5B1UA

Crystal structure of metallo-beta-lactamase smb-1 bound to hydrolyzed imipenem
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
259
structure length
259
Chain Sequence
RDWSSPQQPFTIYGNTHYVGTGGISAVLLSSPQGHILVDGTTEKGAQVVAANIRAMGFKLSDVKYILSTHSHEDHAGGISAMQKLTGATVLAGAANVDTLRTGVSPKSDPQFGSLSNFPGSAKVRAVADGELVKLGPLAVKAHATPGHTEGGITWTWQSCEQGKCKDVVFADSLTAVSADSYRFSDHPEVVASLRGSFEAVEKLSCDIAIAAHPEVNDMWTRQQRAAKEGNSAYVDNGACRAIAAAGRKRLETRLASEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Metallo-beta-Lactamase SMB-1 Bound to Hydrolyzed Imipenem
rcsb
source organism Serratia marcescens
molecule tags Hydrolase/antibiotic
molecule keywords Metallo-beta-lactamase
total genus 87
structure length 259
sequence length 259
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5b1uA00
2FHXA 4LE6A 5ACVA 2FU6A 4J5FA 2YNWA 3DHBA 3TP9A 3IE0A 3IE1A 2OHHA 1ZTCA 4Z6XA 3PG4A 5HISA 4PVTA 5ACWA 2ZNBA 5LMCA 4GCWA 3DHCA 4UA4A 4HL1A 1SMLA 1P9EA 2QJSA 5LE1A 4RAMA 5AYAA 4AWYB 4KEPA 2ZO4A 2WYMA 2GKLA 5AXOA 4ZNBA 4B87A 4RL0A 5EHTA 4RM5A 1K07A 2NYPA 5EH9A 2DOOA 2YNTB 5ACTA 1WW1A 4C1DA 4TZFA 3ZQ4A 4P62A 2BTNA 4D1WA 3I14A 4UBQA 2OHJA 4UWRB 2Q0JA 4XWWA 2AIOA 2UYXA 3ADRA 1JJEA 4NQ6A 1M2XA 3PY6A 4ZO2A 2BG2A 3Q6VA 5EVDA 2A7MA 2BG8A 1KR3A 1DXKA 2CBNA 4HKYA 2FHXB 3FAIA 4EYBA 2H6AA 4C1GA 2QEDA 1L9YA 4PVOA 5HH6A 2WHGA 3I13A 5EV6A 4YSLA 4D02A 2HB9A 3SPUA 5LLDA 5ACPA 5AEBA 2Q0IA 1Y44A 3MD7A 5HIOA 2P97A 1JT1A 1X8IA 5DPXA 4DILA 2I7VA 3AF6A 1YCGA 1XM8A 3BK2A 3ESHA 5EWAA 3L6NA 3X2XA 3WXCA 4V0HA 3BK1A 4ZO3A 2XR1A 1HLKA 3DHAA 4EYLA 4UWSB 3G1PA 4D1TA 1X8HA 3BC2A 2AZ4A 5A0TA 1VJNA 4WD6A 1VMEA 3IE2A 4UWOB 3ZNBA 5K0WA 2BG8B 5EVKA 5HIPA 4AWZA 4DIKA 4RBSA 2QDTA 4RAWA 3KNSA 4C09A 3AF5A 2FM6A 2FU7A 1YCHA 2Y8AA 3A4YA 1VGNA 3IOGA 2M5DA 2BR6A 5ACSA 4EXYA 2GMNA 2GCUA 2BFKA 2BMIA 2FK6A 2NZFA 2BC2A 3F9OA 1WUOA 5FQCA 2OHIA 2Y87A 5HH4A 3FCZA 4Z5YA 4FEKA 4NQ4A 4UAMA 4BZ3A 3RKKA 2BFLA 4TZEA 1YCFA 3JXPA 2DKFA 1DD6A 2GFKA 4EXSA 4YSBA 4H0DA 3DH8A 5LCAA 3SFPA 1BVTA 1ZKPA 4Z67A 1ZNBA 4AX1B 3KNRA 2YNTA 1KO2A 5FQBA 2Q42A 3H3EA 3IEKA 3KL7A 5A87A 3I15A 4TZ9A 2P1EA 5LS3A 4TZBA 5ACUA 2BG6A 4CHLA 3I0VA 4GYUA 4EYFA 4D1VA 1WRAA 4U4LA 4FSBA 1MQOA 3AJ3A 5LCHA 2ZWRA 4XWTA 2YNUA 2BFZB 3X2ZA 1A7TA 4JO0A 5B3RA 2GFJA 2WYMC 4FR7A 4TYFA 4GYQA 3SBLA 2FU8A 4NQ2A 3PY5A 1BC2A 4AD9A 3IOFA 5KIKA 2XF4A 5FQAA 4Z7RA 3T9MA 2YNVB 4O98A 1A8TA 5ACQA 2I7XA 5ACRA 3VPEA 4ZEJA 4F6ZA 4D1UA 2P4ZA 4TYTA 4UWPB 3VQZA 2VW8A 5AHRA 2FU9A 3BV6A 4HL2A 3I11A 5AHOA 5B1UA 5KILA 2BGAA 5LM6A 3LVZA 3QH8A 3R2UA 2Y8BA 1JJTA 3T3NA 5EV8A 3SW3A 2Q9UA 3RKJA 3T3OA 1QH5A 2BIBA 5K4MA 2ZZIA 2QDSA 4RL2A 3IEMA 5B15A 5EVBA 2BFZA 4Z60A 2P18A 3SRXA 4AX0B 3X30A 4Z5ZA 4YSKA 4C1CA 4NQ5A 2WRSA 3IDZA 2R2DA 4F6HA 4J5HA 2YNVA 5LCFA 1WUPA 2M5CA 1X8GA 3SD9A 3X2YA 4EY2A 1BMCA 4EFZA 1XTOA 3S0ZA 2E7YA 5IQKA 4C1HA 5K4KA 2BG7A 2WYLA 5EW0A 4C1EA 2YCBA 3ZR9A 5LSCA 4XUKA 2NZEA 5HH5A 3P2UA 5A5ZA 1KO3A 5A0VA 5HIQA 5ACXA 2YZ3A 1E5DA 4BP0A 1DDKA 5K4NA 1QH3A 2I7TA 5AXRA 3RPCA 2NXAA 2QINA 4KEQA 4C1FA 3IELA 3ZWFA
chains in the Genus database with same CATH superfamily
2FHXA 4LE6A 5ACVA 2FU6A 4J5FA 2YNWA 3DHBA 3TP9A 3IE0A 3IE1A 2OHHA 1ZTCA 4Z6XA 3PG4A 5HISA 4PVTA 5ACWA 2ZNBA 5AIJA 5LMCA 4GCWA 3DHCA 4UA4A 4HL1A 1SMLA 1P9EA 2QJSA 5LE1A 4RAMA 5AYAA 4AWYB 4KEPA 5AJLA 2ZO4A 2WYMA 2GKLA 5AXOA 4ZNBA 4B87A 4RL0A 5EHTA 2CG3A 1K07A 4RM5A 2NYPA 5EH9A 2DOOA 2YNTB 5ACTA 1WW1A 4C1DA 4TZFA 3ZQ4A 4P62A 2BTNA 4D1WA 3I14A 4UBQA 2OHJA 4UWRB 2Q0JA 4XWWA 2AIOA 2UYXA 3ADRA 1JJEA 4NQ6A 1M2XA 3PY6A 4ZO2A 2BG2A 3Q6VA 5EVDA 2CFZA 2A7MA 2BG8A 1KR3A 1DXKA 2CBNA 4HKYA 2FHXB 3FAIA 4EYBA 2H6AA 4C1GA 2QEDA 1L9YA 4PVOA 5HH6A 2WHGA 3I13A 5EV6A 4YSLA 4D02A 2HB9A 3SPUA 5LLDA 5ACPA 5AEBA 2Q0IA 1Y44A 3MD7A 5HIOA 2P97A 1JT1A 1X8IA 5DPXA 4DILA 2I7VA 3AF6A 1YCGA 1XM8A 3BK2A 3ESHA 5EWAA 3L6NA 3X2XA 4AV7A 3WXCA 4V0HA 3BK1A 4ZO3A 2XR1A 1HLKA 3DHAA 4EYLA 4UWSB 3G1PA 4D1TA 1X8HA 3BC2A 2AZ4A 5A0TA 1VJNA 4WD6A 1VMEA 3IE2A 4UWOB 3ZNBA 5K0WA 2BG8B 5EVKA 5HIPA 4AWZA 4DIKA 4RBSA 2QDTA 4RAWA 3KNSA 4C09A 3AF5A 2FM6A 2FU7A 1YCHA 2Y8AA 3A4YA 1VGNA 3IOGA 2M5DA 2BR6A 5ACSA 4EXYA 2GMNA 4PDXA 2GCUA 2BFKA 2BMIA 2FK6A 2NZFA 2BC2A 3F9OA 1WUOA 5FQCA 2OHIA 2Y87A 5HH4A 3FCZA 4Z5YA 4FEKA 4NQ4A 4UAMA 4BZ3A 3RKKA 2BFLA 4TZEA 1YCFA 3JXPA 2DKFA 1DD6A 2GFKA 4EXSA 2CFUA 4YSBA 5A23A 4H0DA 3DH8A 5LCAA 3SFPA 1BVTA 1ZKPA 4Z67A 1ZNBA 4AX1B 3KNRA 2YNTA 1KO2A 5FQBA 2Q42A 3H3EA 3IEKA 3KL7A 5A87A 3I15A 4TZ9A 2P1EA 5LS3A 4TZBA 5ACUA 2BG6A 4CHLA 3I0VA 4GYUA 4EYFA 2YHEA 4D1VA 1WRAA 4U4LA 4FSBA 4AXHA 1MQOA 3AJ3A 5LCHA 2ZWRA 4XWTA 2YNUA 2BFZB 3X2ZA 1A7TA 4JO0A 5B3RA 2GFJA 2WYMC 4FR7A 4TYFA 4GYQA 3SBLA 2FU8A 4NQ2A 3PY5A 1BC2A 4AD9A 3IOFA 5KIKA 2XF4A 5FQAA 4Z7RA 3T9MA 2YNVB 4O98A 1A8TA 5ACQA 2I7XA 5ACRA 3VPEA 4ZEJA 4F6ZA 4D1UA 2P4ZA 4TYTA 4UWPB 3VQZA 2VW8A 5AHRA 2FU9A 3BV6A 4HL2A 3I11A 5AHOA 5B1UA 2BGAA 5KILA 5LM6A 3LVZA 3QH8A 3R2UA 2Y8BA 1JJTA 3T3NA 5EV8A 3SW3A 2Q9UA 3RKJA 3T3OA 1QH5A 2BIBA 5K4MA 2ZZIA 2QDSA 4RL2A 3IEMA 5B15A 5EVBA 2BFZA 4Z60A 2P18A 3SRXA 4AX0B 3X30A 4Z5ZA 4NURA 4YSKA 4C1CA 4NQ5A 2WRSA 3IDZA 2R2DA 4F6HA 4J5HA 2YNVA 5LCFA 1WUPA 2M5CA 1X8GA 3SD9A 3X2YA 4EY2A 1BMCA 4EFZA 1XTOA 3S0ZA 2E7YA 5IQKA 4C1HA 5K4KA 2BG7A 2WYLA 5EW0A 4C1EA 2YCBA 3ZR9A 5LSCA 4XUKA 2NZEA 5HH5A 3P2UA 5A5ZA 2CG2A 1KO3A 5A0VA 5HIQA 5ACXA 2YZ3A 1E5DA 4BP0A 1DDKA 5K4NA 1QH3A 2I7TA 5AXRA 3RPCA 2NXAA 2QINA 4KEQA 4C1FA 3IELA 3ZWFA
chains in the Genus database with same CATH topology
2FHXA 4LE6A 5ACVA 2FU6A 4J5FA 2YNWA 3DHBA 3TP9A 3IE0A 3IE1A 2OHHA 1ZTCA 4Z6XA 3PG4A 5HISA 4PVTA 5ACWA 2ZNBA 5LMCA 4GCWA 3DHCA 4UA4A 4HL1A 1SMLA 1P9EA 2QJSA 5LE1A 4RAMA 5AYAA 4AWYB 4KEPA 2ZO4A 2WYMA 2GKLA 5AXOA 4ZNBA 4B87A 4RL0A 5EHTA 4RM5A 1K07A 2NYPA 5EH9A 2DOOA 2YNTB 5ACTA 1WW1A 4C1DA 4TZFA 3ZQ4A 4P62A 2BTNA 4D1WA 3I14A 4UBQA 2OHJA 4UWRB 2Q0JA 4XWWA 2AIOA 2UYXA 3ADRA 1JJEA 4NQ6A 1M2XA 3PY6A 4ZO2A 2BG2A 3Q6VA 5EVDA 2A7MA 2BG8A 1KR3A 1DXKA 2CBNA 4HKYA 2FHXB 3FAIA 4EYBA 2H6AA 4C1GA 2QEDA 1L9YA 4PVOA 5HH6A 2WHGA 3I13A 5EV6A 4YSLA 4D02A 2HB9A 3SPUA 5LLDA 5ACPA 5AEBA 2Q0IA 1Y44A 3MD7A 5HIOA 2P97A 1JT1A 1X8IA 5DPXA 4DILA 2I7VA 3AF6A 1YCGA 1XM8A 3BK2A 3ESHA 5EWAA 3L6NA 3X2XA 3WXCA 4V0HA 3BK1A 4ZO3A 2XR1A 1HLKA 3DHAA 4EYLA 4UWSB 3G1PA 4D1TA 1X8HA 3BC2A 2AZ4A 5A0TA 1VJNA 4WD6A 1VMEA 3IE2A 4UWOB 3ZNBA 5K0WA 2BG8B 5EVKA 5HIPA 4AWZA 4DIKA 4RBSA 2QDTA 4RAWA 3KNSA 4C09A 3AF5A 2FM6A 2FU7A 1YCHA 2Y8AA 3A4YA 1VGNA 3IOGA 2M5DA 2BR6A 5ACSA 4EXYA 2GMNA 2GCUA 2BFKA 2BMIA 2FK6A 2NZFA 2BC2A 3F9OA 1WUOA 5FQCA 2OHIA 2Y87A 5HH4A 3FCZA 4Z5YA 4FEKA 4NQ4A 4UAMA 4BZ3A 3RKKA 2BFLA 4TZEA 1YCFA 3JXPA 2DKFA 1DD6A 2GFKA 4EXSA 4YSBA 4H0DA 3DH8A 5LCAA 3SFPA 1BVTA 1ZKPA 4Z67A 1ZNBA 4AX1B 3KNRA 2YNTA 1KO2A 5FQBA 2Q42A 3H3EA 3IEKA 3KL7A 5A87A 3I15A 4TZ9A 2P1EA 5LS3A 4TZBA 5ACUA 2BG6A 4CHLA 3I0VA 4GYUA 4EYFA 4D1VA 1WRAA 4U4LA 4FSBA 1MQOA 3AJ3A 5LCHA 2ZWRA 4XWTA 2YNUA 2BFZB 3X2ZA 1A7TA 4JO0A 5B3RA 2GFJA 2WYMC 4FR7A 4TYFA 4GYQA 3SBLA 2FU8A 4NQ2A 3PY5A 1BC2A 4AD9A 3IOFA 5KIKA 2XF4A 5FQAA 4Z7RA 3T9MA 2YNVB 4O98A 1A8TA 5ACQA 2I7XA 5ACRA 3VPEA 4ZEJA 4F6ZA 4D1UA 2P4ZA 4TYTA 4UWPB 3VQZA 2VW8A 5AHRA 2FU9A 3BV6A 4HL2A 3I11A 5AHOA 5B1UA 5KILA 2BGAA 5LM6A 3LVZA 3QH8A 3R2UA 2Y8BA 1JJTA 3T3NA 5EV8A 3SW3A 2Q9UA 3RKJA 3T3OA 1QH5A 2BIBA 5K4MA 2ZZIA 2QDSA 4RL2A 3IEMA 5B15A 5EVBA 2BFZA 4Z60A 2P18A 3SRXA 4AX0B 3X30A 4Z5ZA 4YSKA 4C1CA 4NQ5A 2WRSA 3IDZA 2R2DA 4F6HA 4J5HA 2YNVA 5LCFA 1WUPA 2M5CA 1X8GA 3SD9A 3X2YA 4EY2A 1BMCA 4EFZA 1XTOA 3S0ZA 2E7YA 5IQKA 4C1HA 5K4KA 2BG7A 2WYLA 5EW0A 4C1EA 2YCBA 3ZR9A 5LSCA 4XUKA 2NZEA 5HH5A 3P2UA 5A5ZA 1KO3A 5A0VA 5HIQA 5ACXA 2YZ3A 1E5DA 4BP0A 1DDKA 5K4NA 1QH3A 2I7TA 5AXRA 3RPCA 2NXAA 2QINA 4KEQA 4C1FA 3IELA 3ZWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FHX A;  4LE6 A;  5ACV A;  2FU6 A;  4J5F A;  2YNW A;  3DHB A;  3TP9 A;  3IE0 A;  3IE1 A;  2OHH A;  1ZTC A;  4Z6X A;  3PG4 A;  5HIS A;  4PVT A;  5ACW A;  2ZNB A;  5LMC A;  4GCW A;  3DHC A;  4UA4 A;  4HL1 A;  1SML A;  1P9E A;  2QJS A;  5LE1 A;  4RAM A;  5AYA A;  4AWY B;  4KEP A;  2ZO4 A;  2WYM A;  2GKL A;  5AXO A;  4ZNB A;  4B87 A;  4RL0 A;  5EHT A;  4RM5 A;  1K07 A;  2NYP A;  5EH9 A;  2DOO A;  2YNT B;  5ACT A;  1WW1 A;  4C1D A;  4TZF A;  3ZQ4 A;  4P62 A;  2BTN A;  4D1W A;  3I14 A;  4UBQ A;  2OHJ A;  4UWR B;  2Q0J A;  4XWW A;  2AIO A;  2UYX A;  3ADR A;  1JJE A;  4NQ6 A;  1M2X A;  3PY6 A;  4ZO2 A;  2BG2 A;  3Q6V A;  5EVD A;  2A7M A;  2BG8 A;  1KR3 A;  1DXK A;  2CBN A;  4HKY A;  2FHX B;  3FAI A;  4EYB A;  2H6A A;  4C1G A;  2QED A;  1L9Y A;  4PVO A;  5HH6 A;  2WHG A;  3I13 A;  5EV6 A;  4YSL A;  4D02 A;  2HB9 A;  3SPU A;  5LLD A;  5ACP A;  5AEB A;  2Q0I A;  1Y44 A;  3MD7 A;  5HIO A;  2P97 A;  1JT1 A;  1X8I A;  5DPX A;  4DIL A;  2I7V A;  3AF6 A;  1YCG A;  1XM8 A;  3BK2 A;  3ESH A;  5EWA A;  3L6N A;  3X2X A;  3WXC A;  4V0H A;  3BK1 A;  4ZO3 A;  2XR1 A;  1HLK A;  3DHA A;  4EYL A;  4UWS B;  3G1P A;  4D1T A;  1X8H A;  3BC2 A;  2AZ4 A;  5A0T A;  1VJN A;  4WD6 A;  1VME A;  3IE2 A;  4UWO B;  3ZNB A;  5K0W A;  2BG8 B;  5EVK A;  5HIP A;  4AWZ A;  4DIK A;  4RBS A;  2QDT A;  4RAW A;  3KNS A;  4C09 A;  3AF5 A;  2FM6 A;  2FU7 A;  1YCH A;  2Y8A A;  3A4Y A;  1VGN A;  3IOG A;  2M5D A;  2BR6 A;  5ACS A;  4EXY A;  2GMN A;  2GCU A;  2BFK A;  2BMI A;  2FK6 A;  2NZF A;  2BC2 A;  3F9O A;  1WUO A;  5FQC A;  2OHI A;  2Y87 A;  5HH4 A;  3FCZ A;  4Z5Y A;  4FEK A;  4NQ4 A;  4UAM A;  4BZ3 A;  3RKK A;  2BFL A;  4TZE A;  1YCF A;  3JXP A;  2DKF A;  1DD6 A;  2GFK A;  4EXS A;  4YSB A;  4H0D A;  3DH8 A;  5LCA A;  3SFP A;  1BVT A;  1ZKP A;  4Z67 A;  1ZNB A;  4AX1 B;  3KNR A;  2YNT A;  1KO2 A;  5FQB A;  2Q42 A;  3H3E A;  3IEK A;  3KL7 A;  5A87 A;  3I15 A;  4TZ9 A;  2P1E A;  5LS3 A;  4TZB A;  5ACU A;  2BG6 A;  4CHL A;  3I0V A;  4GYU A;  4EYF A;  4D1V A;  1WRA A;  4U4L A;  4FSB A;  1MQO A;  3AJ3 A;  5LCH A;  2ZWR A;  4XWT A;  2YNU A;  2BFZ B;  3X2Z A;  1A7T A;  4JO0 A;  5B3R A;  2GFJ A;  2WYM C;  4FR7 A;  4TYF A;  4GYQ A;  3SBL A;  2FU8 A;  4NQ2 A;  3PY5 A;  1BC2 A;  4AD9 A;  3IOF A;  5KIK A;  2XF4 A;  5FQA A;  4Z7R A;  3T9M A;  2YNV B;  4O98 A;  1A8T A;  5ACQ A;  2I7X A;  5ACR A;  3VPE A;  4ZEJ A;  4F6Z A;  4D1U A;  2P4Z A;  4TYT A;  4UWP B;  3VQZ A;  2VW8 A;  5AHR A;  2FU9 A;  3BV6 A;  4HL2 A;  3I11 A;  5AHO A;  5B1U A;  5KIL A;  2BGA A;  5LM6 A;  3LVZ A;  3QH8 A;  3R2U A;  2Y8B A;  1JJT A;  3T3N A;  5EV8 A;  3SW3 A;  2Q9U A;  3RKJ A;  3T3O A;  1QH5 A;  2BIB A;  5K4M A;  2ZZI A;  2QDS A;  4RL2 A;  3IEM A;  5B15 A;  5EVB A;  2BFZ A;  4Z60 A;  2P18 A;  3SRX A;  4AX0 B;  3X30 A;  4Z5Z A;  4YSK A;  4C1C A;  4NQ5 A;  2WRS A;  3IDZ A;  2R2D A;  4F6H A;  4J5H A;  2YNV A;  5LCF A;  1WUP A;  2M5C A;  1X8G A;  3SD9 A;  3X2Y A;  4EY2 A;  1BMC A;  4EFZ A;  1XTO A;  3S0Z A;  2E7Y A;  5IQK A;  4C1H A;  5K4K A;  2BG7 A;  2WYL A;  5EW0 A;  4C1E A;  2YCB A;  3ZR9 A;  5LSC A;  4XUK A;  2NZE A;  5HH5 A;  3P2U A;  5A5Z A;  1KO3 A;  5A0V A;  5HIQ A;  5ACX A;  2YZ3 A;  1E5D A;  4BP0 A;  1DDK A;  5K4N A;  1QH3 A;  2I7T A;  5AXR A;  3RPC A;  2NXA A;  2QIN A;  4KEQ A;  4C1F A;  3IEL A;  3ZWF A; 
#chains in the Genus database with same CATH topology
 2FHX A;  4LE6 A;  5ACV A;  2FU6 A;  4J5F A;  2YNW A;  3DHB A;  3TP9 A;  3IE0 A;  3IE1 A;  2OHH A;  1ZTC A;  4Z6X A;  3PG4 A;  5HIS A;  4PVT A;  5ACW A;  2ZNB A;  5AIJ A;  5LMC A;  4GCW A;  3DHC A;  4UA4 A;  4HL1 A;  1SML A;  1P9E A;  2QJS A;  5LE1 A;  4RAM A;  5AYA A;  4AWY B;  4KEP A;  5AJL A;  2ZO4 A;  2WYM A;  2GKL A;  5AXO A;  4ZNB A;  4B87 A;  4RL0 A;  5EHT A;  2CG3 A;  1K07 A;  4RM5 A;  2NYP A;  5EH9 A;  2DOO A;  2YNT B;  5ACT A;  1WW1 A;  4C1D A;  4TZF A;  3ZQ4 A;  4P62 A;  2BTN A;  4D1W A;  3I14 A;  4UBQ A;  2OHJ A;  4UWR B;  2Q0J A;  4XWW A;  2AIO A;  2UYX A;  3ADR A;  1JJE A;  4NQ6 A;  1M2X A;  3PY6 A;  4ZO2 A;  2BG2 A;  3Q6V A;  5EVD A;  2CFZ A;  2A7M A;  2BG8 A;  1KR3 A;  1DXK A;  2CBN A;  4HKY A;  2FHX B;  3FAI A;  4EYB A;  2H6A A;  4C1G A;  2QED A;  1L9Y A;  4PVO A;  5HH6 A;  2WHG A;  3I13 A;  5EV6 A;  4YSL A;  4D02 A;  2HB9 A;  3SPU A;  5LLD A;  5ACP A;  5AEB A;  2Q0I A;  1Y44 A;  3MD7 A;  5HIO A;  2P97 A;  1JT1 A;  1X8I A;  5DPX A;  4DIL A;  2I7V A;  3AF6 A;  1YCG A;  1XM8 A;  3BK2 A;  3ESH A;  5EWA A;  3L6N A;  3X2X A;  4AV7 A;  3WXC A;  4V0H A;  3BK1 A;  4ZO3 A;  2XR1 A;  1HLK A;  3DHA A;  4EYL A;  4UWS B;  3G1P A;  4D1T A;  1X8H A;  3BC2 A;  2AZ4 A;  5A0T A;  1VJN A;  4WD6 A;  1VME A;  3IE2 A;  4UWO B;  3ZNB A;  5K0W A;  2BG8 B;  5EVK A;  5HIP A;  4AWZ A;  4DIK A;  4RBS A;  2QDT A;  4RAW A;  3KNS A;  4C09 A;  3AF5 A;  2FM6 A;  2FU7 A;  1YCH A;  2Y8A A;  3A4Y A;  1VGN A;  3IOG A;  2M5D A;  2BR6 A;  5ACS A;  4EXY A;  2GMN A;  4PDX A;  2GCU A;  2BFK A;  2BMI A;  2FK6 A;  2NZF A;  2BC2 A;  3F9O A;  1WUO A;  5FQC A;  2OHI A;  2Y87 A;  5HH4 A;  3FCZ A;  4Z5Y A;  4FEK A;  4NQ4 A;  4UAM A;  4BZ3 A;  3RKK A;  2BFL A;  4TZE A;  1YCF A;  3JXP A;  2DKF A;  1DD6 A;  2GFK A;  4EXS A;  2CFU A;  4YSB A;  5A23 A;  4H0D A;  3DH8 A;  5LCA A;  3SFP A;  1BVT A;  1ZKP A;  4Z67 A;  1ZNB A;  4AX1 B;  3KNR A;  2YNT A;  1KO2 A;  5FQB A;  2Q42 A;  3H3E A;  3IEK A;  3KL7 A;  5A87 A;  3I15 A;  4TZ9 A;  2P1E A;  5LS3 A;  4TZB A;  5ACU A;  2BG6 A;  4CHL A;  3I0V A;  4GYU A;  4EYF A;  2YHE A;  4D1V A;  1WRA A;  4U4L A;  4FSB A;  4AXH A;  1MQO A;  3AJ3 A;  5LCH A;  2ZWR A;  4XWT A;  2YNU A;  2BFZ B;  3X2Z A;  1A7T A;  4JO0 A;  5B3R A;  2GFJ A;  2WYM C;  4FR7 A;  4TYF A;  4GYQ A;  3SBL A;  2FU8 A;  4NQ2 A;  3PY5 A;  1BC2 A;  4AD9 A;  3IOF A;  5KIK A;  2XF4 A;  5FQA A;  4Z7R A;  3T9M A;  2YNV B;  4O98 A;  1A8T A;  5ACQ A;  2I7X A;  5ACR A;  3VPE A;  4ZEJ A;  4F6Z A;  4D1U A;  2P4Z A;  4TYT A;  4UWP B;  3VQZ A;  2VW8 A;  5AHR A;  2FU9 A;  3BV6 A;  4HL2 A;  3I11 A;  5AHO A;  5B1U A;  2BGA A;  5KIL A;  5LM6 A;  3LVZ A;  3QH8 A;  3R2U A;  2Y8B A;  1JJT A;  3T3N A;  5EV8 A;  3SW3 A;  2Q9U A;  3RKJ A;  3T3O A;  1QH5 A;  2BIB A;  5K4M A;  2ZZI A;  2QDS A;  4RL2 A;  3IEM A;  5B15 A;  5EVB A;  2BFZ A;  4Z60 A;  2P18 A;  3SRX A;  4AX0 B;  3X30 A;  4Z5Z A;  4NUR A;  4YSK A;  4C1C A;  4NQ5 A;  2WRS A;  3IDZ A;  2R2D A;  4F6H A;  4J5H A;  2YNV A;  5LCF A;  1WUP A;  2M5C A;  1X8G A;  3SD9 A;  3X2Y A;  4EY2 A;  1BMC A;  4EFZ A;  1XTO A;  3S0Z A;  2E7Y A;  5IQK A;  4C1H A;  5K4K A;  2BG7 A;  2WYL A;  5EW0 A;  4C1E A;  2YCB A;  3ZR9 A;  5LSC A;  4XUK A;  2NZE A;  5HH5 A;  3P2U A;  5A5Z A;  2CG2 A;  1KO3 A;  5A0V A;  5HIQ A;  5ACX A;  2YZ3 A;  1E5D A;  4BP0 A;  1DDK A;  5K4N A;  1QH3 A;  2I7T A;  5AXR A;  3RPC A;  2NXA A;  2QIN A;  4KEQ A;  4C1F A;  3IEL A;  3ZWF A; 
#chains in the Genus database with same CATH homology
 2FHX A;  4LE6 A;  5ACV A;  2FU6 A;  4J5F A;  2YNW A;  3DHB A;  3TP9 A;  3IE0 A;  3IE1 A;  2OHH A;  1ZTC A;  4Z6X A;  3PG4 A;  5HIS A;  4PVT A;  5ACW A;  2ZNB A;  5LMC A;  4GCW A;  3DHC A;  4UA4 A;  4HL1 A;  1SML A;  1P9E A;  2QJS A;  5LE1 A;  4RAM A;  5AYA A;  4AWY B;  4KEP A;  2ZO4 A;  2WYM A;  2GKL A;  5AXO A;  4ZNB A;  4B87 A;  4RL0 A;  5EHT A;  4RM5 A;  1K07 A;  2NYP A;  5EH9 A;  2DOO A;  2YNT B;  5ACT A;  1WW1 A;  4C1D A;  4TZF A;  3ZQ4 A;  4P62 A;  2BTN A;  4D1W A;  3I14 A;  4UBQ A;  2OHJ A;  4UWR B;  2Q0J A;  4XWW A;  2AIO A;  2UYX A;  3ADR A;  1JJE A;  4NQ6 A;  1M2X A;  3PY6 A;  4ZO2 A;  2BG2 A;  3Q6V A;  5EVD A;  2A7M A;  2BG8 A;  1KR3 A;  1DXK A;  2CBN A;  4HKY A;  2FHX B;  3FAI A;  4EYB A;  2H6A A;  4C1G A;  2QED A;  1L9Y A;  4PVO A;  5HH6 A;  2WHG A;  3I13 A;  5EV6 A;  4YSL A;  4D02 A;  2HB9 A;  3SPU A;  5LLD A;  5ACP A;  5AEB A;  2Q0I A;  1Y44 A;  3MD7 A;  5HIO A;  2P97 A;  1JT1 A;  1X8I A;  5DPX A;  4DIL A;  2I7V A;  3AF6 A;  1YCG A;  1XM8 A;  3BK2 A;  3ESH A;  5EWA A;  3L6N A;  3X2X A;  3WXC A;  4V0H A;  3BK1 A;  4ZO3 A;  2XR1 A;  1HLK A;  3DHA A;  4EYL A;  4UWS B;  3G1P A;  4D1T A;  1X8H A;  3BC2 A;  2AZ4 A;  5A0T A;  1VJN A;  4WD6 A;  1VME A;  3IE2 A;  4UWO B;  3ZNB A;  5K0W A;  2BG8 B;  5EVK A;  5HIP A;  4AWZ A;  4DIK A;  4RBS A;  2QDT A;  4RAW A;  3KNS A;  4C09 A;  3AF5 A;  2FM6 A;  2FU7 A;  1YCH A;  2Y8A A;  3A4Y A;  1VGN A;  3IOG A;  2M5D A;  2BR6 A;  5ACS A;  4EXY A;  2GMN A;  2GCU A;  2BFK A;  2BMI A;  2FK6 A;  2NZF A;  2BC2 A;  3F9O A;  1WUO A;  5FQC A;  2OHI A;  2Y87 A;  5HH4 A;  3FCZ A;  4Z5Y A;  4FEK A;  4NQ4 A;  4UAM A;  4BZ3 A;  3RKK A;  2BFL A;  4TZE A;  1YCF A;  3JXP A;  2DKF A;  1DD6 A;  2GFK A;  4EXS A;  4YSB A;  4H0D A;  3DH8 A;  5LCA A;  3SFP A;  1BVT A;  1ZKP A;  4Z67 A;  1ZNB A;  4AX1 B;  3KNR A;  2YNT A;  1KO2 A;  5FQB A;  2Q42 A;  3H3E A;  3IEK A;  3KL7 A;  5A87 A;  3I15 A;  4TZ9 A;  2P1E A;  5LS3 A;  4TZB A;  5ACU A;  2BG6 A;  4CHL A;  3I0V A;  4GYU A;  4EYF A;  4D1V A;  1WRA A;  4U4L A;  4FSB A;  1MQO A;  3AJ3 A;  5LCH A;  2ZWR A;  4XWT A;  2YNU A;  2BFZ B;  3X2Z A;  1A7T A;  4JO0 A;  5B3R A;  2GFJ A;  2WYM C;  4FR7 A;  4TYF A;  4GYQ A;  3SBL A;  2FU8 A;  4NQ2 A;  3PY5 A;  1BC2 A;  4AD9 A;  3IOF A;  5KIK A;  2XF4 A;  5FQA A;  4Z7R A;  3T9M A;  2YNV B;  4O98 A;  1A8T A;  5ACQ A;  2I7X A;  5ACR A;  3VPE A;  4ZEJ A;  4F6Z A;  4D1U A;  2P4Z A;  4TYT A;  4UWP B;  3VQZ A;  2VW8 A;  5AHR A;  2FU9 A;  3BV6 A;  4HL2 A;  3I11 A;  5AHO A;  5B1U A;  5KIL A;  2BGA A;  5LM6 A;  3LVZ A;  3QH8 A;  3R2U A;  2Y8B A;  1JJT A;  3T3N A;  5EV8 A;  3SW3 A;  2Q9U A;  3RKJ A;  3T3O A;  1QH5 A;  2BIB A;  5K4M A;  2ZZI A;  2QDS A;  4RL2 A;  3IEM A;  5B15 A;  5EVB A;  2BFZ A;  4Z60 A;  2P18 A;  3SRX A;  4AX0 B;  3X30 A;  4Z5Z A;  4YSK A;  4C1C A;  4NQ5 A;  2WRS A;  3IDZ A;  2R2D A;  4F6H A;  4J5H A;  2YNV A;  5LCF A;  1WUP A;  2M5C A;  1X8G A;  3SD9 A;  3X2Y A;  4EY2 A;  1BMC A;  4EFZ A;  1XTO A;  3S0Z A;  2E7Y A;  5IQK A;  4C1H A;  5K4K A;  2BG7 A;  2WYL A;  5EW0 A;  4C1E A;  2YCB A;  3ZR9 A;  5LSC A;  4XUK A;  2NZE A;  5HH5 A;  3P2U A;  5A5Z A;  1KO3 A;  5A0V A;  5HIQ A;  5ACX A;  2YZ3 A;  1E5D A;  4BP0 A;  1DDK A;  5K4N A;  1QH3 A;  2I7T A;  5AXR A;  3RPC A;  2NXA A;  2QIN A;  4KEQ A;  4C1F A;  3IEL A;  3ZWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...