3PY6A

Crystal structure of a beta-lactamase-like protein from brucella melitensis bound to gmp
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
270
structure length
270
Chain Sequence
b'SPRNCLRFTLLGCGSSPGVPRINGDWGKCDPKNPKNRRRRASLLVERYDAEGNNTVVVIDTGPDFRMQMIDSGVHMLDAAVYTHPHADHIHGIDDLRTYVVDNGRLMDVYANRLTRNRLYDTFGYCFETPVGSSYPPILSMHDIAPETPFSIEGAGGAIRFEPFSQVHGDIESLGFRIGSVVYCTDVSAFPEQSLQYIKDADVLIIGALQYRPHPSHFSLGEALEWIEKLSPKRAILTHMHVPLDYETVMRETPHHVEPGYDGLRFEVAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase-like
publication title Crystal Structure of a Beta-Lactamase-Like Protein from Brucella Melitensis bound to GMP
pubmed doi rcsb
source organism Brucella melitensis biovar abortus 2308
molecule tags Hydrolase
total genus 82
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2010-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3py6A00
2GMNA 5FQCA 4RAWA 4HL1A 3T9MA 4C09A 5AHOA 4UAMA 4TZ9A 4XUKA 5K0WA 2BFZA 1A8TA 4KEPA 4D1TA 4F6ZA 1HLKA 4DILA 5K4KA 2YNWA 4WD6A 4UWRB 3RKJA 3IE0A 1VGNA 1SMLA 2WHGA 1YCGA 5AYAA 3I15A 1WRAA 2FU8A 1WUOA 5ACTA 4V0HA 3PG4A 1A7TA 5FQBA 4TZBA 5EWAA 1X8GA 2ZNBA 4FEKA 2GFJA 3KNSA 3IEKA 1ZNBA 3RPCA 5KIKA 5EV8A 4UWPB 5LMCA 1KO2A 2NZEA 3DHCA 5AHRA 3I13A 4YSKA 5A87A 4H0DA 5A0VA 1JJTA 2YCBA 2BTNA 5ACRA 1KO3A 1VMEA 2I7XA 5ACXA 4GCWA 4O98A 1X8HA 4PVTA 1L9YA 4ZO2A 5HH4A 1KR3A 4RL2A 4EXSA 4RL0A 2GKLA 1Y44A 5EVKA 4NQ5A 3SW3A 5LCHA 2BG7A 4FR7A 3L6NA 5EH9A 4HL2A 4C1CA 1JT1A 1K07A 2P4ZA 4BP0A 4AWYB 4RBSA 1VJNA 1ZKPA 2GFKA 3AJ3A 2AZ4A 5AEBA 4DIKA 5KILA 2Y87A 2XF4A 2M5DA 3I11A 4UWSB 3ZR9A 2GCUA 5HIOA 2BGAA 2BG2A 1MQOA 3H3EA 2Q0JA 4UWOB 3AF5A 2YNVB 5EVBA 4GYQA 3ZQ4A 3KL7A 5HISA 4Z7RA 5HH5A 5FQAA 5LM6A 5B1UA 2E7YA 4EYBA 2UYXA 2M5CA 2QEDA 5A5ZA 2XR1A 2FK6A 5IQKA 4HKYA 1DDKA 4FSBA 2YNVA 4NQ4A 5EW0A 5HIQA 4EFZA 4Z67A 4BZ3A 3TP9A 5ACSA 4PVOA 4J5FA 2YZ3A 3ZNBA 2Q42A 4U4LA 4ZNBA 1E5DA 2WYMC 3A4YA 2QJSA 3ZWFA 2WRSA 2BC2A 5K4NA 3QH8A 2FU7A 4TZEA 2FM6A 1YCHA 5HH6A 3X2XA 3LVZA 1YCFA 4EYLA 4TZFA 4JO0A 2BIBA 2FHXB 2OHHA 2VW8A 3X2ZA 3I14A 3T3OA 4Z6XA 2R2DA 2P97A 5HIPA 4D1WA 4CHLA 2ZO4A 4EY2A 4TYTA 4NQ6A 2FHXA 5DPXA 3WXCA 5ACWA 1QH3A 2QINA 3DH8A 2BFLA 2Y8AA 2ZZIA 5EV6A 2BFKA 2HB9A 2P18A 5AXRA 4J5HA 4Z60A 4ZEJA 4GYUA 5LCFA 3G1PA 4C1EA 4D1UA 1XTOA 3ESHA 2BR6A 3T3NA 3FAIA 2DOOA 5ACVA 3MD7A 3X2YA 2WYLA 3PY5A 4KEQA 2WYMA 4XWTA 4LE6A 3I0VA 2H6AA 5EHTA 4F6HA 3BC2A 3S0ZA 2ZWRA 3P2UA 5ACUA 4Z5ZA 3FCZA 4RAMA 2OHJA 2I7TA 1BC2A 2FU6A 4TYFA 3SBLA 3F9OA 3VQZA 5LS3A 4AX0B 3RKKA 1QH5A 2Q0IA 4UA4A 4YSBA 3SRXA 3DHAA 4AD9A 1WUPA 5LSCA 4C1GA 2OHIA 2NXAA 3IDZA 2AIOA 3IE1A 4C1HA 2A7MA 4B87A 4D02A 1JJEA 3X30A 2FU9A 3IOGA 1X8IA 2YNUA 1P9EA 5A0TA 2BG6A 1DXKA 5K4MA 1M2XA 2NYPA 3BK1A 5B3RA 1BMCA 5LE1A 2YNTB 3IELA 1XM8A 4XWWA 3BV6A 4YSLA 5ACQA 5ACPA 2Y8BA 4UBQA 4C1DA 2QDTA 2BG8B 2P1EA 5LCAA 3KNRA 3IEMA 4P62A 3DHBA 5EVDA 2I7VA 4C1FA 4D1VA 4ZO3A 2Q9UA 3PY6A 2NZFA 4NQ2A 2YNTA 4AX1B 4Z5YA 2QDSA 2CBNA 1DD6A 3IOFA 3SD9A 3IE2A 1WW1A 3BK2A 2BG8A 3R2UA 1ZTCA 3AF6A 4EYFA 2BMIA 4RM5A 5AXOA 3SPUA 3Q6VA 3ADRA 3SFPA 3VPEA 4AWZA 2BFZB 5B15A 2DKFA 5LLDA 4EXYA 1BVTA 3JXPA
chains in the Genus database with same CATH superfamily
2GMNA 4PDXA 5FQCA 4RAWA 4HL1A 3T9MA 4C09A 5AHOA 4UAMA 4TZ9A 4XUKA 5K0WA 2BFZA 1A8TA 4KEPA 4D1TA 4F6ZA 1HLKA 4DILA 5K4KA 2YNWA 4WD6A 4UWRB 3RKJA 3IE0A 1VGNA 1SMLA 2WHGA 1YCGA 5AYAA 3I15A 1WRAA 2FU8A 1WUOA 5ACTA 4V0HA 3PG4A 1A7TA 5FQBA 4TZBA 5EWAA 1X8GA 2ZNBA 4FEKA 4AV7A 2GFJA 5A23A 3KNSA 3IEKA 1ZNBA 3RPCA 5KIKA 5EV8A 4UWPB 5LMCA 1KO2A 2NZEA 3DHCA 5AHRA 3I13A 4YSKA 5A87A 4H0DA 5A0VA 1JJTA 2YCBA 2BTNA 5ACRA 1KO3A 1VMEA 2I7XA 5ACXA 4GCWA 4O98A 1X8HA 4PVTA 1L9YA 4ZO2A 5HH4A 1KR3A 4RL2A 4EXSA 4RL0A 2GKLA 1Y44A 5EVKA 4NQ5A 3SW3A 5LCHA 2BG7A 4FR7A 3L6NA 5EH9A 4HL2A 4C1CA 1JT1A 1K07A 2P4ZA 4BP0A 4AWYB 4RBSA 1VJNA 1ZKPA 2GFKA 3AJ3A 2AZ4A 5AEBA 2YHEA 4DIKA 5KILA 2Y87A 2XF4A 2M5DA 3I11A 4UWSB 3ZR9A 2GCUA 5HIOA 2BGAA 2BG2A 1MQOA 3H3EA 2Q0JA 4UWOB 3AF5A 2YNVB 5EVBA 4GYQA 3ZQ4A 3KL7A 5HISA 4Z7RA 5HH5A 5FQAA 5LM6A 5B1UA 2E7YA 4EYBA 2UYXA 2M5CA 2QEDA 5A5ZA 2XR1A 2FK6A 5IQKA 4HKYA 1DDKA 4FSBA 2YNVA 4NQ4A 5EW0A 5HIQA 4EFZA 4Z67A 4BZ3A 3TP9A 5ACSA 4PVOA 4J5FA 2YZ3A 3ZNBA 2Q42A 4U4LA 4ZNBA 1E5DA 2WYMC 3A4YA 2QJSA 3ZWFA 4NURA 2WRSA 2BC2A 5K4NA 3QH8A 2FU7A 4TZEA 2FM6A 1YCHA 5HH6A 3X2XA 3LVZA 1YCFA 4EYLA 4TZFA 4JO0A 2BIBA 2FHXB 2OHHA 2VW8A 5AIJA 3X2ZA 3I14A 3T3OA 4Z6XA 2R2DA 2P97A 5HIPA 4D1WA 4CHLA 2ZO4A 4EY2A 4TYTA 4NQ6A 2FHXA 5DPXA 3WXCA 5ACWA 1QH3A 2QINA 3DH8A 2BFLA 2Y8AA 2ZZIA 5EV6A 2BFKA 2HB9A 2P18A 5AXRA 4J5HA 4Z60A 4ZEJA 4GYUA 5LCFA 3G1PA 4C1EA 4D1UA 1XTOA 3ESHA 2BR6A 2CFUA 3T3NA 3FAIA 2DOOA 5ACVA 3MD7A 3X2YA 2WYLA 3PY5A 4KEQA 2WYMA 4XWTA 4LE6A 3I0VA 2H6AA 5EHTA 4F6HA 3BC2A 3S0ZA 2ZWRA 3P2UA 5ACUA 4Z5ZA 3FCZA 4RAMA 2OHJA 2I7TA 1BC2A 2FU6A 4TYFA 3SBLA 3F9OA 3VQZA 5LS3A 4AX0B 3RKKA 1QH5A 2CG2A 2Q0IA 4UA4A 4YSBA 3SRXA 3DHAA 4AD9A 1WUPA 4AXHA 5LSCA 4C1GA 2OHIA 2NXAA 3IDZA 2AIOA 3IE1A 4C1HA 2A7MA 4B87A 4D02A 1JJEA 2CG3A 3X30A 2FU9A 3IOGA 1X8IA 2YNUA 1P9EA 5A0TA 2BG6A 1DXKA 5K4MA 1M2XA 2NYPA 3BK1A 5B3RA 1BMCA 5LE1A 2YNTB 3IELA 2CFZA 1XM8A 4XWWA 3BV6A 4YSLA 5ACQA 5ACPA 2Y8BA 4UBQA 4C1DA 2QDTA 2BG8B 2P1EA 5LCAA 3KNRA 3IEMA 4P62A 3DHBA 5EVDA 2I7VA 4C1FA 4D1VA 4ZO3A 2Q9UA 3PY6A 2NZFA 4NQ2A 2YNTA 4AX1B 4Z5YA 2QDSA 2CBNA 1DD6A 3IOFA 3SD9A 3IE2A 1WW1A 3BK2A 2BG8A 3R2UA 1ZTCA 3AF6A 4EYFA 2BMIA 4RM5A 5AXOA 3SPUA 3Q6VA 3ADRA 3SFPA 3VPEA 5AJLA 4AWZA 2BFZB 5B15A 2DKFA 5LLDA 4EXYA 1BVTA 3JXPA
chains in the Genus database with same CATH topology
2GMNA 5FQCA 4RAWA 4HL1A 3T9MA 4C09A 5AHOA 4UAMA 4TZ9A 4XUKA 5K0WA 2BFZA 1A8TA 4KEPA 4D1TA 4F6ZA 1HLKA 4DILA 5K4KA 2YNWA 4WD6A 4UWRB 3RKJA 3IE0A 1VGNA 1SMLA 2WHGA 1YCGA 5AYAA 3I15A 1WRAA 2FU8A 1WUOA 5ACTA 4V0HA 3PG4A 1A7TA 5FQBA 4TZBA 5EWAA 1X8GA 2ZNBA 4FEKA 2GFJA 3KNSA 3IEKA 1ZNBA 3RPCA 5KIKA 5EV8A 4UWPB 5LMCA 1KO2A 2NZEA 3DHCA 5AHRA 3I13A 4YSKA 5A87A 4H0DA 5A0VA 1JJTA 2YCBA 2BTNA 5ACRA 1KO3A 1VMEA 2I7XA 5ACXA 4GCWA 4O98A 1X8HA 4PVTA 1L9YA 4ZO2A 5HH4A 1KR3A 4RL2A 4EXSA 4RL0A 2GKLA 1Y44A 5EVKA 4NQ5A 3SW3A 5LCHA 2BG7A 4FR7A 3L6NA 5EH9A 4HL2A 4C1CA 1JT1A 1K07A 2P4ZA 4BP0A 4AWYB 4RBSA 1VJNA 1ZKPA 2GFKA 3AJ3A 2AZ4A 5AEBA 4DIKA 5KILA 2Y87A 2XF4A 2M5DA 3I11A 4UWSB 3ZR9A 2GCUA 5HIOA 2BGAA 2BG2A 1MQOA 3H3EA 2Q0JA 4UWOB 3AF5A 2YNVB 5EVBA 4GYQA 3ZQ4A 3KL7A 5HISA 4Z7RA 5HH5A 5FQAA 5LM6A 5B1UA 2E7YA 4EYBA 2UYXA 2M5CA 2QEDA 5A5ZA 2XR1A 2FK6A 5IQKA 4HKYA 1DDKA 4FSBA 2YNVA 4NQ4A 5EW0A 5HIQA 4EFZA 4Z67A 4BZ3A 3TP9A 5ACSA 4PVOA 4J5FA 2YZ3A 3ZNBA 2Q42A 4U4LA 4ZNBA 1E5DA 2WYMC 3A4YA 2QJSA 3ZWFA 2WRSA 2BC2A 5K4NA 3QH8A 2FU7A 4TZEA 2FM6A 1YCHA 5HH6A 3X2XA 3LVZA 1YCFA 4EYLA 4TZFA 4JO0A 2BIBA 2FHXB 2OHHA 2VW8A 3X2ZA 3I14A 3T3OA 4Z6XA 2R2DA 2P97A 5HIPA 4D1WA 4CHLA 2ZO4A 4EY2A 4TYTA 4NQ6A 2FHXA 5DPXA 3WXCA 5ACWA 1QH3A 2QINA 3DH8A 2BFLA 2Y8AA 2ZZIA 5EV6A 2BFKA 2HB9A 2P18A 5AXRA 4J5HA 4Z60A 4ZEJA 4GYUA 5LCFA 3G1PA 4C1EA 4D1UA 1XTOA 3ESHA 2BR6A 3T3NA 3FAIA 2DOOA 5ACVA 3MD7A 3X2YA 2WYLA 3PY5A 4KEQA 2WYMA 4XWTA 4LE6A 3I0VA 2H6AA 5EHTA 4F6HA 3BC2A 3S0ZA 2ZWRA 3P2UA 5ACUA 4Z5ZA 3FCZA 4RAMA 2OHJA 2I7TA 1BC2A 2FU6A 4TYFA 3SBLA 3F9OA 3VQZA 5LS3A 4AX0B 3RKKA 1QH5A 2Q0IA 4UA4A 4YSBA 3SRXA 3DHAA 4AD9A 1WUPA 5LSCA 4C1GA 2OHIA 2NXAA 3IDZA 2AIOA 3IE1A 4C1HA 2A7MA 4B87A 4D02A 1JJEA 3X30A 2FU9A 3IOGA 1X8IA 2YNUA 1P9EA 5A0TA 2BG6A 1DXKA 5K4MA 1M2XA 2NYPA 3BK1A 5B3RA 1BMCA 5LE1A 2YNTB 3IELA 1XM8A 4XWWA 3BV6A 4YSLA 5ACQA 5ACPA 2Y8BA 4UBQA 4C1DA 2QDTA 2BG8B 2P1EA 5LCAA 3KNRA 3IEMA 4P62A 3DHBA 5EVDA 2I7VA 4C1FA 4D1VA 4ZO3A 2Q9UA 3PY6A 2NZFA 4NQ2A 2YNTA 4AX1B 4Z5YA 2QDSA 2CBNA 1DD6A 3IOFA 3SD9A 3IE2A 1WW1A 3BK2A 2BG8A 3R2UA 1ZTCA 3AF6A 4EYFA 2BMIA 4RM5A 5AXOA 3SPUA 3Q6VA 3ADRA 3SFPA 3VPEA 4AWZA 2BFZB 5B15A 2DKFA 5LLDA 4EXYA 1BVTA 3JXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GMN A;  5FQC A;  4RAW A;  4HL1 A;  3T9M A;  4C09 A;  5AHO A;  4UAM A;  4TZ9 A;  4XUK A;  5K0W A;  2BFZ A;  1A8T A;  4KEP A;  4D1T A;  4F6Z A;  1HLK A;  4DIL A;  5K4K A;  2YNW A;  4WD6 A;  4UWR B;  3RKJ A;  3IE0 A;  1VGN A;  1SML A;  2WHG A;  1YCG A;  5AYA A;  3I15 A;  1WRA A;  2FU8 A;  1WUO A;  5ACT A;  4V0H A;  3PG4 A;  1A7T A;  5FQB A;  4TZB A;  5EWA A;  1X8G A;  2ZNB A;  4FEK A;  2GFJ A;  3KNS A;  3IEK A;  1ZNB A;  3RPC A;  5KIK A;  5EV8 A;  4UWP B;  5LMC A;  1KO2 A;  2NZE A;  3DHC A;  5AHR A;  3I13 A;  4YSK A;  5A87 A;  4H0D A;  5A0V A;  1JJT A;  2YCB A;  2BTN A;  5ACR A;  1KO3 A;  1VME A;  2I7X A;  5ACX A;  4GCW A;  4O98 A;  1X8H A;  4PVT A;  1L9Y A;  4ZO2 A;  5HH4 A;  1KR3 A;  4RL2 A;  4EXS A;  4RL0 A;  2GKL A;  1Y44 A;  5EVK A;  4NQ5 A;  3SW3 A;  5LCH A;  2BG7 A;  4FR7 A;  3L6N A;  5EH9 A;  4HL2 A;  4C1C A;  1JT1 A;  1K07 A;  2P4Z A;  4BP0 A;  4AWY B;  4RBS A;  1VJN A;  1ZKP A;  2GFK A;  3AJ3 A;  2AZ4 A;  5AEB A;  4DIK A;  5KIL A;  2Y87 A;  2XF4 A;  2M5D A;  3I11 A;  4UWS B;  3ZR9 A;  2GCU A;  5HIO A;  2BGA A;  2BG2 A;  1MQO A;  3H3E A;  2Q0J A;  4UWO B;  3AF5 A;  2YNV B;  5EVB A;  4GYQ A;  3ZQ4 A;  3KL7 A;  5HIS A;  4Z7R A;  5HH5 A;  5FQA A;  5LM6 A;  5B1U A;  2E7Y A;  4EYB A;  2UYX A;  2M5C A;  2QED A;  5A5Z A;  2XR1 A;  2FK6 A;  5IQK A;  4HKY A;  1DDK A;  4FSB A;  2YNV A;  4NQ4 A;  5EW0 A;  5HIQ A;  4EFZ A;  4Z67 A;  4BZ3 A;  3TP9 A;  5ACS A;  4PVO A;  4J5F A;  2YZ3 A;  3ZNB A;  2Q42 A;  4U4L A;  4ZNB A;  1E5D A;  2WYM C;  3A4Y A;  2QJS A;  3ZWF A;  2WRS A;  2BC2 A;  5K4N A;  3QH8 A;  2FU7 A;  4TZE A;  2FM6 A;  1YCH A;  5HH6 A;  3X2X A;  3LVZ A;  1YCF A;  4EYL A;  4TZF A;  4JO0 A;  2BIB A;  2FHX B;  2OHH A;  2VW8 A;  3X2Z A;  3I14 A;  3T3O A;  4Z6X A;  2R2D A;  2P97 A;  5HIP A;  4D1W A;  4CHL A;  2ZO4 A;  4EY2 A;  4TYT A;  4NQ6 A;  2FHX A;  5DPX A;  3WXC A;  5ACW A;  1QH3 A;  2QIN A;  3DH8 A;  2BFL A;  2Y8A A;  2ZZI A;  5EV6 A;  2BFK A;  2HB9 A;  2P18 A;  5AXR A;  4J5H A;  4Z60 A;  4ZEJ A;  4GYU A;  5LCF A;  3G1P A;  4C1E A;  4D1U A;  1XTO A;  3ESH A;  2BR6 A;  3T3N A;  3FAI A;  2DOO A;  5ACV A;  3MD7 A;  3X2Y A;  2WYL A;  3PY5 A;  4KEQ A;  2WYM A;  4XWT A;  4LE6 A;  3I0V A;  2H6A A;  5EHT A;  4F6H A;  3BC2 A;  3S0Z A;  2ZWR A;  3P2U A;  5ACU A;  4Z5Z A;  3FCZ A;  4RAM A;  2OHJ A;  2I7T A;  1BC2 A;  2FU6 A;  4TYF A;  3SBL A;  3F9O A;  3VQZ A;  5LS3 A;  4AX0 B;  3RKK A;  1QH5 A;  2Q0I A;  4UA4 A;  4YSB A;  3SRX A;  3DHA A;  4AD9 A;  1WUP A;  5LSC A;  4C1G A;  2OHI A;  2NXA A;  3IDZ A;  2AIO A;  3IE1 A;  4C1H A;  2A7M A;  4B87 A;  4D02 A;  1JJE A;  3X30 A;  2FU9 A;  3IOG A;  1X8I A;  2YNU A;  1P9E A;  5A0T A;  2BG6 A;  1DXK A;  5K4M A;  1M2X A;  2NYP A;  3BK1 A;  5B3R A;  1BMC A;  5LE1 A;  2YNT B;  3IEL A;  1XM8 A;  4XWW A;  3BV6 A;  4YSL A;  5ACQ A;  5ACP A;  2Y8B A;  4UBQ A;  4C1D A;  2QDT A;  2BG8 B;  2P1E A;  5LCA A;  3KNR A;  3IEM A;  4P62 A;  3DHB A;  5EVD A;  2I7V A;  4C1F A;  4D1V A;  4ZO3 A;  2Q9U A;  3PY6 A;  2NZF A;  4NQ2 A;  2YNT A;  4AX1 B;  4Z5Y A;  2QDS A;  2CBN A;  1DD6 A;  3IOF A;  3SD9 A;  3IE2 A;  1WW1 A;  3BK2 A;  2BG8 A;  3R2U A;  1ZTC A;  3AF6 A;  4EYF A;  2BMI A;  4RM5 A;  5AXO A;  3SPU A;  3Q6V A;  3ADR A;  3SFP A;  3VPE A;  4AWZ A;  2BFZ B;  5B15 A;  2DKF A;  5LLD A;  4EXY A;  1BVT A;  3JXP A; 
#chains in the Genus database with same CATH topology
 2GMN A;  4PDX A;  5FQC A;  4RAW A;  4HL1 A;  3T9M A;  4C09 A;  5AHO A;  4UAM A;  4TZ9 A;  4XUK A;  5K0W A;  2BFZ A;  1A8T A;  4KEP A;  4D1T A;  4F6Z A;  1HLK A;  4DIL A;  5K4K A;  2YNW A;  4WD6 A;  4UWR B;  3RKJ A;  3IE0 A;  1VGN A;  1SML A;  2WHG A;  1YCG A;  5AYA A;  3I15 A;  1WRA A;  2FU8 A;  1WUO A;  5ACT A;  4V0H A;  3PG4 A;  1A7T A;  5FQB A;  4TZB A;  5EWA A;  1X8G A;  2ZNB A;  4FEK A;  4AV7 A;  2GFJ A;  5A23 A;  3KNS A;  3IEK A;  1ZNB A;  3RPC A;  5KIK A;  5EV8 A;  4UWP B;  5LMC A;  1KO2 A;  2NZE A;  3DHC A;  5AHR A;  3I13 A;  4YSK A;  5A87 A;  4H0D A;  5A0V A;  1JJT A;  2YCB A;  2BTN A;  5ACR A;  1KO3 A;  1VME A;  2I7X A;  5ACX A;  4GCW A;  4O98 A;  1X8H A;  4PVT A;  1L9Y A;  4ZO2 A;  5HH4 A;  1KR3 A;  4RL2 A;  4EXS A;  4RL0 A;  2GKL A;  1Y44 A;  5EVK A;  4NQ5 A;  3SW3 A;  5LCH A;  2BG7 A;  4FR7 A;  3L6N A;  5EH9 A;  4HL2 A;  4C1C A;  1JT1 A;  1K07 A;  2P4Z A;  4BP0 A;  4AWY B;  4RBS A;  1VJN A;  1ZKP A;  2GFK A;  3AJ3 A;  2AZ4 A;  5AEB A;  2YHE A;  4DIK A;  5KIL A;  2Y87 A;  2XF4 A;  2M5D A;  3I11 A;  4UWS B;  3ZR9 A;  2GCU A;  5HIO A;  2BGA A;  2BG2 A;  1MQO A;  3H3E A;  2Q0J A;  4UWO B;  3AF5 A;  2YNV B;  5EVB A;  4GYQ A;  3ZQ4 A;  3KL7 A;  5HIS A;  4Z7R A;  5HH5 A;  5FQA A;  5LM6 A;  5B1U A;  2E7Y A;  4EYB A;  2UYX A;  2M5C A;  2QED A;  5A5Z A;  2XR1 A;  2FK6 A;  5IQK A;  4HKY A;  1DDK A;  4FSB A;  2YNV A;  4NQ4 A;  5EW0 A;  5HIQ A;  4EFZ A;  4Z67 A;  4BZ3 A;  3TP9 A;  5ACS A;  4PVO A;  4J5F A;  2YZ3 A;  3ZNB A;  2Q42 A;  4U4L A;  4ZNB A;  1E5D A;  2WYM C;  3A4Y A;  2QJS A;  3ZWF A;  4NUR A;  2WRS A;  2BC2 A;  5K4N A;  3QH8 A;  2FU7 A;  4TZE A;  2FM6 A;  1YCH A;  5HH6 A;  3X2X A;  3LVZ A;  1YCF A;  4EYL A;  4TZF A;  4JO0 A;  2BIB A;  2FHX B;  2OHH A;  2VW8 A;  5AIJ A;  3X2Z A;  3I14 A;  3T3O A;  4Z6X A;  2R2D A;  2P97 A;  5HIP A;  4D1W A;  4CHL A;  2ZO4 A;  4EY2 A;  4TYT A;  4NQ6 A;  2FHX A;  5DPX A;  3WXC A;  5ACW A;  1QH3 A;  2QIN A;  3DH8 A;  2BFL A;  2Y8A A;  2ZZI A;  5EV6 A;  2BFK A;  2HB9 A;  2P18 A;  5AXR A;  4J5H A;  4Z60 A;  4ZEJ A;  4GYU A;  5LCF A;  3G1P A;  4C1E A;  4D1U A;  1XTO A;  3ESH A;  2BR6 A;  2CFU A;  3T3N A;  3FAI A;  2DOO A;  5ACV A;  3MD7 A;  3X2Y A;  2WYL A;  3PY5 A;  4KEQ A;  2WYM A;  4XWT A;  4LE6 A;  3I0V A;  2H6A A;  5EHT A;  4F6H A;  3BC2 A;  3S0Z A;  2ZWR A;  3P2U A;  5ACU A;  4Z5Z A;  3FCZ A;  4RAM A;  2OHJ A;  2I7T A;  1BC2 A;  2FU6 A;  4TYF A;  3SBL A;  3F9O A;  3VQZ A;  5LS3 A;  4AX0 B;  3RKK A;  1QH5 A;  2CG2 A;  2Q0I A;  4UA4 A;  4YSB A;  3SRX A;  3DHA A;  4AD9 A;  1WUP A;  4AXH A;  5LSC A;  4C1G A;  2OHI A;  2NXA A;  3IDZ A;  2AIO A;  3IE1 A;  4C1H A;  2A7M A;  4B87 A;  4D02 A;  1JJE A;  2CG3 A;  3X30 A;  2FU9 A;  3IOG A;  1X8I A;  2YNU A;  1P9E A;  5A0T A;  2BG6 A;  1DXK A;  5K4M A;  1M2X A;  2NYP A;  3BK1 A;  5B3R A;  1BMC A;  5LE1 A;  2YNT B;  3IEL A;  2CFZ A;  1XM8 A;  4XWW A;  3BV6 A;  4YSL A;  5ACQ A;  5ACP A;  2Y8B A;  4UBQ A;  4C1D A;  2QDT A;  2BG8 B;  2P1E A;  5LCA A;  3KNR A;  3IEM A;  4P62 A;  3DHB A;  5EVD A;  2I7V A;  4C1F A;  4D1V A;  4ZO3 A;  2Q9U A;  3PY6 A;  2NZF A;  4NQ2 A;  2YNT A;  4AX1 B;  4Z5Y A;  2QDS A;  2CBN A;  1DD6 A;  3IOF A;  3SD9 A;  3IE2 A;  1WW1 A;  3BK2 A;  2BG8 A;  3R2U A;  1ZTC A;  3AF6 A;  4EYF A;  2BMI A;  4RM5 A;  5AXO A;  3SPU A;  3Q6V A;  3ADR A;  3SFP A;  3VPE A;  5AJL A;  4AWZ A;  2BFZ B;  5B15 A;  2DKF A;  5LLD A;  4EXY A;  1BVT A;  3JXP A; 
#chains in the Genus database with same CATH homology
 2GMN A;  5FQC A;  4RAW A;  4HL1 A;  3T9M A;  4C09 A;  5AHO A;  4UAM A;  4TZ9 A;  4XUK A;  5K0W A;  2BFZ A;  1A8T A;  4KEP A;  4D1T A;  4F6Z A;  1HLK A;  4DIL A;  5K4K A;  2YNW A;  4WD6 A;  4UWR B;  3RKJ A;  3IE0 A;  1VGN A;  1SML A;  2WHG A;  1YCG A;  5AYA A;  3I15 A;  1WRA A;  2FU8 A;  1WUO A;  5ACT A;  4V0H A;  3PG4 A;  1A7T A;  5FQB A;  4TZB A;  5EWA A;  1X8G A;  2ZNB A;  4FEK A;  2GFJ A;  3KNS A;  3IEK A;  1ZNB A;  3RPC A;  5KIK A;  5EV8 A;  4UWP B;  5LMC A;  1KO2 A;  2NZE A;  3DHC A;  5AHR A;  3I13 A;  4YSK A;  5A87 A;  4H0D A;  5A0V A;  1JJT A;  2YCB A;  2BTN A;  5ACR A;  1KO3 A;  1VME A;  2I7X A;  5ACX A;  4GCW A;  4O98 A;  1X8H A;  4PVT A;  1L9Y A;  4ZO2 A;  5HH4 A;  1KR3 A;  4RL2 A;  4EXS A;  4RL0 A;  2GKL A;  1Y44 A;  5EVK A;  4NQ5 A;  3SW3 A;  5LCH A;  2BG7 A;  4FR7 A;  3L6N A;  5EH9 A;  4HL2 A;  4C1C A;  1JT1 A;  1K07 A;  2P4Z A;  4BP0 A;  4AWY B;  4RBS A;  1VJN A;  1ZKP A;  2GFK A;  3AJ3 A;  2AZ4 A;  5AEB A;  4DIK A;  5KIL A;  2Y87 A;  2XF4 A;  2M5D A;  3I11 A;  4UWS B;  3ZR9 A;  2GCU A;  5HIO A;  2BGA A;  2BG2 A;  1MQO A;  3H3E A;  2Q0J A;  4UWO B;  3AF5 A;  2YNV B;  5EVB A;  4GYQ A;  3ZQ4 A;  3KL7 A;  5HIS A;  4Z7R A;  5HH5 A;  5FQA A;  5LM6 A;  5B1U A;  2E7Y A;  4EYB A;  2UYX A;  2M5C A;  2QED A;  5A5Z A;  2XR1 A;  2FK6 A;  5IQK A;  4HKY A;  1DDK A;  4FSB A;  2YNV A;  4NQ4 A;  5EW0 A;  5HIQ A;  4EFZ A;  4Z67 A;  4BZ3 A;  3TP9 A;  5ACS A;  4PVO A;  4J5F A;  2YZ3 A;  3ZNB A;  2Q42 A;  4U4L A;  4ZNB A;  1E5D A;  2WYM C;  3A4Y A;  2QJS A;  3ZWF A;  2WRS A;  2BC2 A;  5K4N A;  3QH8 A;  2FU7 A;  4TZE A;  2FM6 A;  1YCH A;  5HH6 A;  3X2X A;  3LVZ A;  1YCF A;  4EYL A;  4TZF A;  4JO0 A;  2BIB A;  2FHX B;  2OHH A;  2VW8 A;  3X2Z A;  3I14 A;  3T3O A;  4Z6X A;  2R2D A;  2P97 A;  5HIP A;  4D1W A;  4CHL A;  2ZO4 A;  4EY2 A;  4TYT A;  4NQ6 A;  2FHX A;  5DPX A;  3WXC A;  5ACW A;  1QH3 A;  2QIN A;  3DH8 A;  2BFL A;  2Y8A A;  2ZZI A;  5EV6 A;  2BFK A;  2HB9 A;  2P18 A;  5AXR A;  4J5H A;  4Z60 A;  4ZEJ A;  4GYU A;  5LCF A;  3G1P A;  4C1E A;  4D1U A;  1XTO A;  3ESH A;  2BR6 A;  3T3N A;  3FAI A;  2DOO A;  5ACV A;  3MD7 A;  3X2Y A;  2WYL A;  3PY5 A;  4KEQ A;  2WYM A;  4XWT A;  4LE6 A;  3I0V A;  2H6A A;  5EHT A;  4F6H A;  3BC2 A;  3S0Z A;  2ZWR A;  3P2U A;  5ACU A;  4Z5Z A;  3FCZ A;  4RAM A;  2OHJ A;  2I7T A;  1BC2 A;  2FU6 A;  4TYF A;  3SBL A;  3F9O A;  3VQZ A;  5LS3 A;  4AX0 B;  3RKK A;  1QH5 A;  2Q0I A;  4UA4 A;  4YSB A;  3SRX A;  3DHA A;  4AD9 A;  1WUP A;  5LSC A;  4C1G A;  2OHI A;  2NXA A;  3IDZ A;  2AIO A;  3IE1 A;  4C1H A;  2A7M A;  4B87 A;  4D02 A;  1JJE A;  3X30 A;  2FU9 A;  3IOG A;  1X8I A;  2YNU A;  1P9E A;  5A0T A;  2BG6 A;  1DXK A;  5K4M A;  1M2X A;  2NYP A;  3BK1 A;  5B3R A;  1BMC A;  5LE1 A;  2YNT B;  3IEL A;  1XM8 A;  4XWW A;  3BV6 A;  4YSL A;  5ACQ A;  5ACP A;  2Y8B A;  4UBQ A;  4C1D A;  2QDT A;  2BG8 B;  2P1E A;  5LCA A;  3KNR A;  3IEM A;  4P62 A;  3DHB A;  5EVD A;  2I7V A;  4C1F A;  4D1V A;  4ZO3 A;  2Q9U A;  3PY6 A;  2NZF A;  4NQ2 A;  2YNT A;  4AX1 B;  4Z5Y A;  2QDS A;  2CBN A;  1DD6 A;  3IOF A;  3SD9 A;  3IE2 A;  1WW1 A;  3BK2 A;  2BG8 A;  3R2U A;  1ZTC A;  3AF6 A;  4EYF A;  2BMI A;  4RM5 A;  5AXO A;  3SPU A;  3Q6V A;  3ADR A;  3SFP A;  3VPE A;  4AWZ A;  2BFZ B;  5B15 A;  2DKF A;  5LLD A;  4EXY A;  1BVT A;  3JXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...