5EV8A

Crystal structure of the metallo-beta-lactamase imp-1 in complex with the bisthiazolidine inhibitor d-cs319
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
219
structure length
219
Chain Sequence
SLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cross-class metallo-beta-lactamase inhibition by bisthiazolidines reveals multiple binding modes.
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Hydrolase
molecule keywords Beta-lactamase IMP-1
total genus 71
structure length 219
sequence length 219
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5ev8A00
3SPUA 4ZEJA 4Z6XA 5AEBA 4H0DA 1QH5A 4UWRB 3DH8A 3BC2A 1ZNBA 4RAWA 4C1HA 5K4KA 2ZO4A 3DHCA 3SBLA 1WUPA 5AHRA 4UBQA 5A5ZA 1ZTCA 4UWPB 5KILA 4FEKA 2GMNA 3FCZA 3BK1A 3R2UA 5AHOA 4GYQA 1KO3A 2FU8A 5LS3A 2WYMA 4NQ2A 5LM6A 5KIKA 4Z67A 5HH5A 4FR7A 5K4MA 4C1CA 4EXYA 4P62A 3IELA 5HH4A 2P97A 3DHAA 2CBNA 4KEPA 4D1WA 1L9YA 4D1VA 4F6ZA 2OHIA 3PY5A 4UWOB 2FU7A 3I14A 4AWYB 2R2DA 2NZEA 2YNUA 5HISA 2DKFA 4U4LA 4PVOA 3MD7A 5FQBA 4GCWA 2NYPA 2P1EA 4NQ5A 3WXCA 2WYLA 4JO0A 1QH3A 2YZ3A 4KEQA 4NQ6A 4UA4A 3X2XA 3F9OA 4F6HA 1VGNA 2H6AA 2Y87A 3T3OA 2FHXB 2QEDA 5K4NA 2YCBA 3X30A 3X2ZA 4XUKA 4EYLA 4J5HA 3IDZA 5EV8A 4V0HA 1JT1A 2WRSA 4C1GA 1BC2A 5A0VA 4C09A 2BG8B 5LCFA 3H3EA 4RL2A 5HH6A 2BG7A 2BFZA 2BR6A 5HIOA 3ZWFA 2YNTB 4TYFA 2Q0JA 3IEKA 5ACPA 1K07A 5AXOA 1WW1A 3I0VA 4D1UA 2I7XA 2QINA 4NQ4A 3I15A 3AF6A 2BIBA 4EYFA 1X8IA 3LVZA 3T3NA 2AZ4A 1KR3A 3DHBA 1JJEA 4RM5A 5EH9A 2GKLA 2XR1A 3BK2A 4FSBA 3TP9A 5EVBA 1X8GA 4BZ3A 1DDKA 4XWWA 3P2UA 2ZNBA 3IOFA 2BG6A 3JXPA 2I7VA 1YCGA 4D1TA 2QJSA 5B1UA 4J5FA 3SFPA 2A7MA 2ZWRA 5AXRA 4TZFA 3SD9A 3AJ3A 5B3RA 5ACUA 1HLKA 4TYTA 5EVKA 4Z7RA 5ACQA 4GYUA 4AX0B 4HL2A 2YNVB 2E7YA 5IQKA 2FM6A 4PVTA 1WUOA 1BVTA 3KL7A 4DIKA 3ZNBA 3QH8A 4WD6A 4RBSA 2BMIA 5A87A 2Y8AA 3IE0A 4O98A 5EW0A 4AWZA 2GCUA 5EVDA 2GFJA 2BFKA 5EWAA 5LLDA 1XM8A 2FHXA 1XTOA 4EYBA 1P9EA 3ZQ4A 2OHJA 3IE1A 2GFKA 1ZKPA 4HL1A 3IE2A 2BFLA 2QDSA 3ADRA 3I11A 3T9MA 4Z5YA 3PY6A 4C1FA 5EV6A 2BC2A 2DOOA 3ZR9A 4EFZA 3I13A 2P4ZA 2AIOA 2OHHA 2BG8A 1M2XA 3RPCA 3VQZA 5ACSA 4RAMA 4XWTA 4YSBA 3A4YA 5B15A 5LMCA 2UYXA 1BMCA 2YNTA 4AD9A 5K0WA 5A0TA 1DD6A 2FU9A 1YCFA 1A7TA 3BV6A 3ESHA 4EY2A 2FK6A 3KNRA 5ACRA 5EHTA 5LE1A 4TZEA 1X8HA 3L6NA 4UAMA 2VW8A 4ZNBA 5LCHA 5ACTA 2M5DA 3Q6VA 5LSCA 4LE6A 1MQOA 5LCAA 2BTNA 2WYMC 3KNSA 5AYAA 4YSKA 4DILA 4TZBA 3RKJA 4D02A 2QDTA 2BG2A 4TZ9A 5HIPA 4C1EA 3S0ZA 2XF4A 2BGAA 1VJNA 3RKKA 5HIQA 2Q0IA 3X2YA 2Q42A 2P18A 5DPXA 3SW3A 2NZFA 2WHGA 2NXAA 4CHLA 1DXKA 5ACWA 4Z5ZA 2M5CA 3AF5A 5FQAA 4ZO2A 1A8TA 2YNVA 4EXSA 1YCHA 4B87A 2I7TA 1JJTA 1SMLA 3PG4A 2HB9A 4YSLA 1Y44A 1E5DA 5ACVA 4C1DA 3IEMA 4UWSB 5FQCA 3VPEA 4BP0A 3IOGA 2Y8BA 4AX1B 1VMEA 2BFZB 2FU6A 4ZO3A 1KO2A 1WRAA 2YNWA 2Q9UA 3G1PA 2ZZIA 5ACXA 4RL0A 4HKYA 3FAIA 4Z60A 3SRXA
chains in the Genus database with same CATH superfamily
3SPUA 4ZEJA 4Z6XA 5AEBA 4H0DA 1QH5A 4UWRB 3DH8A 3BC2A 1ZNBA 4RAWA 4C1HA 5K4KA 2ZO4A 3DHCA 3SBLA 1WUPA 5AHRA 4UBQA 5A5ZA 1ZTCA 4UWPB 5KILA 4FEKA 2GMNA 3FCZA 3BK1A 3R2UA 5AHOA 4GYQA 1KO3A 2FU8A 2CFZA 2WYMA 4NQ2A 5LS3A 5LM6A 5KIKA 4Z67A 5HH5A 4FR7A 5K4MA 4C1CA 4EXYA 4P62A 3IELA 5HH4A 2P97A 3DHAA 2CBNA 4KEPA 4D1WA 4F6ZA 1L9YA 4D1VA 2OHIA 3PY5A 4UWOB 2FU7A 3I14A 5A23A 4AWYB 2R2DA 2NZEA 2YNUA 5HISA 2DKFA 4U4LA 4PVOA 3MD7A 5FQBA 4GCWA 2NYPA 2P1EA 4NQ5A 3WXCA 2WYLA 4JO0A 1QH3A 2YZ3A 4KEQA 4NQ6A 4UA4A 3X2XA 3F9OA 4F6HA 1VGNA 2H6AA 2Y87A 3T3OA 2FHXB 2QEDA 5K4NA 2YCBA 3X30A 3X2ZA 4XUKA 4EYLA 4J5HA 3IDZA 5EV8A 4V0HA 1JT1A 2WRSA 4C1GA 1BC2A 5A0VA 4C09A 2BG8B 5LCFA 3H3EA 4RL2A 5HH6A 2BG7A 4PDXA 2BFZA 2BR6A 5HIOA 3ZWFA 2YNTB 2CG2A 4TYFA 2Q0JA 3IEKA 5ACPA 1K07A 5AXOA 1WW1A 3I0VA 4D1UA 2I7XA 2QINA 4NQ4A 3I15A 3AF6A 2BIBA 4EYFA 1X8IA 3LVZA 3T3NA 2AZ4A 1KR3A 3DHBA 5AJLA 1JJEA 2CG3A 4RM5A 5EH9A 2GKLA 2XR1A 3BK2A 4FSBA 3TP9A 5EVBA 1X8GA 4BZ3A 1DDKA 4XWWA 3P2UA 2ZNBA 3IOFA 2BG6A 3JXPA 2I7VA 1YCGA 4D1TA 2QJSA 5B1UA 4J5FA 3SFPA 2A7MA 2ZWRA 5AXRA 4TZFA 3SD9A 3AJ3A 5B3RA 5ACUA 1HLKA 4TYTA 5EVKA 4Z7RA 5ACQA 4GYUA 4AX0B 4HL2A 2YNVB 2E7YA 5IQKA 2FM6A 4PVTA 1WUOA 1BVTA 3KL7A 4DIKA 3ZNBA 3QH8A 4NURA 4WD6A 4RBSA 2BMIA 5A87A 2Y8AA 3IE0A 4O98A 5EW0A 4AWZA 2GCUA 5EVDA 2GFJA 2BFKA 5EWAA 5LLDA 1XM8A 2FHXA 1XTOA 4EYBA 1P9EA 3ZQ4A 2OHJA 3IE1A 4AV7A 2GFKA 1ZKPA 4HL1A 3IE2A 2BFLA 2QDSA 3ADRA 3I11A 3T9MA 4Z5YA 3PY6A 4C1FA 5EV6A 2BC2A 2DOOA 3ZR9A 4EFZA 3I13A 2P4ZA 2AIOA 2OHHA 2BG8A 1M2XA 3RPCA 3VQZA 5ACSA 4RAMA 4XWTA 4YSBA 3A4YA 5B15A 5LMCA 4AXHA 2UYXA 1BMCA 2YNTA 4AD9A 5K0WA 5A0TA 1DD6A 2FU9A 1YCFA 1A7TA 3BV6A 3ESHA 4EY2A 2FK6A 3KNRA 5ACRA 5EHTA 5LE1A 4TZEA 1X8HA 3L6NA 4UAMA 2VW8A 4ZNBA 5LCHA 5ACTA 2M5DA 3Q6VA 5LSCA 4LE6A 2YHEA 1MQOA 5LCAA 2BTNA 2WYMC 3KNSA 5AYAA 4YSKA 4DILA 4TZBA 3RKJA 4D02A 2QDTA 2BG2A 4TZ9A 5HIPA 4C1EA 5AIJA 3S0ZA 2XF4A 2BGAA 1VJNA 3RKKA 5HIQA 2Q0IA 3X2YA 2CFUA 2Q42A 2P18A 5DPXA 3SW3A 2NZFA 2WHGA 2NXAA 4CHLA 1DXKA 5ACWA 4Z5ZA 2M5CA 3AF5A 5FQAA 4ZO2A 1A8TA 2YNVA 4EXSA 1YCHA 4B87A 2I7TA 1JJTA 1SMLA 3PG4A 2HB9A 4YSLA 1Y44A 1E5DA 5ACVA 4C1DA 3IEMA 4UWSB 5FQCA 3VPEA 4BP0A 3IOGA 2Y8BA 4AX1B 1VMEA 2BFZB 2FU6A 4ZO3A 1KO2A 1WRAA 2YNWA 2Q9UA 3G1PA 2ZZIA 5ACXA 4RL0A 4HKYA 3FAIA 4Z60A 3SRXA
chains in the Genus database with same CATH topology
3SPUA 4ZEJA 4Z6XA 5AEBA 4H0DA 1QH5A 4UWRB 3DH8A 3BC2A 1ZNBA 4RAWA 4C1HA 5K4KA 2ZO4A 3DHCA 3SBLA 1WUPA 5AHRA 4UBQA 5A5ZA 1ZTCA 4UWPB 5KILA 4FEKA 2GMNA 3FCZA 3BK1A 3R2UA 5AHOA 4GYQA 1KO3A 2FU8A 5LS3A 2WYMA 4NQ2A 5LM6A 5KIKA 4Z67A 5HH5A 4FR7A 5K4MA 4C1CA 4EXYA 4P62A 3IELA 5HH4A 2P97A 3DHAA 2CBNA 4KEPA 4D1WA 1L9YA 4D1VA 4F6ZA 2OHIA 3PY5A 4UWOB 2FU7A 3I14A 4AWYB 2R2DA 2NZEA 2YNUA 5HISA 2DKFA 4U4LA 4PVOA 3MD7A 5FQBA 4GCWA 2NYPA 2P1EA 4NQ5A 3WXCA 2WYLA 4JO0A 1QH3A 2YZ3A 4KEQA 4NQ6A 4UA4A 3X2XA 3F9OA 4F6HA 1VGNA 2H6AA 2Y87A 3T3OA 2FHXB 2QEDA 5K4NA 2YCBA 3X30A 3X2ZA 4XUKA 4EYLA 4J5HA 3IDZA 5EV8A 4V0HA 1JT1A 2WRSA 4C1GA 1BC2A 5A0VA 4C09A 2BG8B 5LCFA 3H3EA 4RL2A 5HH6A 2BG7A 2BFZA 2BR6A 5HIOA 3ZWFA 2YNTB 4TYFA 2Q0JA 3IEKA 5ACPA 1K07A 5AXOA 1WW1A 3I0VA 4D1UA 2I7XA 2QINA 4NQ4A 3I15A 3AF6A 2BIBA 4EYFA 1X8IA 3LVZA 3T3NA 2AZ4A 1KR3A 3DHBA 1JJEA 4RM5A 5EH9A 2GKLA 2XR1A 3BK2A 4FSBA 3TP9A 5EVBA 1X8GA 4BZ3A 1DDKA 4XWWA 3P2UA 2ZNBA 3IOFA 2BG6A 3JXPA 2I7VA 1YCGA 4D1TA 2QJSA 5B1UA 4J5FA 3SFPA 2A7MA 2ZWRA 5AXRA 4TZFA 3SD9A 3AJ3A 5B3RA 5ACUA 1HLKA 4TYTA 5EVKA 4Z7RA 5ACQA 4GYUA 4AX0B 4HL2A 2YNVB 2E7YA 5IQKA 2FM6A 4PVTA 1WUOA 1BVTA 3KL7A 4DIKA 3ZNBA 3QH8A 4WD6A 4RBSA 2BMIA 5A87A 2Y8AA 3IE0A 4O98A 5EW0A 4AWZA 2GCUA 5EVDA 2GFJA 2BFKA 5EWAA 5LLDA 1XM8A 2FHXA 1XTOA 4EYBA 1P9EA 3ZQ4A 2OHJA 3IE1A 2GFKA 1ZKPA 4HL1A 3IE2A 2BFLA 2QDSA 3ADRA 3I11A 3T9MA 4Z5YA 3PY6A 4C1FA 5EV6A 2BC2A 2DOOA 3ZR9A 4EFZA 3I13A 2P4ZA 2AIOA 2OHHA 2BG8A 1M2XA 3RPCA 3VQZA 5ACSA 4RAMA 4XWTA 4YSBA 3A4YA 5B15A 5LMCA 2UYXA 1BMCA 2YNTA 4AD9A 5K0WA 5A0TA 1DD6A 2FU9A 1YCFA 1A7TA 3BV6A 3ESHA 4EY2A 2FK6A 3KNRA 5ACRA 5EHTA 5LE1A 4TZEA 1X8HA 3L6NA 4UAMA 2VW8A 4ZNBA 5LCHA 5ACTA 2M5DA 3Q6VA 5LSCA 4LE6A 1MQOA 5LCAA 2BTNA 2WYMC 3KNSA 5AYAA 4YSKA 4DILA 4TZBA 3RKJA 4D02A 2QDTA 2BG2A 4TZ9A 5HIPA 4C1EA 3S0ZA 2XF4A 2BGAA 1VJNA 3RKKA 5HIQA 2Q0IA 3X2YA 2Q42A 2P18A 5DPXA 3SW3A 2NZFA 2WHGA 2NXAA 4CHLA 1DXKA 5ACWA 4Z5ZA 2M5CA 3AF5A 5FQAA 4ZO2A 1A8TA 2YNVA 4EXSA 1YCHA 4B87A 2I7TA 1JJTA 1SMLA 3PG4A 2HB9A 4YSLA 1Y44A 1E5DA 5ACVA 4C1DA 3IEMA 4UWSB 5FQCA 3VPEA 4BP0A 3IOGA 2Y8BA 4AX1B 1VMEA 2BFZB 2FU6A 4ZO3A 1KO2A 1WRAA 2YNWA 2Q9UA 3G1PA 2ZZIA 5ACXA 4RL0A 4HKYA 3FAIA 4Z60A 3SRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SPU A;  4ZEJ A;  4Z6X A;  5AEB A;  4H0D A;  1QH5 A;  4UWR B;  3DH8 A;  3BC2 A;  1ZNB A;  4RAW A;  4C1H A;  5K4K A;  2ZO4 A;  3DHC A;  3SBL A;  1WUP A;  5AHR A;  4UBQ A;  5A5Z A;  1ZTC A;  4UWP B;  5KIL A;  4FEK A;  2GMN A;  3FCZ A;  3BK1 A;  3R2U A;  5AHO A;  4GYQ A;  1KO3 A;  2FU8 A;  5LS3 A;  2WYM A;  4NQ2 A;  5LM6 A;  5KIK A;  4Z67 A;  5HH5 A;  4FR7 A;  5K4M A;  4C1C A;  4EXY A;  4P62 A;  3IEL A;  5HH4 A;  2P97 A;  3DHA A;  2CBN A;  4KEP A;  4D1W A;  1L9Y A;  4D1V A;  4F6Z A;  2OHI A;  3PY5 A;  4UWO B;  2FU7 A;  3I14 A;  4AWY B;  2R2D A;  2NZE A;  2YNU A;  5HIS A;  2DKF A;  4U4L A;  4PVO A;  3MD7 A;  5FQB A;  4GCW A;  2NYP A;  2P1E A;  4NQ5 A;  3WXC A;  2WYL A;  4JO0 A;  1QH3 A;  2YZ3 A;  4KEQ A;  4NQ6 A;  4UA4 A;  3X2X A;  3F9O A;  4F6H A;  1VGN A;  2H6A A;  2Y87 A;  3T3O A;  2FHX B;  2QED A;  5K4N A;  2YCB A;  3X30 A;  3X2Z A;  4XUK A;  4EYL A;  4J5H A;  3IDZ A;  5EV8 A;  4V0H A;  1JT1 A;  2WRS A;  4C1G A;  1BC2 A;  5A0V A;  4C09 A;  2BG8 B;  5LCF A;  3H3E A;  4RL2 A;  5HH6 A;  2BG7 A;  2BFZ A;  2BR6 A;  5HIO A;  3ZWF A;  2YNT B;  4TYF A;  2Q0J A;  3IEK A;  5ACP A;  1K07 A;  5AXO A;  1WW1 A;  3I0V A;  4D1U A;  2I7X A;  2QIN A;  4NQ4 A;  3I15 A;  3AF6 A;  2BIB A;  4EYF A;  1X8I A;  3LVZ A;  3T3N A;  2AZ4 A;  1KR3 A;  3DHB A;  1JJE A;  4RM5 A;  5EH9 A;  2GKL A;  2XR1 A;  3BK2 A;  4FSB A;  3TP9 A;  5EVB A;  1X8G A;  4BZ3 A;  1DDK A;  4XWW A;  3P2U A;  2ZNB A;  3IOF A;  2BG6 A;  3JXP A;  2I7V A;  1YCG A;  4D1T A;  2QJS A;  5B1U A;  4J5F A;  3SFP A;  2A7M A;  2ZWR A;  5AXR A;  4TZF A;  3SD9 A;  3AJ3 A;  5B3R A;  5ACU A;  1HLK A;  4TYT A;  5EVK A;  4Z7R A;  5ACQ A;  4GYU A;  4AX0 B;  4HL2 A;  2YNV B;  2E7Y A;  5IQK A;  2FM6 A;  4PVT A;  1WUO A;  1BVT A;  3KL7 A;  4DIK A;  3ZNB A;  3QH8 A;  4WD6 A;  4RBS A;  2BMI A;  5A87 A;  2Y8A A;  3IE0 A;  4O98 A;  5EW0 A;  4AWZ A;  2GCU A;  5EVD A;  2GFJ A;  2BFK A;  5EWA A;  5LLD A;  1XM8 A;  2FHX A;  1XTO A;  4EYB A;  1P9E A;  3ZQ4 A;  2OHJ A;  3IE1 A;  2GFK A;  1ZKP A;  4HL1 A;  3IE2 A;  2BFL A;  2QDS A;  3ADR A;  3I11 A;  3T9M A;  4Z5Y A;  3PY6 A;  4C1F A;  5EV6 A;  2BC2 A;  2DOO A;  3ZR9 A;  4EFZ A;  3I13 A;  2P4Z A;  2AIO A;  2OHH A;  2BG8 A;  1M2X A;  3RPC A;  3VQZ A;  5ACS A;  4RAM A;  4XWT A;  4YSB A;  3A4Y A;  5B15 A;  5LMC A;  2UYX A;  1BMC A;  2YNT A;  4AD9 A;  5K0W A;  5A0T A;  1DD6 A;  2FU9 A;  1YCF A;  1A7T A;  3BV6 A;  3ESH A;  4EY2 A;  2FK6 A;  3KNR A;  5ACR A;  5EHT A;  5LE1 A;  4TZE A;  1X8H A;  3L6N A;  4UAM A;  2VW8 A;  4ZNB A;  5LCH A;  5ACT A;  2M5D A;  3Q6V A;  5LSC A;  4LE6 A;  1MQO A;  5LCA A;  2BTN A;  2WYM C;  3KNS A;  5AYA A;  4YSK A;  4DIL A;  4TZB A;  3RKJ A;  4D02 A;  2QDT A;  2BG2 A;  4TZ9 A;  5HIP A;  4C1E A;  3S0Z A;  2XF4 A;  2BGA A;  1VJN A;  3RKK A;  5HIQ A;  2Q0I A;  3X2Y A;  2Q42 A;  2P18 A;  5DPX A;  3SW3 A;  2NZF A;  2WHG A;  2NXA A;  4CHL A;  1DXK A;  5ACW A;  4Z5Z A;  2M5C A;  3AF5 A;  5FQA A;  4ZO2 A;  1A8T A;  2YNV A;  4EXS A;  1YCH A;  4B87 A;  2I7T A;  1JJT A;  1SML A;  3PG4 A;  2HB9 A;  4YSL A;  1Y44 A;  1E5D A;  5ACV A;  4C1D A;  3IEM A;  4UWS B;  5FQC A;  3VPE A;  4BP0 A;  3IOG A;  2Y8B A;  4AX1 B;  1VME A;  2BFZ B;  2FU6 A;  4ZO3 A;  1KO2 A;  1WRA A;  2YNW A;  2Q9U A;  3G1P A;  2ZZI A;  5ACX A;  4RL0 A;  4HKY A;  3FAI A;  4Z60 A;  3SRX A; 
#chains in the Genus database with same CATH topology
 3SPU A;  4ZEJ A;  4Z6X A;  5AEB A;  4H0D A;  1QH5 A;  4UWR B;  3DH8 A;  3BC2 A;  1ZNB A;  4RAW A;  4C1H A;  5K4K A;  2ZO4 A;  3DHC A;  3SBL A;  1WUP A;  5AHR A;  4UBQ A;  5A5Z A;  1ZTC A;  4UWP B;  5KIL A;  4FEK A;  2GMN A;  3FCZ A;  3BK1 A;  3R2U A;  5AHO A;  4GYQ A;  1KO3 A;  2FU8 A;  2CFZ A;  2WYM A;  4NQ2 A;  5LS3 A;  5LM6 A;  5KIK A;  4Z67 A;  5HH5 A;  4FR7 A;  5K4M A;  4C1C A;  4EXY A;  4P62 A;  3IEL A;  5HH4 A;  2P97 A;  3DHA A;  2CBN A;  4KEP A;  4D1W A;  4F6Z A;  1L9Y A;  4D1V A;  2OHI A;  3PY5 A;  4UWO B;  2FU7 A;  3I14 A;  5A23 A;  4AWY B;  2R2D A;  2NZE A;  2YNU A;  5HIS A;  2DKF A;  4U4L A;  4PVO A;  3MD7 A;  5FQB A;  4GCW A;  2NYP A;  2P1E A;  4NQ5 A;  3WXC A;  2WYL A;  4JO0 A;  1QH3 A;  2YZ3 A;  4KEQ A;  4NQ6 A;  4UA4 A;  3X2X A;  3F9O A;  4F6H A;  1VGN A;  2H6A A;  2Y87 A;  3T3O A;  2FHX B;  2QED A;  5K4N A;  2YCB A;  3X30 A;  3X2Z A;  4XUK A;  4EYL A;  4J5H A;  3IDZ A;  5EV8 A;  4V0H A;  1JT1 A;  2WRS A;  4C1G A;  1BC2 A;  5A0V A;  4C09 A;  2BG8 B;  5LCF A;  3H3E A;  4RL2 A;  5HH6 A;  2BG7 A;  4PDX A;  2BFZ A;  2BR6 A;  5HIO A;  3ZWF A;  2YNT B;  2CG2 A;  4TYF A;  2Q0J A;  3IEK A;  5ACP A;  1K07 A;  5AXO A;  1WW1 A;  3I0V A;  4D1U A;  2I7X A;  2QIN A;  4NQ4 A;  3I15 A;  3AF6 A;  2BIB A;  4EYF A;  1X8I A;  3LVZ A;  3T3N A;  2AZ4 A;  1KR3 A;  3DHB A;  5AJL A;  1JJE A;  2CG3 A;  4RM5 A;  5EH9 A;  2GKL A;  2XR1 A;  3BK2 A;  4FSB A;  3TP9 A;  5EVB A;  1X8G A;  4BZ3 A;  1DDK A;  4XWW A;  3P2U A;  2ZNB A;  3IOF A;  2BG6 A;  3JXP A;  2I7V A;  1YCG A;  4D1T A;  2QJS A;  5B1U A;  4J5F A;  3SFP A;  2A7M A;  2ZWR A;  5AXR A;  4TZF A;  3SD9 A;  3AJ3 A;  5B3R A;  5ACU A;  1HLK A;  4TYT A;  5EVK A;  4Z7R A;  5ACQ A;  4GYU A;  4AX0 B;  4HL2 A;  2YNV B;  2E7Y A;  5IQK A;  2FM6 A;  4PVT A;  1WUO A;  1BVT A;  3KL7 A;  4DIK A;  3ZNB A;  3QH8 A;  4NUR A;  4WD6 A;  4RBS A;  2BMI A;  5A87 A;  2Y8A A;  3IE0 A;  4O98 A;  5EW0 A;  4AWZ A;  2GCU A;  5EVD A;  2GFJ A;  2BFK A;  5EWA A;  5LLD A;  1XM8 A;  2FHX A;  1XTO A;  4EYB A;  1P9E A;  3ZQ4 A;  2OHJ A;  3IE1 A;  4AV7 A;  2GFK A;  1ZKP A;  4HL1 A;  3IE2 A;  2BFL A;  2QDS A;  3ADR A;  3I11 A;  3T9M A;  4Z5Y A;  3PY6 A;  4C1F A;  5EV6 A;  2BC2 A;  2DOO A;  3ZR9 A;  4EFZ A;  3I13 A;  2P4Z A;  2AIO A;  2OHH A;  2BG8 A;  1M2X A;  3RPC A;  3VQZ A;  5ACS A;  4RAM A;  4XWT A;  4YSB A;  3A4Y A;  5B15 A;  5LMC A;  4AXH A;  2UYX A;  1BMC A;  2YNT A;  4AD9 A;  5K0W A;  5A0T A;  1DD6 A;  2FU9 A;  1YCF A;  1A7T A;  3BV6 A;  3ESH A;  4EY2 A;  2FK6 A;  3KNR A;  5ACR A;  5EHT A;  5LE1 A;  4TZE A;  1X8H A;  3L6N A;  4UAM A;  2VW8 A;  4ZNB A;  5LCH A;  5ACT A;  2M5D A;  3Q6V A;  5LSC A;  4LE6 A;  2YHE A;  1MQO A;  5LCA A;  2BTN A;  2WYM C;  3KNS A;  5AYA A;  4YSK A;  4DIL A;  4TZB A;  3RKJ A;  4D02 A;  2QDT A;  2BG2 A;  4TZ9 A;  5HIP A;  4C1E A;  5AIJ A;  3S0Z A;  2XF4 A;  2BGA A;  1VJN A;  3RKK A;  5HIQ A;  2Q0I A;  3X2Y A;  2CFU A;  2Q42 A;  2P18 A;  5DPX A;  3SW3 A;  2NZF A;  2WHG A;  2NXA A;  4CHL A;  1DXK A;  5ACW A;  4Z5Z A;  2M5C A;  3AF5 A;  5FQA A;  4ZO2 A;  1A8T A;  2YNV A;  4EXS A;  1YCH A;  4B87 A;  2I7T A;  1JJT A;  1SML A;  3PG4 A;  2HB9 A;  4YSL A;  1Y44 A;  1E5D A;  5ACV A;  4C1D A;  3IEM A;  4UWS B;  5FQC A;  3VPE A;  4BP0 A;  3IOG A;  2Y8B A;  4AX1 B;  1VME A;  2BFZ B;  2FU6 A;  4ZO3 A;  1KO2 A;  1WRA A;  2YNW A;  2Q9U A;  3G1P A;  2ZZI A;  5ACX A;  4RL0 A;  4HKY A;  3FAI A;  4Z60 A;  3SRX A; 
#chains in the Genus database with same CATH homology
 3SPU A;  4ZEJ A;  4Z6X A;  5AEB A;  4H0D A;  1QH5 A;  4UWR B;  3DH8 A;  3BC2 A;  1ZNB A;  4RAW A;  4C1H A;  5K4K A;  2ZO4 A;  3DHC A;  3SBL A;  1WUP A;  5AHR A;  4UBQ A;  5A5Z A;  1ZTC A;  4UWP B;  5KIL A;  4FEK A;  2GMN A;  3FCZ A;  3BK1 A;  3R2U A;  5AHO A;  4GYQ A;  1KO3 A;  2FU8 A;  5LS3 A;  2WYM A;  4NQ2 A;  5LM6 A;  5KIK A;  4Z67 A;  5HH5 A;  4FR7 A;  5K4M A;  4C1C A;  4EXY A;  4P62 A;  3IEL A;  5HH4 A;  2P97 A;  3DHA A;  2CBN A;  4KEP A;  4D1W A;  1L9Y A;  4D1V A;  4F6Z A;  2OHI A;  3PY5 A;  4UWO B;  2FU7 A;  3I14 A;  4AWY B;  2R2D A;  2NZE A;  2YNU A;  5HIS A;  2DKF A;  4U4L A;  4PVO A;  3MD7 A;  5FQB A;  4GCW A;  2NYP A;  2P1E A;  4NQ5 A;  3WXC A;  2WYL A;  4JO0 A;  1QH3 A;  2YZ3 A;  4KEQ A;  4NQ6 A;  4UA4 A;  3X2X A;  3F9O A;  4F6H A;  1VGN A;  2H6A A;  2Y87 A;  3T3O A;  2FHX B;  2QED A;  5K4N A;  2YCB A;  3X30 A;  3X2Z A;  4XUK A;  4EYL A;  4J5H A;  3IDZ A;  5EV8 A;  4V0H A;  1JT1 A;  2WRS A;  4C1G A;  1BC2 A;  5A0V A;  4C09 A;  2BG8 B;  5LCF A;  3H3E A;  4RL2 A;  5HH6 A;  2BG7 A;  2BFZ A;  2BR6 A;  5HIO A;  3ZWF A;  2YNT B;  4TYF A;  2Q0J A;  3IEK A;  5ACP A;  1K07 A;  5AXO A;  1WW1 A;  3I0V A;  4D1U A;  2I7X A;  2QIN A;  4NQ4 A;  3I15 A;  3AF6 A;  2BIB A;  4EYF A;  1X8I A;  3LVZ A;  3T3N A;  2AZ4 A;  1KR3 A;  3DHB A;  1JJE A;  4RM5 A;  5EH9 A;  2GKL A;  2XR1 A;  3BK2 A;  4FSB A;  3TP9 A;  5EVB A;  1X8G A;  4BZ3 A;  1DDK A;  4XWW A;  3P2U A;  2ZNB A;  3IOF A;  2BG6 A;  3JXP A;  2I7V A;  1YCG A;  4D1T A;  2QJS A;  5B1U A;  4J5F A;  3SFP A;  2A7M A;  2ZWR A;  5AXR A;  4TZF A;  3SD9 A;  3AJ3 A;  5B3R A;  5ACU A;  1HLK A;  4TYT A;  5EVK A;  4Z7R A;  5ACQ A;  4GYU A;  4AX0 B;  4HL2 A;  2YNV B;  2E7Y A;  5IQK A;  2FM6 A;  4PVT A;  1WUO A;  1BVT A;  3KL7 A;  4DIK A;  3ZNB A;  3QH8 A;  4WD6 A;  4RBS A;  2BMI A;  5A87 A;  2Y8A A;  3IE0 A;  4O98 A;  5EW0 A;  4AWZ A;  2GCU A;  5EVD A;  2GFJ A;  2BFK A;  5EWA A;  5LLD A;  1XM8 A;  2FHX A;  1XTO A;  4EYB A;  1P9E A;  3ZQ4 A;  2OHJ A;  3IE1 A;  2GFK A;  1ZKP A;  4HL1 A;  3IE2 A;  2BFL A;  2QDS A;  3ADR A;  3I11 A;  3T9M A;  4Z5Y A;  3PY6 A;  4C1F A;  5EV6 A;  2BC2 A;  2DOO A;  3ZR9 A;  4EFZ A;  3I13 A;  2P4Z A;  2AIO A;  2OHH A;  2BG8 A;  1M2X A;  3RPC A;  3VQZ A;  5ACS A;  4RAM A;  4XWT A;  4YSB A;  3A4Y A;  5B15 A;  5LMC A;  2UYX A;  1BMC A;  2YNT A;  4AD9 A;  5K0W A;  5A0T A;  1DD6 A;  2FU9 A;  1YCF A;  1A7T A;  3BV6 A;  3ESH A;  4EY2 A;  2FK6 A;  3KNR A;  5ACR A;  5EHT A;  5LE1 A;  4TZE A;  1X8H A;  3L6N A;  4UAM A;  2VW8 A;  4ZNB A;  5LCH A;  5ACT A;  2M5D A;  3Q6V A;  5LSC A;  4LE6 A;  1MQO A;  5LCA A;  2BTN A;  2WYM C;  3KNS A;  5AYA A;  4YSK A;  4DIL A;  4TZB A;  3RKJ A;  4D02 A;  2QDT A;  2BG2 A;  4TZ9 A;  5HIP A;  4C1E A;  3S0Z A;  2XF4 A;  2BGA A;  1VJN A;  3RKK A;  5HIQ A;  2Q0I A;  3X2Y A;  2Q42 A;  2P18 A;  5DPX A;  3SW3 A;  2NZF A;  2WHG A;  2NXA A;  4CHL A;  1DXK A;  5ACW A;  4Z5Z A;  2M5C A;  3AF5 A;  5FQA A;  4ZO2 A;  1A8T A;  2YNV A;  4EXS A;  1YCH A;  4B87 A;  2I7T A;  1JJT A;  1SML A;  3PG4 A;  2HB9 A;  4YSL A;  1Y44 A;  1E5D A;  5ACV A;  4C1D A;  3IEM A;  4UWS B;  5FQC A;  3VPE A;  4BP0 A;  3IOG A;  2Y8B A;  4AX1 B;  1VME A;  2BFZ B;  2FU6 A;  4ZO3 A;  1KO2 A;  1WRA A;  2YNW A;  2Q9U A;  3G1P A;  2ZZI A;  5ACX A;  4RL0 A;  4HKY A;  3FAI A;  4Z60 A;  3SRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...