG A;  1E5D A;  5K4M A;  2YNT B;  3F9O A;  4D1U A;  2OHH A;  4TYT A;  1YCH A;  2BFZ A;  1DDK A;  3IE2 A;  4NQ6 A;  4KEQ A;  5LCA A;  3X2X A;  5AYA A;  3SFP A;  4UWS B;  4CHL A;  2BGA A;  4F6Z A;  2Y87 A;  2XR1 A;  5K0W A;  5HIO A;  4RAM A;  5AHR A;  2YNV B;  5EVK A;  1BMC A;  3MD7 A;  4UA4 A;  4AWY B;  3I14 A;  4Z5Z A;  2P18 A;  3SRX A;  2ZO4 A;  5HIP A;  5A0V A;  1X8H A;  4AX1 B;  4TZB A;  4XUK A;  3ZQ4 A;  4RAW A;  4C1H A;  3T3O A;  5EH9 A;  5HH5 A;  1WUP A;  3IE0 A;  3KNR A;  4RL0 A;  5B15 A;  5ACP A;  4GYQ A;  3IE1 A;  2QJS A;  3QH8 A;  4HL1 A;  4C1C A;  4YSL A;  3X2Z A;  3PY5 A;  1P9E A;  3RKK A;  4FR7 A;  4C09 A;  1L9Y A;  4TYF A;  3P2U A;  4PVT A;  2QED A;  4UBQ A;  3IEK A;  3I13 A;  3DHC A;  1KO2 A;  2ZZI A;  2OHJ A;  2YNW A;  4Z6X A;  2Y8B A;  3A4Y A;  5EV6 A;  4PVO A;  2NZF A;  4C1E A;  2QIN A;  1DXK A;  4HL2 A;  4F6H A;  5LS3 A;  5ACT A;  2Q0I A;  3TP9 A;  2GFK A;  4GCW A;  4EXS A;  2DKF A;  2FM6 A;  4YSK A;  5KIK A;  5HH6 A;  2YZ3 A;  3T3N A;  1WW1 A;  5FQB A;  3FCZ A;  3DHB A;  5ACW A;  4EFZ A;  5EWA A;  5AEB A;  1JJE A;  1BVT A;  5LMC A;  1VGN A;  1QH3 A;  5K4K A;  5EVD A;  5ACU A;  3PG4 A;  1A8T A;  2Q42 A;  4Z60 A;  1DD6 A;  3BC2 A;  4UWR B;  4D1V A;  5ACR A;  3SW3 A;  2WYL A;  3ZNB A;  2Q9U A;  2BG2 A;  3X30 A;  2P4Z A;  2BC2 A;  5FQC A;  2GKL A;  3IEM A;  2Q0J A;  3WXC A;  3H3E A;  4GYU A;  3L6N A;  3LVZ A;  2R2D A;  5A87 A;  2YNV A;  4RL2 A;  2WYM A;  5K4N A;  3G1P A;  1MQO A;  2QDT A;  1SML A;  3T9M A;  2YNU A;  2Y8A A;  2GMN A;  1X8G A;  2GFJ A;  1X8I A;  4J5F A;  4AWZ A;  2HB9 A;  4ZEJ A;  5EW0 A;  3BV6 A;  3SPU A;  2BG6 A;  4DIL A;  5AXR A;  3KNS A;  3RPC A;  4J5H A;  1YCF A;  5HIQ A;  4EYB A;  3ZWF A;  3ESH A;  2FHX B;  1JT1 A;  2BG7 A;  4ZO2 A;  3I11 A;  4TZE A;  5LE1 A;  1K07 A;  5B1U A;  4FSB A;  2OHI A;  3IDZ A;  1WRA A;  4RBS A;  2I7T A;  4YSB A;  1Y44 A;  4O98 A;  4UAM A;  2DOO A;  2M5D A;  2ZNB A;  4TZ9 A;  5LCH A;  4ZO3 A;  5AHO A;  3SD9 A;  3I15 A;  5ACQ A;  4C1D A;  4EXY A;  4AD9 A;  3JXP A;  5EVB A;  1JJT A;  3S0Z A;  4WD6 A;  4KEP A;  3PY6 A;  4D1W A;  2I7X A;  5A5Z A;  5LSC A;  3I0V A;  5HIS A;  3VPE A;  4LE6 A;  2H6A A;  1ZNB A;  4EYL A;  4DIK A;  3AF5 A;  5HH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...