5EV8A

Crystal structure of the metallo-beta-lactamase imp-1 in complex with the bisthiazolidine inhibitor d-cs319
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
219
structure length
219
Chain Sequence
SLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase IMP-1
publication title Cross-class metallo-beta-lactamase inhibition by bisthiazolidines reveals multiple binding modes.
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Hydrolase
total genus 71
structure length 219
sequence length 219
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5ev8A00
3T9MA 4KEPA 1BVTA 2I7VA 2YNTB 4RL0A 4DIKA 2WRSA 2QDSA 5LS3A 1MQOA 4NQ6A 3KNSA 4V0HA 1YCHA 3I0VA 4KEQA 3IELA 4TZEA 5EHTA 5FQAA 2FU7A 4ZO2A 5AYAA 3AF6A 2BFKA 2BFLA 4PVTA 2FK6A 3ZR9A 1XTOA 4UWSB 4C1DA 2QEDA 2BG8A 2YNVB 3SD9A 3VPEA 5ACTA 5AEBA 1BMCA 5EV6A 1YCFA 4GCWA 3IOFA 1Y44A 2I7XA 2AZ4A 2XF4A 4AD9A 3R2UA 5FQBA 5A0TA 3IOGA 4ZO3A 1E5DA 3IEKA 3IE0A 3ZWFA 4DILA 2P18A 3KL7A 2ZNBA 4UWPB 3I13A 4D1WA 5IQKA 1JT1A 2GCUA 4UAMA 2OHJA 3F9OA 2ZO4A 4TYFA 2E7YA 2GFKA 1ZKPA 4LE6A 3DHBA 2YNWA 3TP9A 2NYPA 4XUKA 4C1GA 3BV6A 2BMIA 2YZ3A 5EW0A 2FU9A 5KILA 5EVKA 5LCFA 3T3OA 3FAIA 5HH5A 4D1TA 5LLDA 2WYMC 1WUOA 2Y87A 2BFZB 3PG4A 4NQ2A 2M5CA 4GYQA 5ACQA 3I15A 5A0VA 2CBNA 1ZNBA 5ACUA 2QINA 1YCGA 2BTNA 4NQ5A 2NXAA 2WYLA 4CHLA 1X8HA 3S0ZA 4HL2A 4GYUA 3ZNBA 4ZNBA 4Z5YA 2FU8A 4RAWA 3PY6A 5KIKA 5ACVA 3IE2A 4HKYA 2WYMA 4P62A 5K4NA 3RPCA 4C1EA 4AWYB 3BC2A 5DPXA 4C1FA 4EXSA 2GMNA 4PVOA 5HH4A 5HH6A 2R2DA 5EH9A 2Q9UA 2BGAA 5B1UA 1QH3A 4D1UA 4EY2A 4BP0A 3AJ3A 2ZWRA 3ADRA 5AHOA 3G1PA 3JXPA 3BK1A 4XWTA 4FR7A 1M2XA 2BG2A 3H3EA 4EXYA 3SFPA 3X2XA 2FHXA 5ACRA 2BC2A 5AHRA 4UWOB 4JO0A 5ACXA 2BIBA 2ZZIA 5LCAA 4H0DA 3AF5A 1DXKA 5ACPA 4EYFA 4BZ3A 5AXRA 2OHIA 1VMEA 2BR6A 3L6NA 2P1EA 4RM5A 4C09A 4C1CA 2A7MA 5EVDA 4TYTA 1A7TA 3X2YA 4EFZA 3T3NA 2YCBA 4AWZA 1JJEA 4Z67A 1KO3A 1ZTCA 5FQCA 2BG8B 4FEKA 2YNTA 5HIOA 5LE1A 3Q6VA 5EV8A 1DDKA 1X8IA 5A87A 5EVBA 1WW1A 5EWAA 2WHGA 1K07A 1VJNA 5B15A 2OHHA 2FU6A 1WRAA 3X30A 3DH8A 3RKKA 2XR1A 2FM6A 4WD6A 2YNVA 4D1VA 4UWRB 1JJTA 3WXCA 3X2ZA 5K4KA 4XWWA 3SRXA 3DHAA 2Q0IA 2DOOA 1A8TA 1X8GA 3I11A 4RAMA 2Q0JA 4TZ9A 2HB9A 2NZEA 4RL2A 1P9EA 2VW8A 3SPUA 4U4LA 4YSBA 3ESHA 5LSCA 4TZBA 4Z6XA 4EYBA 3MD7A 3RKJA 5AXOA 3ZQ4A 2NZFA 2AIOA 4O98A 3KNRA 4J5FA 3A4YA 4YSLA 4EYLA 3SW3A 2BFZA 4J5HA 5ACWA 4YSKA 4Z5ZA 2DKFA 3VQZA 4NQ4A 3IDZA 3I14A 2I7TA 4AX0B 3P2UA 2H6AA 1VGNA 4D02A 2Y8BA 4B87A 5LM6A 1KR3A 2P97A 1QH5A 3IE1A 2Q42A 2QJSA 2BG7A 3BK2A 5ACSA 5LCHA 3PY5A 3IEMA 4HL1A 3DHCA 4ZEJA 2BG6A 4TZFA 3SBLA 2M5DA 4FSBA 4C1HA 2Y8AA 3LVZA 5A5ZA 2FHXB 5K4MA 2P4ZA 4Z60A 5K0WA 4UA4A 2QDTA 4UBQA 1SMLA 4F6HA 1WUPA 5HIPA 2UYXA 4RBSA 5HISA 4Z7RA 2YNUA 1XM8A 1DD6A 1BC2A 1HLKA 5LMCA 1L9YA 2GKLA 3FCZA 5HIQA 4AX1B 2GFJA 4F6ZA 1KO2A 3QH8A 5B3RA
chains in the Genus database with same CATH superfamily
3T9MA 4KEPA 1BVTA 2I7VA 2YNTB 4RL0A 4DIKA 2WRSA 2QDSA 5LS3A 1MQOA 4NQ6A 3KNSA 4V0HA 1YCHA 3I0VA 4KEQA 3IELA 4TZEA 5EHTA 5FQAA 2FU7A 4ZO2A 5AYAA 3AF6A 2BFKA 2BFLA 4PVTA 2FK6A 3ZR9A 1XTOA 4UWSB 4C1DA 2QEDA 2BG8A 2YNVB 3SD9A 3VPEA 5ACTA 5AEBA 1BMCA 5EV6A 1YCFA 4GCWA 3IOFA 1Y44A 2I7XA 2AZ4A 2XF4A 4AD9A 3R2UA 5FQBA 5A0TA 3IOGA 4ZO3A 1E5DA 3IEKA 3IE0A 3ZWFA 4DILA 2P18A 3KL7A 2ZNBA 4UWPB 3I13A 4D1WA 5IQKA 1JT1A 2GCUA 4UAMA 2OHJA 3F9OA 2ZO4A 4TYFA 2E7YA 2GFKA 1ZKPA 4LE6A 3DHBA 2YNWA 3TP9A 2NYPA 4C1GA 4XUKA 3BV6A 2BMIA 2YZ3A 5EW0A 2FU9A 5KILA 5EVKA 5LCFA 3T3OA 3FAIA 5HH5A 4D1TA 4NURA 5LLDA 2WYMC 1WUOA 2Y87A 2BFZB 3PG4A 4NQ2A 2M5CA 4GYQA 5ACQA 3I15A 5A0VA 2CBNA 1ZNBA 5ACUA 2QINA 1YCGA 2BTNA 2CFUA 4NQ5A 2NXAA 2WYLA 4CHLA 1X8HA 3S0ZA 4HL2A 4GYUA 3ZNBA 4ZNBA 4Z5YA 2FU8A 4RAWA 4AV7A 3PY6A 2CG2A 5KIKA 5ACVA 3IE2A 4HKYA 2WYMA 4P62A 5K4NA 3RPCA 4C1EA 4AWYB 3BC2A 5DPXA 4C1FA 4EXSA 2GMNA 4PVOA 5HH4A 5HH6A 2R2DA 5EH9A 2Q9UA 2BGAA 5B1UA 1QH3A 4D1UA 4EY2A 4BP0A 3AJ3A 2ZWRA 3ADRA 5AHOA 3G1PA 3JXPA 3BK1A 5A23A 4XWTA 4FR7A 1M2XA 2BG2A 3H3EA 4EXYA 3SFPA 3X2XA 2FHXA 5ACRA 2BC2A 5AHRA 4UWOB 4JO0A 5ACXA 2BIBA 2ZZIA 5LCAA 4H0DA 3AF5A 1DXKA 5ACPA 4EYFA 4BZ3A 5AXRA 2OHIA 1VMEA 2BR6A 3L6NA 4PDXA 2P1EA 4RM5A 4C09A 4C1CA 2A7MA 5EVDA 4TYTA 1A7TA 3X2YA 4EFZA 3T3NA 2YCBA 4AWZA 1JJEA 4Z67A 1KO3A 1ZTCA 5FQCA 2BG8B 4FEKA 2YNTA 5HIOA 5LE1A 3Q6VA 5EV8A 1DDKA 1X8IA 5A87A 5EVBA 1WW1A 5EWAA 2WHGA 1K07A 1VJNA 5B15A 2OHHA 2FU6A 1WRAA 3X30A 3DH8A 3RKKA 2XR1A 2FM6A 4WD6A 2YNVA 4D1VA 4UWRB 1JJTA 3WXCA 2CG3A 3X2ZA 5K4KA 4XWWA 3SRXA 3DHAA 2Q0IA 2DOOA 1A8TA 1X8GA 3I11A 4RAMA 2CFZA 2Q0JA 4TZ9A 2HB9A 2NZEA 4RL2A 1P9EA 2VW8A 3SPUA 4U4LA 4YSBA 3ESHA 5LSCA 4TZBA 4Z6XA 4EYBA 3MD7A 3RKJA 5AXOA 3ZQ4A 2NZFA 2AIOA 2YHEA 4O98A 3KNRA 4J5FA 3A4YA 4YSLA 4EYLA 3SW3A 2BFZA 4J5HA 5AJLA 5ACWA 4YSKA 4Z5ZA 2DKFA 3VQZA 4NQ4A 3IDZA 3I14A 2I7TA 4AX0B 3P2UA 2H6AA 1VGNA 4D02A 2Y8BA 4B87A 5LM6A 1KR3A 2P97A 1QH5A 3IE1A 2Q42A 2QJSA 2BG7A 3BK2A 5ACSA 5LCHA 3PY5A 5AIJA 3IEMA 4AXHA 4HL1A 3DHCA 4ZEJA 2BG6A 4TZFA 3SBLA 2M5DA 4FSBA 4C1HA 2Y8AA 3LVZA 5A5ZA 2FHXB 5K4MA 2P4ZA 4Z60A 5K0WA 4UA4A 2QDTA 4UBQA 1SMLA 4F6HA 1WUPA 5HIPA 2UYXA 4RBSA 5HISA 4Z7RA 2YNUA 1XM8A 1DD6A 1BC2A 1HLKA 5LMCA 1L9YA 2GKLA 3FCZA 5HIQA 4AX1B 2GFJA 4F6ZA 1KO2A 3QH8A 5B3RA
chains in the Genus database with same CATH topology
3T9MA 4KEPA 1BVTA 2I7VA 2YNTB 4RL0A 4DIKA 2WRSA 2QDSA 5LS3A 1MQOA 4NQ6A 3KNSA 4V0HA 1YCHA 3I0VA 4KEQA 3IELA 4TZEA 5EHTA 5FQAA 2FU7A 4ZO2A 5AYAA 3AF6A 2BFKA 2BFLA 4PVTA 2FK6A 3ZR9A 1XTOA 4UWSB 4C1DA 2QEDA 2BG8A 2YNVB 3SD9A 3VPEA 5ACTA 5AEBA 1BMCA 5EV6A 1YCFA 4GCWA 3IOFA 1Y44A 2I7XA 2AZ4A 2XF4A 4AD9A 3R2UA 5FQBA 5A0TA 3IOGA 4ZO3A 1E5DA 3IEKA 3IE0A 3ZWFA 4DILA 2P18A 3KL7A 2ZNBA 4UWPB 3I13A 4D1WA 5IQKA 1JT1A 2GCUA 4UAMA 2OHJA 3F9OA 2ZO4A 4TYFA 2E7YA 2GFKA 1ZKPA 4LE6A 3DHBA 2YNWA 3TP9A 2NYPA 4XUKA 4C1GA 3BV6A 2BMIA 2YZ3A 5EW0A 2FU9A 5KILA 5EVKA 5LCFA 3T3OA 3FAIA 5HH5A 4D1TA 5LLDA 2WYMC 1WUOA 2Y87A 2BFZB 3PG4A 4NQ2A 2M5CA 4GYQA 5ACQA 3I15A 5A0VA 2CBNA 1ZNBA 5ACUA 2QINA 1YCGA 2BTNA 4NQ5A 2NXAA 2WYLA 4CHLA 1X8HA 3S0ZA 4HL2A 4GYUA 3ZNBA 4ZNBA 4Z5YA 2FU8A 4RAWA 3PY6A 5KIKA 5ACVA 3IE2A 4HKYA 2WYMA 4P62A 5K4NA 3RPCA 4C1EA 4AWYB 3BC2A 5DPXA 4C1FA 4EXSA 2GMNA 4PVOA 5HH4A 5HH6A 2R2DA 5EH9A 2Q9UA 2BGAA 5B1UA 1QH3A 4D1UA 4EY2A 4BP0A 3AJ3A 2ZWRA 3ADRA 5AHOA 3G1PA 3JXPA 3BK1A 4XWTA 4FR7A 1M2XA 2BG2A 3H3EA 4EXYA 3SFPA 3X2XA 2FHXA 5ACRA 2BC2A 5AHRA 4UWOB 4JO0A 5ACXA 2BIBA 2ZZIA 5LCAA 4H0DA 3AF5A 1DXKA 5ACPA 4EYFA 4BZ3A 5AXRA 2OHIA 1VMEA 2BR6A 3L6NA 2P1EA 4RM5A 4C09A 4C1CA 2A7MA 5EVDA 4TYTA 1A7TA 3X2YA 4EFZA 3T3NA 2YCBA 4AWZA 1JJEA 4Z67A 1KO3A 1ZTCA 5FQCA 2BG8B 4FEKA 2YNTA 5HIOA 5LE1A 3Q6VA 5EV8A 1DDKA 1X8IA 5A87A 5EVBA 1WW1A 5EWAA 2WHGA 1K07A 1VJNA 5B15A 2OHHA 2FU6A 1WRAA 3X30A 3DH8A 3RKKA 2XR1A 2FM6A 4WD6A 2YNVA 4D1VA 4UWRB 1JJTA 3WXCA 3X2ZA 5K4KA 4XWWA 3SRXA 3DHAA 2Q0IA 2DOOA 1A8TA 1X8GA 3I11A 4RAMA 2Q0JA 4TZ9A 2HB9A 2NZEA 4RL2A 1P9EA 2VW8A 3SPUA 4U4LA 4YSBA 3ESHA 5LSCA 4TZBA 4Z6XA 4EYBA 3MD7A 3RKJA 5AXOA 3ZQ4A 2NZFA 2AIOA 4O98A 3KNRA 4J5FA 3A4YA 4YSLA 4EYLA 3SW3A 2BFZA 4J5HA 5ACWA 4YSKA 4Z5ZA 2DKFA 3VQZA 4NQ4A 3IDZA 3I14A 2I7TA 4AX0B 3P2UA 2H6AA 1VGNA 4D02A 2Y8BA 4B87A 5LM6A 1KR3A 2P97A 1QH5A 3IE1A 2Q42A 2QJSA 2BG7A 3BK2A 5ACSA 5LCHA 3PY5A 3IEMA 4HL1A 3DHCA 4ZEJA 2BG6A 4TZFA 3SBLA 2M5DA 4FSBA 4C1HA 2Y8AA 3LVZA 5A5ZA 2FHXB 5K4MA 2P4ZA 4Z60A 5K0WA 4UA4A 2QDTA 4UBQA 1SMLA 4F6HA 1WUPA 5HIPA 2UYXA 4RBSA 5HISA 4Z7RA 2YNUA 1XM8A 1DD6A 1BC2A 1HLKA 5LMCA 1L9YA 2GKLA 3FCZA 5HIQA 4AX1B 2GFJA 4F6ZA 1KO2A 3QH8A 5B3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T9M A;  4KEP A;  1BVT A;  2I7V A;  2YNT B;  4RL0 A;  4DIK A;  2WRS A;  2QDS A;  5LS3 A;  1MQO A;  4NQ6 A;  3KNS A;  4V0H A;  1YCH A;  3I0V A;  4KEQ A;  3IEL A;  4TZE A;  5EHT A;  5FQA A;  2FU7 A;  4ZO2 A;  5AYA A;  3AF6 A;  2BFK A;  2BFL A;  4PVT A;  2FK6 A;  3ZR9 A;  1XTO A;  4UWS B;  4C1D A;  2QED A;  2BG8 A;  2YNV B;  3SD9 A;  3VPE A;  5ACT A;  5AEB A;  1BMC A;  5EV6 A;  1YCF A;  4GCW A;  3IOF A;  1Y44 A;  2I7X A;  2AZ4 A;  2XF4 A;  4AD9 A;  3R2U A;  5FQB A;  5A0T A;  3IOG A;  4ZO3 A;  1E5D A;  3IEK A;  3IE0 A;  3ZWF A;  4DIL A;  2P18 A;  3KL7 A;  2ZNB A;  4UWP B;  3I13 A;  4D1W A;  5IQK A;  1JT1 A;  2GCU A;  4UAM A;  2OHJ A;  3F9O A;  2ZO4 A;  4TYF A;  2E7Y A;  2GFK A;  1ZKP A;  4LE6 A;  3DHB A;  2YNW A;  3TP9 A;  2NYP A;  4XUK A;  4C1G A;  3BV6 A;  2BMI A;  2YZ3 A;  5EW0 A;  2FU9 A;  5KIL A;  5EVK A;  5LCF A;  3T3O A;  3FAI A;  5HH5 A;  4D1T A;  5LLD A;  2WYM C;  1WUO A;  2Y87 A;  2BFZ B;  3PG4 A;  4NQ2 A;  2M5C A;  4GYQ A;  5ACQ A;  3I15 A;  5A0V A;  2CBN A;  1ZNB A;  5ACU A;  2QIN A;  1YCG A;  2BTN A;  4NQ5 A;  2NXA A;  2WYL A;  4CHL A;  1X8H A;  3S0Z A;  4HL2 A;  4GYU A;  3ZNB A;  4ZNB A;  4Z5Y A;  2FU8 A;  4RAW A;  3PY6 A;  5KIK A;  5ACV A;  3IE2 A;  4HKY A;  2WYM A;  4P62 A;  5K4N A;  3RPC A;  4C1E A;  4AWY B;  3BC2 A;  5DPX A;  4C1F A;  4EXS A;  2GMN A;  4PVO A;  5HH4 A;  5HH6 A;  2R2D A;  5EH9 A;  2Q9U A;  2BGA A;  5B1U A;  1QH3 A;  4D1U A;  4EY2 A;  4BP0 A;  3AJ3 A;  2ZWR A;  3ADR A;  5AHO A;  3G1P A;  3JXP A;  3BK1 A;  4XWT A;  4FR7 A;  1M2X A;  2BG2 A;  3H3E A;  4EXY A;  3SFP A;  3X2X A;  2FHX A;  5ACR A;  2BC2 A;  5AHR A;  4UWO B;  4JO0 A;  5ACX A;  2BIB A;  2ZZI A;  5LCA A;  4H0D A;  3AF5 A;  1DXK A;  5ACP A;  4EYF A;  4BZ3 A;  5AXR A;  2OHI A;  1VME A;  2BR6 A;  3L6N A;  2P1E A;  4RM5 A;  4C09 A;  4C1C A;  2A7M A;  5EVD A;  4TYT A;  1A7T A;  3X2Y A;  4EFZ A;  3T3N A;  2YCB A;  4AWZ A;  1JJE A;  4Z67 A;  1KO3 A;  1ZTC A;  5FQC A;  2BG8 B;  4FEK A;  2YNT A;  5HIO A;  5LE1 A;  3Q6V A;  5EV8 A;  1DDK A;  1X8I A;  5A87 A;  5EVB A;  1WW1 A;  5EWA A;  2WHG A;  1K07 A;  1VJN A;  5B15 A;  2OHH A;  2FU6 A;  1WRA A;  3X30 A;  3DH8 A;  3RKK A;  2XR1 A;  2FM6 A;  4WD6 A;  2YNV A;  4D1V A;  4UWR B;  1JJT A;  3WXC A;  3X2Z A;  5K4K A;  4XWW A;  3SRX A;  3DHA A;  2Q0I A;  2DOO A;  1A8T A;  1X8G A;  3I11 A;  4RAM A;  2Q0J A;  4TZ9 A;  2HB9 A;  2NZE A;  4RL2 A;  1P9E A;  2VW8 A;  3SPU A;  4U4L A;  4YSB A;  3ESH A;  5LSC A;  4TZB A;  4Z6X A;  4EYB A;  3MD7 A;  3RKJ A;  5AXO A;  3ZQ4 A;  2NZF A;  2AIO A;  4O98 A;  3KNR A;  4J5F A;  3A4Y A;  4YSL A;  4EYL A;  3SW3 A;  2BFZ A;  4J5H A;  5ACW A;  4YSK A;  4Z5Z A;  2DKF A;  3VQZ A;  4NQ4 A;  3IDZ A;  3I14 A;  2I7T A;  4AX0 B;  3P2U A;  2H6A A;  1VGN A;  4D02 A;  2Y8B A;  4B87 A;  5LM6 A;  1KR3 A;  2P97 A;  1QH5 A;  3IE1 A;  2Q42 A;  2QJS A;  2BG7 A;  3BK2 A;  5ACS A;  5LCH A;  3PY5 A;  3IEM A;  4HL1 A;  3DHC A;  4ZEJ A;  2BG6 A;  4TZF A;  3SBL A;  2M5D A;  4FSB A;  4C1H A;  2Y8A A;  3LVZ A;  5A5Z A;  2FHX B;  5K4M A;  2P4Z A;  4Z60 A;  5K0W A;  4UA4 A;  2QDT A;  4UBQ A;  1SML A;  4F6H A;  1WUP A;  5HIP A;  2UYX A;  4RBS A;  5HIS A;  4Z7R A;  2YNU A;  1XM8 A;  1DD6 A;  1BC2 A;  1HLK A;  5LMC A;  1L9Y A;  2GKL A;  3FCZ A;  5HIQ A;  4AX1 B;  2GFJ A;  4F6Z A;  1KO2 A;  3QH8 A;  5B3R A; 
#chains in the Genus database with same CATH topology
 3T9M A;  4KEP A;  1BVT A;  2I7V A;  2YNT B;  4RL0 A;  4DIK A;  2WRS A;  2QDS A;  5LS3 A;  1MQO A;  4NQ6 A;  3KNS A;  4V0H A;  1YCH A;  3I0V A;  4KEQ A;  3IEL A;  4TZE A;  5EHT A;  5FQA A;  2FU7 A;  4ZO2 A;  5AYA A;  3AF6 A;  2BFK A;  2BFL A;  4PVT A;  2FK6 A;  3ZR9 A;  1XTO A;  4UWS B;  4C1D A;  2QED A;  2BG8 A;  2YNV B;  3SD9 A;  3VPE A;  5ACT A;  5AEB A;  1BMC A;  5EV6 A;  1YCF A;  4GCW A;  3IOF A;  1Y44 A;  2I7X A;  2AZ4 A;  2XF4 A;  4AD9 A;  3R2U A;  5FQB A;  5A0T A;  3IOG A;  4ZO3 A;  1E5D A;  3IEK A;  3IE0 A;  3ZWF A;  4DIL A;  2P18 A;  3KL7 A;  2ZNB A;  4UWP B;  3I13 A;  4D1W A;  5IQK A;  1JT1 A;  2GCU A;  4UAM A;  2OHJ A;  3F9O A;  2ZO4 A;  4TYF A;  2E7Y A;  2GFK A;  1ZKP A;  4LE6 A;  3DHB A;  2YNW A;  3TP9 A;  2NYP A;  4C1G A;  4XUK A;  3BV6 A;  2BMI A;  2YZ3 A;  5EW0 A;  2FU9 A;  5KIL A;  5EVK A;  5LCF A;  3T3O A;  3FAI A;  5HH5 A;  4D1T A;  4NUR A;  5LLD A;  2WYM C;  1WUO A;  2Y87 A;  2BFZ B;  3PG4 A;  4NQ2 A;  2M5C A;  4GYQ A;  5ACQ A;  3I15 A;  5A0V A;  2CBN A;  1ZNB A;  5ACU A;  2QIN A;  1YCG A;  2BTN A;  2CFU A;  4NQ5 A;  2NXA A;  2WYL A;  4CHL A;  1X8H A;  3S0Z A;  4HL2 A;  4GYU A;  3ZNB A;  4ZNB A;  4Z5Y A;  2FU8 A;  4RAW A;  4AV7 A;  3PY6 A;  2CG2 A;  5KIK A;  5ACV A;  3IE2 A;  4HKY A;  2WYM A;  4P62 A;  5K4N A;  3RPC A;  4C1E A;  4AWY B;  3BC2 A;  5DPX A;  4C1F A;  4EXS A;  2GMN A;  4PVO A;  5HH4 A;  5HH6 A;  2R2D A;  5EH9 A;  2Q9U A;  2BGA A;  5B1U A;  1QH3 A;  4D1U A;  4EY2 A;  4BP0 A;  3AJ3 A;  2ZWR A;  3ADR A;  5AHO A;  3G1P A;  3JXP A;  3BK1 A;  5A23 A;  4XWT A;  4FR7 A;  1M2X A;  2BG2 A;  3H3E A;  4EXY A;  3SFP A;  3X2X A;  2FHX A;  5ACR A;  2BC2 A;  5AHR A;  4UWO B;  4JO0 A;  5ACX A;  2BIB A;  2ZZI A;  5LCA A;  4H0D A;  3AF5 A;  1DXK A;  5ACP A;  4EYF A;  4BZ3 A;  5AXR A;  2OHI A;  1VME A;  2BR6 A;  3L6N A;  4PDX A;  2P1E A;  4RM5 A;  4C09 A;  4C1C A;  2A7M A;  5EVD A;  4TYT A;  1A7T A;  3X2Y A;  4EFZ A;  3T3N A;  2YCB A;  4AWZ A;  1JJE A;  4Z67 A;  1KO3 A;  1ZTC A;  5FQC A;  2BG8 B;  4FEK A;  2YNT A;  5HIO A;  5LE1 A;  3Q6V A;  5EV8 A;  1DDK A;  1X8I A;  5A87 A;  5EVB A;  1WW1 A;  5EWA A;  2WHG A;  1K07 A;  1VJN A;  5B15 A;  2OHH A;  2FU6 A;  1WRA A;  3X30 A;  3DH8 A;  3RKK A;  2XR1 A;  2FM6 A;  4WD6 A;  2YNV A;  4D1V A;  4UWR B;  1JJT A;  3WXC A;  2CG3 A;  3X2Z A;  5K4K A;  4XWW A;  3SRX A;  3DHA A;  2Q0I A;  2DOO A;  1A8T A;  1X8G A;  3I11 A;  4RAM A;  2CFZ A;  2Q0J A;  4TZ9 A;  2HB9 A;  2NZE A;  4RL2 A;  1P9E A;  2VW8 A;  3SPU A;  4U4L A;  4YSB A;  3ESH A;  5LSC A;  4TZB A;  4Z6X A;  4EYB A;  3MD7 A;  3RKJ A;  5AXO A;  3ZQ4 A;  2NZF A;  2AIO A;  2YHE A;  4O98 A;  3KNR A;  4J5F A;  3A4Y A;  4YSL A;  4EYL A;  3SW3 A;  2BFZ A;  4J5H A;  5AJL A;  5ACW A;  4YSK A;  4Z5Z A;  2DKF A;  3VQZ A;  4NQ4 A;  3IDZ A;  3I14 A;  2I7T A;  4AX0 B;  3P2U A;  2H6A A;  1VGN A;  4D02 A;  2Y8B A;  4B87 A;  5LM6 A;  1KR3 A;  2P97 A;  1QH5 A;  3IE1 A;  2Q42 A;  2QJS A;  2BG7 A;  3BK2 A;  5ACS A;  5LCH A;  3PY5 A;  5AIJ A;  3IEM A;  4AXH A;  4HL1 A;  3DHC A;  4ZEJ A;  2BG6 A;  4TZF A;  3SBL A;  2M5D A;  4FSB A;  4C1H A;  2Y8A A;  3LVZ A;  5A5Z A;  2FHX B;  5K4M A;  2P4Z A;  4Z60 A;  5K0W A;  4UA4 A;  2QDT A;  4UBQ A;  1SML A;  4F6H A;  1WUP A;  5HIP A;  2UYX A;  4RBS A;  5HIS A;  4Z7R A;  2YNU A;  1XM8 A;  1DD6 A;  1BC2 A;  1HLK A;  5LMC A;  1L9Y A;  2GKL A;  3FCZ A;  5HIQ A;  4AX1 B;  2GFJ A;  4F6Z A;  1KO2 A;  3QH8 A;  5B3R A; 
#chains in the Genus database with same CATH homology
 3T9M A;  4KEP A;  1BVT A;  2I7V A;  2YNT B;  4RL0 A;  4DIK A;  2WRS A;  2QDS A;  5LS3 A;  1MQO A;  4NQ6 A;  3KNS A;  4V0H A;  1YCH A;  3I0V A;  4KEQ A;  3IEL A;  4TZE A;  5EHT A;  5FQA A;  2FU7 A;  4ZO2 A;  5AYA A;  3AF6 A;  2BFK A;  2BFL A;  4PVT A;  2FK6 A;  3ZR9 A;  1XTO A;  4UWS B;  4C1D A;  2QED A;  2BG8 A;  2YNV B;  3SD9 A;  3VPE A;  5ACT A;  5AEB A;  1BMC A;  5EV6 A;  1YCF A;  4GCW A;  3IOF A;  1Y44 A;  2I7X A;  2AZ4 A;  2XF4 A;  4AD9 A;  3R2U A;  5FQB A;  5A0T A;  3IOG A;  4ZO3 A;  1E5D A;  3IEK A;  3IE0 A;  3ZWF A;  4DIL A;  2P18 A;  3KL7 A;  2ZNB A;  4UWP B;  3I13 A;  4D1W A;  5IQK A;  1JT1 A;  2GCU A;  4UAM A;  2OHJ A;  3F9O A;  2ZO4 A;  4TYF A;  2E7Y A;  2GFK A;  1ZKP A;  4LE6 A;  3DHB A;  2YNW A;  3TP9 A;  2NYP A;  4XUK A;  4C1G A;  3BV6 A;  2BMI A;  2YZ3 A;  5EW0 A;  2FU9 A;  5KIL A;  5EVK A;  5LCF A;  3T3O A;  3FAI A;  5HH5 A;  4D1T A;  5LLD A;  2WYM C;  1WUO A;  2Y87 A;  2BFZ B;  3PG4 A;  4NQ2 A;  2M5C A;  4GYQ A;  5ACQ A;  3I15 A;  5A0V A;  2CBN A;  1ZNB A;  5ACU A;  2QIN A;  1YCG A;  2BTN A;  4NQ5 A;  2NXA A;  2WYL A;  4CHL A;  1X8H A;  3S0Z A;  4HL2 A;  4GYU A;  3ZNB A;  4ZNB A;  4Z5Y A;  2FU8 A;  4RAW A;  3PY6 A;  5KIK A;  5ACV A;  3IE2 A;  4HKY A;  2WYM A;  4P62 A;  5K4N A;  3RPC A;  4C1E A;  4AWY B;  3BC2 A;  5DPX A;  4C1F A;  4EXS A;  2GMN A;  4PVO A;  5HH4 A;  5HH6 A;  2R2D A;  5EH9 A;  2Q9U A;  2BGA A;  5B1U A;  1QH3 A;  4D1U A;  4EY2 A;  4BP0 A;  3AJ3 A;  2ZWR A;  3ADR A;  5AHO A;  3G1P A;  3JXP A;  3BK1 A;  4XWT A;  4FR7 A;  1M2X A;  2BG2 A;  3H3E A;  4EXY A;  3SFP A;  3X2X A;  2FHX A;  5ACR A;  2BC2 A;  5AHR A;  4UWO B;  4JO0 A;  5ACX A;  2BIB A;  2ZZI A;  5LCA A;  4H0D A;  3AF5 A;  1DXK A;  5ACP A;  4EYF A;  4BZ3 A;  5AXR A;  2OHI A;  1VME A;  2BR6 A;  3L6N A;  2P1E A;  4RM5 A;  4C09 A;  4C1C A;  2A7M A;  5EVD A;  4TYT A;  1A7T A;  3X2Y A;  4EFZ A;  3T3N A;  2YCB A;  4AWZ A;  1JJE A;  4Z67 A;  1KO3 A;  1ZTC A;  5FQC A;  2BG8 B;  4FEK A;  2YNT A;  5HIO A;  5LE1 A;  3Q6V A;  5EV8 A;  1DDK A;  1X8I A;  5A87 A;  5EVB A;  1WW1 A;  5EWA A;  2WHG A;  1K07 A;  1VJN A;  5B15 A;  2OHH A;  2FU6 A;  1WRA A;  3X30 A;  3DH8 A;  3RKK A;  2XR1 A;  2FM6 A;  4WD6 A;  2YNV A;  4D1V A;  4UWR B;  1JJT A;  3WXC A;  3X2Z A;  5K4K A;  4XWW A;  3SRX A;  3DHA A;  2Q0I A;  2DOO A;  1A8T A;  1X8G A;  3I11 A;  4RAM A;  2Q0J A;  4TZ9 A;  2HB9 A;  2NZE A;  4RL2 A;  1P9E A;  2VW8 A;  3SPU A;  4U4L A;  4YSB A;  3ESH A;  5LSC A;  4TZB A;  4Z6X A;  4EYB A;  3MD7 A;  3RKJ A;  5AXO A;  3ZQ4 A;  2NZF A;  2AIO A;  4O98 A;  3KNR A;  4J5F A;  3A4Y A;  4YSL A;  4EYL A;  3SW3 A;  2BFZ A;  4J5H A;  5ACW A;  4YSK A;  4Z5Z A;  2DKF A;  3VQZ A;  4NQ4 A;  3IDZ A;  3I14 A;  2I7T A;  4AX0 B;  3P2U A;  2H6A A;  1VGN A;  4D02 A;  2Y8B A;  4B87 A;  5LM6 A;  1KR3 A;  2P97 A;  1QH5 A;  3IE1 A;  2Q42 A;  2QJS A;  2BG7 A;  3BK2 A;  5ACS A;  5LCH A;  3PY5 A;  3IEM A;  4HL1 A;  3DHC A;  4ZEJ A;  2BG6 A;  4TZF A;  3SBL A;  2M5D A;  4FSB A;  4C1H A;  2Y8A A;  3LVZ A;  5A5Z A;  2FHX B;  5K4M A;  2P4Z A;  4Z60 A;  5K0W A;  4UA4 A;  2QDT A;  4UBQ A;  1SML A;  4F6H A;  1WUP A;  5HIP A;  2UYX A;  4RBS A;  5HIS A;  4Z7R A;  2YNU A;  1XM8 A;  1DD6 A;  1BC2 A;  1HLK A;  5LMC A;  1L9Y A;  2GKL A;  3FCZ A;  5HIQ A;  4AX1 B;  2GFJ A;  4F6Z A;  1KO2 A;  3QH8 A;  5B3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...