3PY6A

Crystal structure of a beta-lactamase-like protein from brucella melitensis bound to gmp
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
270
structure length
270
Chain Sequence
SPRNCLRFTLLGCGSSPGVPRINGDWGKCDPKNPKNRRRRASLLVERYDAEGNNTVVVIDTGPDFRMQMIDSGVHMLDAAVYTHPHADHIHGIDDLRTYVVDNGRLMDVYANRLTRNRLYDTFGYCFETPVGSSYPPILSMHDIAPETPFSIEGAGGAIRFEPFSQVHGDIESLGFRIGSVVYCTDVSAFPEQSLQYIKDADVLIIGALQYRPHPSHFSLGEALEWIEKLSPKRAILTHMHVPLDYETVMRETPHHVEPGYDGLRFEVAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Beta-Lactamase-Like Protein from Brucella Melitensis bound to GMP
pubmed doi rcsb
source organism Brucella melitensis biovar abortus 2308
molecule tags Hydrolase
molecule keywords Beta-lactamase-like
total genus 82
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2010-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3py6A00
3DHCA 5EVKA 2GFKA 3SD9A 5A0VA 3AF6A 1DDKA 1KO2A 4EFZA 3VPEA 2BGAA 4ZO3A 5FQAA 5LCAA 3AJ3A 2BMIA 5HIQA 1YCFA 2OHHA 4UWPB 5AXOA 3S0ZA 4TZFA 4XUKA 5B1UA 4YSLA 4YSKA 3PG4A 2WYMA 4AD9A 2P1EA 3G1PA 2Q42A 1BMCA 2OHJA 2Q0IA 2YNTA 3ZNBA 4D02A 2H6AA 2A7MA 5LLDA 3Q6VA 1VMEA 3X2YA 2UYXA 3IEMA 1VGNA 3P2UA 4C1DA 2BG8A 2FU8A 3PY6A 5AHRA 5KIKA 3SPUA 1ZTCA 5K4NA 2XR1A 4UA4A 2BG2A 3I11A 5HIOA 2BG7A 2BFZA 5B3RA 4PVOA 5DPXA 5AYAA 2NXAA 3X2XA 3T3OA 4EXYA 2HB9A 4JO0A 3VQZA 3I15A 2CBNA 2Q0JA 4HKYA 4EYFA 2QDTA 2FM6A 1JT1A 3IELA 4FR7A 5EVDA 3WXCA 4J5FA 2BIBA 2QINA 4PVTA 4YSBA 4KEQA 1ZNBA 4B87A 2FU9A 1WUPA 3ADRA 3ZQ4A 4NQ4A 2GCUA 2QEDA 3RKJA 4TYTA 5FQBA 3PY5A 4AWZA 1WUOA 2E7YA 4P62A 1JJTA 4GCWA 2M5CA 2BFKA 1HLKA 5K4KA 3X2ZA 4D1VA 5HH6A 2Q9UA 5HIPA 1DD6A 3IEKA 3DHAA 1YCHA 4Z6XA 2I7XA 1X8IA 5A5ZA 5AHOA 2WRSA 1WRAA 1KR3A 4HL2A 3IE1A 4BP0A 2QDSA 2FHXB 4C1EA 5EVBA 4UBQA 4LE6A 3AF5A 4AX0B 3LVZA 2QJSA 1M2XA 5ACQA 5EW0A 5ACVA 4TZEA 3QH8A 4U4LA 1QH3A 3I0VA 3A4YA 4Z5YA 3IE2A 5EWAA 4AX1B 3FCZA 4KEPA 4O98A 4GYUA 2NYPA 2AIOA 3H3EA 4XWWA 1ZKPA 4UWRB 4C1CA 3I14A 4C09A 5KILA 1BC2A 3RKKA 4NQ5A 2FHXA 2WYLA 4RBSA 5FQCA 2BG6A 4Z60A 3IOFA 4CHLA 1MQOA 4Z67A 5ACSA 4AWYB 4C1FA 5A87A 2Y8BA 5LMCA 2WYMC 1A7TA 5LM6A 1X8GA 2BG8B 5EV8A 3SBLA 1VJNA 4EY2A 4J5HA 2YZ3A 2DOOA 2BR6A 4ZEJA 1SMLA 3BK1A 3F9OA 2AZ4A 3ZR9A 5HISA 2FU7A 3DH8A 5AEBA 2XF4A 2I7TA 3I13A 3R2UA 4D1UA 1QH5A 3DHBA 1Y44A 3IDZA 3ZWFA 2I7VA 5ACXA 2YNUA 3L6NA 1XTOA 3BC2A 5EV6A 3X30A 2YNWA 2GKLA 5LS3A 4EYBA 5K0WA 1KO3A 5ACUA 3KL7A 4DILA 1YCGA 5AXRA 5ACWA 4EXSA 4HL1A 4D1WA 2P18A 4FSBA 1JJEA 1X8HA 2BC2A 5B15A 4Z7RA 5IQKA 3BV6A 5HH5A 2NZFA 3SRXA 4UWOB 2BTNA 2YNTB 1P9EA 4EYLA 4D1TA 4NQ2A 2BFZB 1K07A 2ZO4A 2ZZIA 4BZ3A 4XWTA 4TZ9A 2YNVA 2DKFA 2FK6A 4UWSB 5ACRA 5K4MA 4ZNBA 4RAWA 3T9MA 4H0DA 2YCBA 4ZO2A 5EHTA 2P97A 2Y8AA 3RPCA 5LCFA 5A0TA 4WD6A 2BFLA 4RL0A 4C1GA 4Z5ZA 2M5DA 4RL2A 4UAMA 4V0HA 3TP9A 5ACPA 5LCHA 3KNRA 2NZEA 2P4ZA 3FAIA 4FEKA 1DXKA 3MD7A 5LE1A 5ACTA 2WHGA 3IE0A 2Y87A 2R2DA 3JXPA 4RAMA 4RM5A 4GYQA 1XM8A 1BVTA 2GFJA 2VW8A 3SFPA 3KNSA 4C1HA 1L9YA 2YNVB 4F6HA 3T3NA 5EH9A 3SW3A 1WW1A 1A8TA 3IOGA 2OHIA 5HH4A 2FU6A 2GMNA 3ESHA 4F6ZA 4DIKA 4NQ6A 3BK2A 4TYFA 4TZBA 2ZNBA 2ZWRA 1E5DA 5LSCA
chains in the Genus database with same CATH superfamily
3DHCA 5EVKA 2GFKA 3SD9A 5A0VA 3AF6A 1DDKA 1KO2A 4EFZA 3VPEA 2BGAA 4ZO3A 5FQAA 5LCAA 3AJ3A 2BMIA 5HIQA 1YCFA 2OHHA 4UWPB 5AXOA 3S0ZA 4TZFA 4XUKA 5B1UA 4YSLA 4YSKA 3PG4A 2WYMA 4AD9A 2P1EA 3G1PA 2Q42A 1BMCA 2OHJA 2Q0IA 2YNTA 3ZNBA 4D02A 2H6AA 2A7MA 5LLDA 3Q6VA 1VMEA 3X2YA 2UYXA 3IEMA 1VGNA 3P2UA 4C1DA 2BG8A 2FU8A 3PY6A 5AHRA 5KIKA 3SPUA 1ZTCA 5K4NA 2XR1A 4UA4A 2BG2A 3I11A 5HIOA 2BG7A 2BFZA 5B3RA 4PVOA 5DPXA 5AYAA 2NXAA 3X2XA 3T3OA 4EXYA 2HB9A 4JO0A 3VQZA 3I15A 2CBNA 2Q0JA 4HKYA 4EYFA 2QDTA 2FM6A 1JT1A 3IELA 4FR7A 5EVDA 3WXCA 4J5FA 2BIBA 2QINA 4PVTA 4YSBA 4KEQA 1ZNBA 4B87A 2FU9A 4AXHA 1WUPA 3ADRA 3ZQ4A 4NQ4A 2GCUA 2QEDA 2CFUA 3RKJA 4TYTA 5FQBA 3PY5A 4AWZA 1WUOA 2E7YA 4P62A 1JJTA 4GCWA 2M5CA 2BFKA 1HLKA 5K4KA 3X2ZA 4D1VA 5HH6A 2Q9UA 5HIPA 1DD6A 3IEKA 3DHAA 1YCHA 4Z6XA 2I7XA 1X8IA 5A5ZA 5AHOA 2WRSA 1WRAA 1KR3A 4HL2A 3IE1A 4BP0A 2QDSA 2FHXB 4C1EA 5EVBA 4UBQA 4LE6A 3AF5A 4AX0B 3LVZA 2QJSA 1M2XA 5ACQA 5EW0A 4PDXA 5ACVA 4TZEA 3QH8A 4U4LA 1QH3A 3I0VA 3A4YA 4Z5YA 3IE2A 5EWAA 4AX1B 3FCZA 4KEPA 4O98A 4GYUA 2NYPA 2YHEA 2AIOA 3H3EA 4XWWA 1ZKPA 4UWRB 4C1CA 3I14A 4C09A 5KILA 1BC2A 3RKKA 5A23A 4NQ5A 2FHXA 2WYLA 4RBSA 5FQCA 2BG6A 4Z60A 3IOFA 4CHLA 1MQOA 4Z67A 5AIJA 5ACSA 4AWYB 4C1FA 5A87A 2Y8BA 5LMCA 2WYMC 1A7TA 5LM6A 1X8GA 2BG8B 5EV8A 2CG3A 3SBLA 1VJNA 4EY2A 4J5HA 2YZ3A 2DOOA 2BR6A 4ZEJA 1SMLA 3BK1A 3F9OA 2AZ4A 3ZR9A 5HISA 2FU7A 3DH8A 5AEBA 2XF4A 2I7TA 3I13A 3R2UA 4D1UA 1QH5A 3DHBA 1Y44A 3IDZA 3ZWFA 2I7VA 5ACXA 2YNUA 3L6NA 1XTOA 3BC2A 5EV6A 3X30A 2YNWA 2GKLA 2CG2A 5LS3A 4EYBA 5AJLA 5K0WA 1KO3A 5ACUA 3KL7A 4DILA 1YCGA 5AXRA 5ACWA 4EXSA 4HL1A 4D1WA 2P18A 4FSBA 1JJEA 1X8HA 2BC2A 5B15A 4Z7RA 5IQKA 3BV6A 5HH5A 4AV7A 2NZFA 3SRXA 4UWOB 2BTNA 2YNTB 1P9EA 4EYLA 4D1TA 4NQ2A 2BFZB 1K07A 2ZO4A 2ZZIA 4BZ3A 4XWTA 4TZ9A 2YNVA 2DKFA 2FK6A 4UWSB 5ACRA 5K4MA 4ZNBA 4RAWA 4NURA 3T9MA 4H0DA 2YCBA 4ZO2A 5EHTA 2P97A 2Y8AA 3RPCA 5LCFA 5A0TA 4WD6A 2BFLA 4RL0A 4C1GA 4Z5ZA 2M5DA 4RL2A 4UAMA 4V0HA 3TP9A 5ACPA 5LCHA 3KNRA 2NZEA 2P4ZA 3FAIA 4FEKA 1DXKA 3MD7A 5LE1A 5ACTA 2CFZA 2WHGA 3IE0A 2Y87A 2R2DA 3JXPA 4RAMA 4RM5A 4GYQA 1XM8A 1BVTA 2GFJA 2VW8A 3SFPA 3KNSA 4C1HA 1L9YA 2YNVB 4F6HA 3T3NA 5EH9A 3SW3A 1WW1A 1A8TA 3IOGA 2OHIA 5HH4A 2FU6A 2GMNA 3ESHA 4F6ZA 4DIKA 4NQ6A 3BK2A 4TYFA 4TZBA 2ZNBA 2ZWRA 1E5DA 5LSCA
chains in the Genus database with same CATH topology
3DHCA 5EVKA 2GFKA 3SD9A 5A0VA 3AF6A 1DDKA 1KO2A 4EFZA 3VPEA 2BGAA 4ZO3A 5FQAA 5LCAA 3AJ3A 2BMIA 5HIQA 1YCFA 2OHHA 4UWPB 5AXOA 3S0ZA 4TZFA 4XUKA 5B1UA 4YSLA 4YSKA 3PG4A 2WYMA 4AD9A 2P1EA 3G1PA 2Q42A 1BMCA 2OHJA 2Q0IA 2YNTA 3ZNBA 4D02A 2H6AA 2A7MA 5LLDA 3Q6VA 1VMEA 3X2YA 2UYXA 3IEMA 1VGNA 3P2UA 4C1DA 2BG8A 2FU8A 3PY6A 5AHRA 5KIKA 3SPUA 1ZTCA 5K4NA 2XR1A 4UA4A 2BG2A 3I11A 5HIOA 2BG7A 2BFZA 5B3RA 4PVOA 5DPXA 5AYAA 2NXAA 3X2XA 3T3OA 4EXYA 2HB9A 4JO0A 3VQZA 3I15A 2CBNA 2Q0JA 4HKYA 4EYFA 2QDTA 2FM6A 1JT1A 3IELA 4FR7A 5EVDA 3WXCA 4J5FA 2BIBA 2QINA 4PVTA 4YSBA 4KEQA 1ZNBA 4B87A 2FU9A 1WUPA 3ADRA 3ZQ4A 4NQ4A 2GCUA 2QEDA 3RKJA 4TYTA 5FQBA 3PY5A 4AWZA 1WUOA 2E7YA 4P62A 1JJTA 4GCWA 2M5CA 2BFKA 1HLKA 5K4KA 3X2ZA 4D1VA 5HH6A 2Q9UA 5HIPA 1DD6A 3IEKA 3DHAA 1YCHA 4Z6XA 2I7XA 1X8IA 5A5ZA 5AHOA 2WRSA 1WRAA 1KR3A 4HL2A 3IE1A 4BP0A 2QDSA 2FHXB 4C1EA 5EVBA 4UBQA 4LE6A 3AF5A 4AX0B 3LVZA 2QJSA 1M2XA 5ACQA 5EW0A 5ACVA 4TZEA 3QH8A 4U4LA 1QH3A 3I0VA 3A4YA 4Z5YA 3IE2A 5EWAA 4AX1B 3FCZA 4KEPA 4O98A 4GYUA 2NYPA 2AIOA 3H3EA 4XWWA 1ZKPA 4UWRB 4C1CA 3I14A 4C09A 5KILA 1BC2A 3RKKA 4NQ5A 2FHXA 2WYLA 4RBSA 5FQCA 2BG6A 4Z60A 3IOFA 4CHLA 1MQOA 4Z67A 5ACSA 4AWYB 4C1FA 5A87A 2Y8BA 5LMCA 2WYMC 1A7TA 5LM6A 1X8GA 2BG8B 5EV8A 3SBLA 1VJNA 4EY2A 4J5HA 2YZ3A 2DOOA 2BR6A 4ZEJA 1SMLA 3BK1A 3F9OA 2AZ4A 3ZR9A 5HISA 2FU7A 3DH8A 5AEBA 2XF4A 2I7TA 3I13A 3R2UA 4D1UA 1QH5A 3DHBA 1Y44A 3IDZA 3ZWFA 2I7VA 5ACXA 2YNUA 3L6NA 1XTOA 3BC2A 5EV6A 3X30A 2YNWA 2GKLA 5LS3A 4EYBA 5K0WA 1KO3A 5ACUA 3KL7A 4DILA 1YCGA 5AXRA 5ACWA 4EXSA 4HL1A 4D1WA 2P18A 4FSBA 1JJEA 1X8HA 2BC2A 5B15A 4Z7RA 5IQKA 3BV6A 5HH5A 2NZFA 3SRXA 4UWOB 2BTNA 2YNTB 1P9EA 4EYLA 4D1TA 4NQ2A 2BFZB 1K07A 2ZO4A 2ZZIA 4BZ3A 4XWTA 4TZ9A 2YNVA 2DKFA 2FK6A 4UWSB 5ACRA 5K4MA 4ZNBA 4RAWA 3T9MA 4H0DA 2YCBA 4ZO2A 5EHTA 2P97A 2Y8AA 3RPCA 5LCFA 5A0TA 4WD6A 2BFLA 4RL0A 4C1GA 4Z5ZA 2M5DA 4RL2A 4UAMA 4V0HA 3TP9A 5ACPA 5LCHA 3KNRA 2NZEA 2P4ZA 3FAIA 4FEKA 1DXKA 3MD7A 5LE1A 5ACTA 2WHGA 3IE0A 2Y87A 2R2DA 3JXPA 4RAMA 4RM5A 4GYQA 1XM8A 1BVTA 2GFJA 2VW8A 3SFPA 3KNSA 4C1HA 1L9YA 2YNVB 4F6HA 3T3NA 5EH9A 3SW3A 1WW1A 1A8TA 3IOGA 2OHIA 5HH4A 2FU6A 2GMNA 3ESHA 4F6ZA 4DIKA 4NQ6A 3BK2A 4TYFA 4TZBA 2ZNBA 2ZWRA 1E5DA 5LSCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DHC A;  5EVK A;  2GFK A;  3SD9 A;  5A0V A;  3AF6 A;  1DDK A;  1KO2 A;  4EFZ A;  3VPE A;  2BGA A;  4ZO3 A;  5FQA A;  5LCA A;  3AJ3 A;  2BMI A;  5HIQ A;  1YCF A;  2OHH A;  4UWP B;  5AXO A;  3S0Z A;  4TZF A;  4XUK A;  5B1U A;  4YSL A;  4YSK A;  3PG4 A;  2WYM A;  4AD9 A;  2P1E A;  3G1P A;  2Q42 A;  1BMC A;  2OHJ A;  2Q0I A;  2YNT A;  3ZNB A;  4D02 A;  2H6A A;  2A7M A;  5LLD A;  3Q6V A;  1VME A;  3X2Y A;  2UYX A;  3IEM A;  1VGN A;  3P2U A;  4C1D A;  2BG8 A;  2FU8 A;  3PY6 A;  5AHR A;  5KIK A;  3SPU A;  1ZTC A;  5K4N A;  2XR1 A;  4UA4 A;  2BG2 A;  3I11 A;  5HIO A;  2BG7 A;  2BFZ A;  5B3R A;  4PVO A;  5DPX A;  5AYA A;  2NXA A;  3X2X A;  3T3O A;  4EXY A;  2HB9 A;  4JO0 A;  3VQZ A;  3I15 A;  2CBN A;  2Q0J A;  4HKY A;  4EYF A;  2QDT A;  2FM6 A;  1JT1 A;  3IEL A;  4FR7 A;  5EVD A;  3WXC A;  4J5F A;  2BIB A;  2QIN A;  4PVT A;  4YSB A;  4KEQ A;  1ZNB A;  4B87 A;  2FU9 A;  1WUP A;  3ADR A;  3ZQ4 A;  4NQ4 A;  2GCU A;  2QED A;  3RKJ A;  4TYT A;  5FQB A;  3PY5 A;  4AWZ A;  1WUO A;  2E7Y A;  4P62 A;  1JJT A;  4GCW A;  2M5C A;  2BFK A;  1HLK A;  5K4K A;  3X2Z A;  4D1V A;  5HH6 A;  2Q9U A;  5HIP A;  1DD6 A;  3IEK A;  3DHA A;  1YCH A;  4Z6X A;  2I7X A;  1X8I A;  5A5Z A;  5AHO A;  2WRS A;  1WRA A;  1KR3 A;  4HL2 A;  3IE1 A;  4BP0 A;  2QDS A;  2FHX B;  4C1E A;  5EVB A;  4UBQ A;  4LE6 A;  3AF5 A;  4AX0 B;  3LVZ A;  2QJS A;  1M2X A;  5ACQ A;  5EW0 A;  5ACV A;  4TZE A;  3QH8 A;  4U4L A;  1QH3 A;  3I0V A;  3A4Y A;  4Z5Y A;  3IE2 A;  5EWA A;  4AX1 B;  3FCZ A;  4KEP A;  4O98 A;  4GYU A;  2NYP A;  2AIO A;  3H3E A;  4XWW A;  1ZKP A;  4UWR B;  4C1C A;  3I14 A;  4C09 A;  5KIL A;  1BC2 A;  3RKK A;  4NQ5 A;  2FHX A;  2WYL A;  4RBS A;  5FQC A;  2BG6 A;  4Z60 A;  3IOF A;  4CHL A;  1MQO A;  4Z67 A;  5ACS A;  4AWY B;  4C1F A;  5A87 A;  2Y8B A;  5LMC A;  2WYM C;  1A7T A;  5LM6 A;  1X8G A;  2BG8 B;  5EV8 A;  3SBL A;  1VJN A;  4EY2 A;  4J5H A;  2YZ3 A;  2DOO A;  2BR6 A;  4ZEJ A;  1SML A;  3BK1 A;  3F9O A;  2AZ4 A;  3ZR9 A;  5HIS A;  2FU7 A;  3DH8 A;  5AEB A;  2XF4 A;  2I7T A;  3I13 A;  3R2U A;  4D1U A;  1QH5 A;  3DHB A;  1Y44 A;  3IDZ A;  3ZWF A;  2I7V A;  5ACX A;  2YNU A;  3L6N A;  1XTO A;  3BC2 A;  5EV6 A;  3X30 A;  2YNW A;  2GKL A;  5LS3 A;  4EYB A;  5K0W A;  1KO3 A;  5ACU A;  3KL7 A;  4DIL A;  1YCG A;  5AXR A;  5ACW A;  4EXS A;  4HL1 A;  4D1W A;  2P18 A;  4FSB A;  1JJE A;  1X8H A;  2BC2 A;  5B15 A;  4Z7R A;  5IQK A;  3BV6 A;  5HH5 A;  2NZF A;  3SRX A;  4UWO B;  2BTN A;  2YNT B;  1P9E A;  4EYL A;  4D1T A;  4NQ2 A;  2BFZ B;  1K07 A;  2ZO4 A;  2ZZI A;  4BZ3 A;  4XWT A;  4TZ9 A;  2YNV A;  2DKF A;  2FK6 A;  4UWS B;  5ACR A;  5K4M A;  4ZNB A;  4RAW A;  3T9M A;  4H0D A;  2YCB A;  4ZO2 A;  5EHT A;  2P97 A;  2Y8A A;  3RPC A;  5LCF A;  5A0T A;  4WD6 A;  2BFL A;  4RL0 A;  4C1G A;  4Z5Z A;  2M5D A;  4RL2 A;  4UAM A;  4V0H A;  3TP9 A;  5ACP A;  5LCH A;  3KNR A;  2NZE A;  2P4Z A;  3FAI A;  4FEK A;  1DXK A;  3MD7 A;  5LE1 A;  5ACT A;  2WHG A;  3IE0 A;  2Y87 A;  2R2D A;  3JXP A;  4RAM A;  4RM5 A;  4GYQ A;  1XM8 A;  1BVT A;  2GFJ A;  2VW8 A;  3SFP A;  3KNS A;  4C1H A;  1L9Y A;  2YNV B;  4F6H A;  3T3N A;  5EH9 A;  3SW3 A;  1WW1 A;  1A8T A;  3IOG A;  2OHI A;  5HH4 A;  2FU6 A;  2GMN A;  3ESH A;  4F6Z A;  4DIK A;  4NQ6 A;  3BK2 A;  4TYF A;  4TZB A;  2ZNB A;  2ZWR A;  1E5D A;  5LSC A; 
#chains in the Genus database with same CATH topology
 3DHC A;  5EVK A;  2GFK A;  3SD9 A;  5A0V A;  3AF6 A;  1DDK A;  1KO2 A;  4EFZ A;  3VPE A;  2BGA A;  4ZO3 A;  5FQA A;  5LCA A;  3AJ3 A;  2BMI A;  5HIQ A;  1YCF A;  2OHH A;  4UWP B;  5AXO A;  3S0Z A;  4TZF A;  4XUK A;  5B1U A;  4YSL A;  4YSK A;  3PG4 A;  2WYM A;  4AD9 A;  2P1E A;  3G1P A;  2Q42 A;  1BMC A;  2OHJ A;  2Q0I A;  2YNT A;  3ZNB A;  4D02 A;  2H6A A;  2A7M A;  5LLD A;  3Q6V A;  1VME A;  3X2Y A;  2UYX A;  3IEM A;  1VGN A;  3P2U A;  4C1D A;  2BG8 A;  2FU8 A;  3PY6 A;  5AHR A;  5KIK A;  3SPU A;  1ZTC A;  5K4N A;  2XR1 A;  4UA4 A;  2BG2 A;  3I11 A;  5HIO A;  2BG7 A;  2BFZ A;  5B3R A;  4PVO A;  5DPX A;  5AYA A;  2NXA A;  3X2X A;  3T3O A;  4EXY A;  2HB9 A;  4JO0 A;  3VQZ A;  3I15 A;  2CBN A;  2Q0J A;  4HKY A;  4EYF A;  2QDT A;  2FM6 A;  1JT1 A;  3IEL A;  4FR7 A;  5EVD A;  3WXC A;  4J5F A;  2BIB A;  2QIN A;  4PVT A;  4YSB A;  4KEQ A;  1ZNB A;  4B87 A;  2FU9 A;  4AXH A;  1WUP A;  3ADR A;  3ZQ4 A;  4NQ4 A;  2GCU A;  2QED A;  2CFU A;  3RKJ A;  4TYT A;  5FQB A;  3PY5 A;  4AWZ A;  1WUO A;  2E7Y A;  4P62 A;  1JJT A;  4GCW A;  2M5C A;  2BFK A;  1HLK A;  5K4K A;  3X2Z A;  4D1V A;  5HH6 A;  2Q9U A;  5HIP A;  1DD6 A;  3IEK A;  3DHA A;  1YCH A;  4Z6X A;  2I7X A;  1X8I A;  5A5Z A;  5AHO A;  2WRS A;  1WRA A;  1KR3 A;  4HL2 A;  3IE1 A;  4BP0 A;  2QDS A;  2FHX B;  4C1E A;  5EVB A;  4UBQ A;  4LE6 A;  3AF5 A;  4AX0 B;  3LVZ A;  2QJS A;  1M2X A;  5ACQ A;  5EW0 A;  4PDX A;  5ACV A;  4TZE A;  3QH8 A;  4U4L A;  1QH3 A;  3I0V A;  3A4Y A;  4Z5Y A;  3IE2 A;  5EWA A;  4AX1 B;  3FCZ A;  4KEP A;  4O98 A;  4GYU A;  2NYP A;  2YHE A;  2AIO A;  3H3E A;  4XWW A;  1ZKP A;  4UWR B;  4C1C A;  3I14 A;  4C09 A;  5KIL A;  1BC2 A;  3RKK A;  5A23 A;  4NQ5 A;  2FHX A;  2WYL A;  4RBS A;  5FQC A;  2BG6 A;  4Z60 A;  3IOF A;  4CHL A;  1MQO A;  4Z67 A;  5AIJ A;  5ACS A;  4AWY B;  4C1F A;  5A87 A;  2Y8B A;  5LMC A;  2WYM C;  1A7T A;  5LM6 A;  1X8G A;  2BG8 B;  5EV8 A;  2CG3 A;  3SBL A;  1VJN A;  4EY2 A;  4J5H A;  2YZ3 A;  2DOO A;  2BR6 A;  4ZEJ A;  1SML A;  3BK1 A;  3F9O A;  2AZ4 A;  3ZR9 A;  5HIS A;  2FU7 A;  3DH8 A;  5AEB A;  2XF4 A;  2I7T A;  3I13 A;  3R2U A;  4D1U A;  1QH5 A;  3DHB A;  1Y44 A;  3IDZ A;  3ZWF A;  2I7V A;  5ACX A;  2YNU A;  3L6N A;  1XTO A;  3BC2 A;  5EV6 A;  3X30 A;  2YNW A;  2GKL A;  2CG2 A;  5LS3 A;  4EYB A;  5AJL A;  5K0W A;  1KO3 A;  5ACU A;  3KL7 A;  4DIL A;  1YCG A;  5AXR A;  5ACW A;  4EXS A;  4HL1 A;  4D1W A;  2P18 A;  4FSB A;  1JJE A;  1X8H A;  2BC2 A;  5B15 A;  4Z7R A;  5IQK A;  3BV6 A;  5HH5 A;  4AV7 A;  2NZF A;  3SRX A;  4UWO B;  2BTN A;  2YNT B;  1P9E A;  4EYL A;  4D1T A;  4NQ2 A;  2BFZ B;  1K07 A;  2ZO4 A;  2ZZI A;  4BZ3 A;  4XWT A;  4TZ9 A;  2YNV A;  2DKF A;  2FK6 A;  4UWS B;  5ACR A;  5K4M A;  4ZNB A;  4RAW A;  4NUR A;  3T9M A;  4H0D A;  2YCB A;  4ZO2 A;  5EHT A;  2P97 A;  2Y8A A;  3RPC A;  5LCF A;  5A0T A;  4WD6 A;  2BFL A;  4RL0 A;  4C1G A;  4Z5Z A;  2M5D A;  4RL2 A;  4UAM A;  4V0H A;  3TP9 A;  5ACP A;  5LCH A;  3KNR A;  2NZE A;  2P4Z A;  3FAI A;  4FEK A;  1DXK A;  3MD7 A;  5LE1 A;  5ACT A;  2CFZ A;  2WHG A;  3IE0 A;  2Y87 A;  2R2D A;  3JXP A;  4RAM A;  4RM5 A;  4GYQ A;  1XM8 A;  1BVT A;  2GFJ A;  2VW8 A;  3SFP A;  3KNS A;  4C1H A;  1L9Y A;  2YNV B;  4F6H A;  3T3N A;  5EH9 A;  3SW3 A;  1WW1 A;  1A8T A;  3IOG A;  2OHI A;  5HH4 A;  2FU6 A;  2GMN A;  3ESH A;  4F6Z A;  4DIK A;  4NQ6 A;  3BK2 A;  4TYF A;  4TZB A;  2ZNB A;  2ZWR A;  1E5D A;  5LSC A; 
#chains in the Genus database with same CATH homology
 3DHC A;  5EVK A;  2GFK A;  3SD9 A;  5A0V A;  3AF6 A;  1DDK A;  1KO2 A;  4EFZ A;  3VPE A;  2BGA A;  4ZO3 A;  5FQA A;  5LCA A;  3AJ3 A;  2BMI A;  5HIQ A;  1YCF A;  2OHH A;  4UWP B;  5AXO A;  3S0Z A;  4TZF A;  4XUK A;  5B1U A;  4YSL A;  4YSK A;  3PG4 A;  2WYM A;  4AD9 A;  2P1E A;  3G1P A;  2Q42 A;  1BMC A;  2OHJ A;  2Q0I A;  2YNT A;  3ZNB A;  4D02 A;  2H6A A;  2A7M A;  5LLD A;  3Q6V A;  1VME A;  3X2Y A;  2UYX A;  3IEM A;  1VGN A;  3P2U A;  4C1D A;  2BG8 A;  2FU8 A;  3PY6 A;  5AHR A;  5KIK A;  3SPU A;  1ZTC A;  5K4N A;  2XR1 A;  4UA4 A;  2BG2 A;  3I11 A;  5HIO A;  2BG7 A;  2BFZ A;  5B3R A;  4PVO A;  5DPX A;  5AYA A;  2NXA A;  3X2X A;  3T3O A;  4EXY A;  2HB9 A;  4JO0 A;  3VQZ A;  3I15 A;  2CBN A;  2Q0J A;  4HKY A;  4EYF A;  2QDT A;  2FM6 A;  1JT1 A;  3IEL A;  4FR7 A;  5EVD A;  3WXC A;  4J5F A;  2BIB A;  2QIN A;  4PVT A;  4YSB A;  4KEQ A;  1ZNB A;  4B87 A;  2FU9 A;  1WUP A;  3ADR A;  3ZQ4 A;  4NQ4 A;  2GCU A;  2QED A;  3RKJ A;  4TYT A;  5FQB A;  3PY5 A;  4AWZ A;  1WUO A;  2E7Y A;  4P62 A;  1JJT A;  4GCW A;  2M5C A;  2BFK A;  1HLK A;  5K4K A;  3X2Z A;  4D1V A;  5HH6 A;  2Q9U A;  5HIP A;  1DD6 A;  3IEK A;  3DHA A;  1YCH A;  4Z6X A;  2I7X A;  1X8I A;  5A5Z A;  5AHO A;  2WRS A;  1WRA A;  1KR3 A;  4HL2 A;  3IE1 A;  4BP0 A;  2QDS A;  2FHX B;  4C1E A;  5EVB A;  4UBQ A;  4LE6 A;  3AF5 A;  4AX0 B;  3LVZ A;  2QJS A;  1M2X A;  5ACQ A;  5EW0 A;  5ACV A;  4TZE A;  3QH8 A;  4U4L A;  1QH3 A;  3I0V A;  3A4Y A;  4Z5Y A;  3IE2 A;  5EWA A;  4AX1 B;  3FCZ A;  4KEP A;  4O98 A;  4GYU A;  2NYP A;  2AIO A;  3H3E A;  4XWW A;  1ZKP A;  4UWR B;  4C1C A;  3I14 A;  4C09 A;  5KIL A;  1BC2 A;  3RKK A;  4NQ5 A;  2FHX A;  2WYL A;  4RBS A;  5FQC A;  2BG6 A;  4Z60 A;  3IOF A;  4CHL A;  1MQO A;  4Z67 A;  5ACS A;  4AWY B;  4C1F A;  5A87 A;  2Y8B A;  5LMC A;  2WYM C;  1A7T A;  5LM6 A;  1X8G A;  2BG8 B;  5EV8 A;  3SBL A;  1VJN A;  4EY2 A;  4J5H A;  2YZ3 A;  2DOO A;  2BR6 A;  4ZEJ A;  1SML A;  3BK1 A;  3F9O A;  2AZ4 A;  3ZR9 A;  5HIS A;  2FU7 A;  3DH8 A;  5AEB A;  2XF4 A;  2I7T A;  3I13 A;  3R2U A;  4D1U A;  1QH5 A;  3DHB A;  1Y44 A;  3IDZ A;  3ZWF A;  2I7V A;  5ACX A;  2YNU A;  3L6N A;  1XTO A;  3BC2 A;  5EV6 A;  3X30 A;  2YNW A;  2GKL A;  5LS3 A;  4EYB A;  5K0W A;  1KO3 A;  5ACU A;  3KL7 A;  4DIL A;  1YCG A;  5AXR A;  5ACW A;  4EXS A;  4HL1 A;  4D1W A;  2P18 A;  4FSB A;  1JJE A;  1X8H A;  2BC2 A;  5B15 A;  4Z7R A;  5IQK A;  3BV6 A;  5HH5 A;  2NZF A;  3SRX A;  4UWO B;  2BTN A;  2YNT B;  1P9E A;  4EYL A;  4D1T A;  4NQ2 A;  2BFZ B;  1K07 A;  2ZO4 A;  2ZZI A;  4BZ3 A;  4XWT A;  4TZ9 A;  2YNV A;  2DKF A;  2FK6 A;  4UWS B;  5ACR A;  5K4M A;  4ZNB A;  4RAW A;  3T9M A;  4H0D A;  2YCB A;  4ZO2 A;  5EHT A;  2P97 A;  2Y8A A;  3RPC A;  5LCF A;  5A0T A;  4WD6 A;  2BFL A;  4RL0 A;  4C1G A;  4Z5Z A;  2M5D A;  4RL2 A;  4UAM A;  4V0H A;  3TP9 A;  5ACP A;  5LCH A;  3KNR A;  2NZE A;  2P4Z A;  3FAI A;  4FEK A;  1DXK A;  3MD7 A;  5LE1 A;  5ACT A;  2WHG A;  3IE0 A;  2Y87 A;  2R2D A;  3JXP A;  4RAM A;  4RM5 A;  4GYQ A;  1XM8 A;  1BVT A;  2GFJ A;  2VW8 A;  3SFP A;  3KNS A;  4C1H A;  1L9Y A;  2YNV B;  4F6H A;  3T3N A;  5EH9 A;  3SW3 A;  1WW1 A;  1A8T A;  3IOG A;  2OHI A;  5HH4 A;  2FU6 A;  2GMN A;  3ESH A;  4F6Z A;  4DIK A;  4NQ6 A;  3BK2 A;  4TYF A;  4TZB A;  2ZNB A;  2ZWR A;  1E5D A;  5LSC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...