3PY6A

Crystal structure of a beta-lactamase-like protein from brucella melitensis bound to gmp
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
270
structure length
270
Chain Sequence
SPRNCLRFTLLGCGSSPGVPRINGDWGKCDPKNPKNRRRRASLLVERYDAEGNNTVVVIDTGPDFRMQMIDSGVHMLDAAVYTHPHADHIHGIDDLRTYVVDNGRLMDVYANRLTRNRLYDTFGYCFETPVGSSYPPILSMHDIAPETPFSIEGAGGAIRFEPFSQVHGDIESLGFRIGSVVYCTDVSAFPEQSLQYIKDADVLIIGALQYRPHPSHFSLGEALEWIEKLSPKRAILTHMHVPLDYETVMRETPHHVEPGYDGLRFEVAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase-like
publication title Crystal Structure of a Beta-Lactamase-Like Protein from Brucella Melitensis bound to GMP
pubmed doi rcsb
source organism Brucella melitensis biovar abortus 2308
molecule tags Hydrolase
total genus 82
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2010-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3py6A00
3ZWFA 2Y8AA 3X30A 4D02A 4RL2A 1VGNA 3R2UA 1ZKPA 2Q0IA 4AD9A 4UWRB 4JO0A 2Q0JA 4D1TA 2E7YA 2I7VA 4EYLA 1JT1A 4HKYA 4BP0A 2BR6A 5KIKA 1L9YA 4HL1A 5AHOA 3I14A 3JXPA 3IOFA 5LSCA 4RAWA 2NYPA 4D1UA 1BVTA 4BZ3A 5HH4A 3AJ3A 2OHHA 4C1CA 4UWPB 2QEDA 2P18A 2BMIA 3IOGA 2P97A 4YSLA 1YCHA 3SBLA 2WYLA 5ACPA 5AEBA 5A5ZA 4TZFA 3L6NA 2BG6A 1YCGA 5HH6A 1M2XA 3DHAA 1WW1A 5K4MA 4F6HA 5EWAA 4C1DA 5AXRA 1YCFA 4AWYB 4UWSB 4EYFA 4TYTA 5AXOA 1ZNBA 4C1EA 2OHJA 3BK1A 1WRAA 3IELA 1BC2A 2OHIA 1WUPA 2QINA 3KNSA 3I13A 2YNTA 4Z67A 3WXCA 3PG4A 5A0VA 1QH3A 2GCUA 5K4NA 3IE1A 4WD6A 3MD7A 2FU7A 5EVDA 4P62A 2BFKA 2BIBA 2I7XA 4Z6XA 3I0VA 2BG2A 2GFKA 4RAMA 3BV6A 3S0ZA 3RKKA 5LS3A 3T3OA 5EH9A 2H6AA 5HIQA 5K4KA 1DXKA 1E5DA 2P1EA 2R2DA 2CBNA 1HLKA 2QDTA 4AWZA 2DOOA 4EFZA 1VJNA 4UBQA 2NZEA 4C1GA 5ACTA 2BFZB 5B15A 3LVZA 3I15A 5IQKA 4FSBA 5LLDA 2BGAA 1WUOA 4DIKA 2YNWA 4TZEA 1X8IA 2WHGA 1JJEA 4GYUA 2UYXA 2YZ3A 4UAMA 2ZZIA 3A4YA 3AF6A 3PY5A 5LCAA 3KNRA 2BFLA 5HISA 4U4LA 3ZNBA 2ZWRA 5LE1A 3SW3A 4D1VA 5EV8A 5LMCA 4YSKA 2XF4A 1K07A 2XR1A 4EYBA 4TZ9A 3SPUA 3ESHA 3G1PA 1DDKA 1A7TA 5EHTA 1JJTA 3SRXA 1BMCA 3BK2A 1XTOA 4FR7A 2GKLA 4D1WA 2BG8B 3SD9A 4GCWA 4Z5YA 4ZNBA 3BC2A 4KEPA 5HH5A 4EXYA 2WYMC 3FCZA 4NQ4A 1KO3A 2YNVB 5EVBA 5AHRA 2GMNA 2NZFA 1X8HA 4NQ2A 3FAIA 3X2ZA 2I7TA 1KR3A 4AX1B 1MQOA 4KEQA 5A87A 5ACXA 5EV6A 4NQ6A 5KILA 2YCBA 3F9OA 3ADRA 4CHLA 4EY2A 2Q42A 5LM6A 4J5FA 4UA4A 3QH8A 5AYAA 2Y87A 2YNUA 1X8GA 3Q6VA 5ACWA 2WRSA 2FU6A 2BG8A 1KO2A 5EW0A 3DH8A 5ACQA 4RBSA 5ACRA 4UWOB 2YNVA 3X2YA 2Q9UA 5B1UA 3I11A 1XM8A 2FHXB 4XWTA 5FQAA 4HL2A 3IE0A 1A8TA 1Y44A 2FK6A 5FQBA 4J5HA 3RKJA 3ZR9A 4ZEJA 3AF5A 4GYQA 4H0DA 1DD6A 1P9EA 2P4ZA 2WYMA 5HIPA 3KL7A 5A0TA 3P2UA 2FU8A 5K0WA 3DHCA 4PVTA 2YNTB 4XUKA 3IDZA 4LE6A 2AZ4A 4FEKA 2A7MA 1QH5A 5LCHA 1VMEA 1SMLA 4TZBA 3T9MA 4ZO2A 4RL0A 2BFZA 5EVKA 5ACVA 4C09A 3SFPA 2AIOA 4Z60A 5ACUA 4O98A 3ZQ4A 3T3NA 2FHXA 3VPEA 2FU9A 4PVOA 2BTNA 5B3RA 3VQZA 4XWWA 2NXAA 5ACSA 5DPXA 3DHBA 4NQ5A 2GFJA 4DILA 4ZO3A 3IE2A 4C1HA 2VW8A 4TYFA 2ZNBA 5LCFA 2FM6A 2BC2A 4V0HA 2Y8BA 4YSBA 5FQCA 2BG7A 2DKFA 2ZO4A 3IEKA 3RPCA 3TP9A 2QJSA 4Z5ZA 1ZTCA 4B87A 3H3EA 4Z7RA 3IEMA 4F6ZA 4AX0B 3PY6A 2HB9A 2M5DA 2QDSA 2M5CA 4RM5A 3X2XA 5HIOA 4EXSA 4C1FA
chains in the Genus database with same CATH superfamily
3ZWFA 2Y8AA 3X30A 4D02A 4RL2A 1VGNA 3R2UA 1ZKPA 2Q0IA 4AD9A 4UWRB 4JO0A 2Q0JA 4D1TA 2E7YA 2I7VA 4EYLA 2CFZA 1JT1A 4HKYA 4BP0A 2BR6A 5KIKA 1L9YA 4HL1A 5AHOA 2CG3A 3I14A 3JXPA 3IOFA 5LSCA 4RAWA 2NYPA 4D1UA 1BVTA 4BZ3A 5HH4A 3AJ3A 2OHHA 4C1CA 4UWPB 2QEDA 2CFUA 2P18A 2BMIA 3IOGA 2P97A 4YSLA 1YCHA 3SBLA 2WYLA 5ACPA 5AEBA 5A5ZA 4TZFA 3L6NA 2BG6A 1YCGA 5HH6A 1M2XA 3DHAA 1WW1A 5K4MA 4F6HA 5EWAA 4C1DA 5AXRA 1YCFA 4AWYB 4UWSB 4EYFA 4TYTA 5AXOA 1ZNBA 4C1EA 2OHJA 3BK1A 1WRAA 3IELA 1BC2A 2OHIA 5AIJA 1WUPA 2QINA 3KNSA 3I13A 2YNTA 4Z67A 3WXCA 3PG4A 5A0VA 1QH3A 2GCUA 5K4NA 3IE1A 4WD6A 3MD7A 2FU7A 5EVDA 4P62A 2YHEA 2BFKA 2BIBA 2I7XA 4Z6XA 3I0VA 2BG2A 2GFKA 4RAMA 3BV6A 3S0ZA 3RKKA 5LS3A 3T3OA 5EH9A 2H6AA 5HIQA 4AXHA 5K4KA 1DXKA 1E5DA 2P1EA 2R2DA 2CBNA 1HLKA 2QDTA 4AWZA 2DOOA 4EFZA 1VJNA 4UBQA 2NZEA 4C1GA 5ACTA 2BFZB 5B15A 3LVZA 3I15A 5IQKA 4FSBA 5LLDA 2BGAA 1WUOA 4DIKA 2YNWA 4TZEA 1X8IA 2WHGA 1JJEA 4GYUA 2UYXA 2YZ3A 4UAMA 2ZZIA 3A4YA 3AF6A 3PY5A 5LCAA 3KNRA 2BFLA 5HISA 4U4LA 3ZNBA 2ZWRA 5LE1A 3SW3A 4D1VA 5EV8A 5LMCA 4YSKA 2XF4A 1K07A 2XR1A 4EYBA 5AJLA 4TZ9A 2CG2A 3SPUA 3ESHA 3G1PA 1DDKA 1A7TA 5EHTA 1JJTA 3SRXA 1BMCA 3BK2A 1XTOA 4FR7A 2GKLA 4D1WA 2BG8B 3SD9A 4GCWA 4Z5YA 4ZNBA 3BC2A 4KEPA 5HH5A 4EXYA 2WYMC 3FCZA 4NQ4A 4AV7A 1KO3A 2YNVB 5EVBA 5AHRA 2GMNA 2NZFA 1X8HA 4NQ2A 3FAIA 3X2ZA 2I7TA 1KR3A 4AX1B 1MQOA 4KEQA 5A87A 5ACXA 5EV6A 4NQ6A 5KILA 2YCBA 3F9OA 3ADRA 4CHLA 4EY2A 2Q42A 5LM6A 4J5FA 4UA4A 3QH8A 5AYAA 2Y87A 2YNUA 1X8GA 3Q6VA 5ACWA 2WRSA 2FU6A 2BG8A 1KO2A 5EW0A 3DH8A 5ACQA 4RBSA 5ACRA 4UWOB 2YNVA 3X2YA 2Q9UA 4NURA 5B1UA 3I11A 1XM8A 4PDXA 2FHXB 4XWTA 5FQAA 4HL2A 3IE0A 1A8TA 1Y44A 2FK6A 5FQBA 4J5HA 3RKJA 3ZR9A 4ZEJA 3AF5A 4GYQA 4H0DA 1DD6A 1P9EA 2P4ZA 2WYMA 5HIPA 3KL7A 5A0TA 3P2UA 2FU8A 5K0WA 3DHCA 4PVTA 2YNTB 4XUKA 3IDZA 4LE6A 2AZ4A 4FEKA 2A7MA 1QH5A 5LCHA 1VMEA 1SMLA 4TZBA 3T9MA 4ZO2A 4RL0A 2BFZA 5EVKA 5ACVA 4C09A 3SFPA 2AIOA 4Z60A 5ACUA 4O98A 3ZQ4A 3T3NA 2FHXA 3VPEA 2FU9A 4PVOA 2BTNA 5B3RA 3VQZA 4XWWA 2NXAA 5ACSA 5DPXA 3DHBA 4NQ5A 2GFJA 4DILA 4ZO3A 3IE2A 4C1HA 2VW8A 5A23A 4TYFA 2ZNBA 5LCFA 2FM6A 2BC2A 4V0HA 2Y8BA 4YSBA 5FQCA 2BG7A 2DKFA 2ZO4A 3IEKA 3RPCA 3TP9A 2QJSA 4Z5ZA 1ZTCA 4B87A 3H3EA 4Z7RA 3IEMA 4F6ZA 4AX0B 3PY6A 2HB9A 2M5DA 2QDSA 2M5CA 4RM5A 3X2XA 5HIOA 4EXSA 4C1FA
chains in the Genus database with same CATH topology
3ZWFA 2Y8AA 3X30A 4D02A 4RL2A 1VGNA 3R2UA 1ZKPA 2Q0IA 4AD9A 4UWRB 4JO0A 2Q0JA 4D1TA 2E7YA 2I7VA 4EYLA 1JT1A 4HKYA 4BP0A 2BR6A 5KIKA 1L9YA 4HL1A 5AHOA 3I14A 3JXPA 3IOFA 5LSCA 4RAWA 2NYPA 4D1UA 1BVTA 4BZ3A 5HH4A 3AJ3A 2OHHA 4C1CA 4UWPB 2QEDA 2P18A 2BMIA 3IOGA 2P97A 4YSLA 1YCHA 3SBLA 2WYLA 5ACPA 5AEBA 5A5ZA 4TZFA 3L6NA 2BG6A 1YCGA 5HH6A 1M2XA 3DHAA 1WW1A 5K4MA 4F6HA 5EWAA 4C1DA 5AXRA 1YCFA 4AWYB 4UWSB 4EYFA 4TYTA 5AXOA 1ZNBA 4C1EA 2OHJA 3BK1A 1WRAA 3IELA 1BC2A 2OHIA 1WUPA 2QINA 3KNSA 3I13A 2YNTA 4Z67A 3WXCA 3PG4A 5A0VA 1QH3A 2GCUA 5K4NA 3IE1A 4WD6A 3MD7A 2FU7A 5EVDA 4P62A 2BFKA 2BIBA 2I7XA 4Z6XA 3I0VA 2BG2A 2GFKA 4RAMA 3BV6A 3S0ZA 3RKKA 5LS3A 3T3OA 5EH9A 2H6AA 5HIQA 5K4KA 1DXKA 1E5DA 2P1EA 2R2DA 2CBNA 1HLKA 2QDTA 4AWZA 2DOOA 4EFZA 1VJNA 4UBQA 2NZEA 4C1GA 5ACTA 2BFZB 5B15A 3LVZA 3I15A 5IQKA 4FSBA 5LLDA 2BGAA 1WUOA 4DIKA 2YNWA 4TZEA 1X8IA 2WHGA 1JJEA 4GYUA 2UYXA 2YZ3A 4UAMA 2ZZIA 3A4YA 3AF6A 3PY5A 5LCAA 3KNRA 2BFLA 5HISA 4U4LA 3ZNBA 2ZWRA 5LE1A 3SW3A 4D1VA 5EV8A 5LMCA 4YSKA 2XF4A 1K07A 2XR1A 4EYBA 4TZ9A 3SPUA 3ESHA 3G1PA 1DDKA 1A7TA 5EHTA 1JJTA 3SRXA 1BMCA 3BK2A 1XTOA 4FR7A 2GKLA 4D1WA 2BG8B 3SD9A 4GCWA 4Z5YA 4ZNBA 3BC2A 4KEPA 5HH5A 4EXYA 2WYMC 3FCZA 4NQ4A 1KO3A 2YNVB 5EVBA 5AHRA 2GMNA 2NZFA 1X8HA 4NQ2A 3FAIA 3X2ZA 2I7TA 1KR3A 4AX1B 1MQOA 4KEQA 5A87A 5ACXA 5EV6A 4NQ6A 5KILA 2YCBA 3F9OA 3ADRA 4CHLA 4EY2A 2Q42A 5LM6A 4J5FA 4UA4A 3QH8A 5AYAA 2Y87A 2YNUA 1X8GA 3Q6VA 5ACWA 2WRSA 2FU6A 2BG8A 1KO2A 5EW0A 3DH8A 5ACQA 4RBSA 5ACRA 4UWOB 2YNVA 3X2YA 2Q9UA 5B1UA 3I11A 1XM8A 2FHXB 4XWTA 5FQAA 4HL2A 3IE0A 1A8TA 1Y44A 2FK6A 5FQBA 4J5HA 3RKJA 3ZR9A 4ZEJA 3AF5A 4GYQA 4H0DA 1DD6A 1P9EA 2P4ZA 2WYMA 5HIPA 3KL7A 5A0TA 3P2UA 2FU8A 5K0WA 3DHCA 4PVTA 2YNTB 4XUKA 3IDZA 4LE6A 2AZ4A 4FEKA 2A7MA 1QH5A 5LCHA 1VMEA 1SMLA 4TZBA 3T9MA 4ZO2A 4RL0A 2BFZA 5EVKA 5ACVA 4C09A 3SFPA 2AIOA 4Z60A 5ACUA 4O98A 3ZQ4A 3T3NA 2FHXA 3VPEA 2FU9A 4PVOA 2BTNA 5B3RA 3VQZA 4XWWA 2NXAA 5ACSA 5DPXA 3DHBA 4NQ5A 2GFJA 4DILA 4ZO3A 3IE2A 4C1HA 2VW8A 4TYFA 2ZNBA 5LCFA 2FM6A 2BC2A 4V0HA 2Y8BA 4YSBA 5FQCA 2BG7A 2DKFA 2ZO4A 3IEKA 3RPCA 3TP9A 2QJSA 4Z5ZA 1ZTCA 4B87A 3H3EA 4Z7RA 3IEMA 4F6ZA 4AX0B 3PY6A 2HB9A 2M5DA 2QDSA 2M5CA 4RM5A 3X2XA 5HIOA 4EXSA 4C1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZWF A;  2Y8A A;  3X30 A;  4D02 A;  4RL2 A;  1VGN A;  3R2U A;  1ZKP A;  2Q0I A;  4AD9 A;  4UWR B;  4JO0 A;  2Q0J A;  4D1T A;  2E7Y A;  2I7V A;  4EYL A;  1JT1 A;  4HKY A;  4BP0 A;  2BR6 A;  5KIK A;  1L9Y A;  4HL1 A;  5AHO A;  3I14 A;  3JXP A;  3IOF A;  5LSC A;  4RAW A;  2NYP A;  4D1U A;  1BVT A;  4BZ3 A;  5HH4 A;  3AJ3 A;  2OHH A;  4C1C A;  4UWP B;  2QED A;  2P18 A;  2BMI A;  3IOG A;  2P97 A;  4YSL A;  1YCH A;  3SBL A;  2WYL A;  5ACP A;  5AEB A;  5A5Z A;  4TZF A;  3L6N A;  2BG6 A;  1YCG A;  5HH6 A;  1M2X A;  3DHA A;  1WW1 A;  5K4M A;  4F6H A;  5EWA A;  4C1D A;  5AXR A;  1YCF A;  4AWY B;  4UWS B;  4EYF A;  4TYT A;  5AXO A;  1ZNB A;  4C1E A;  2OHJ A;  3BK1 A;  1WRA A;  3IEL A;  1BC2 A;  2OHI A;  1WUP A;  2QIN A;  3KNS A;  3I13 A;  2YNT A;  4Z67 A;  3WXC A;  3PG4 A;  5A0V A;  1QH3 A;  2GCU A;  5K4N A;  3IE1 A;  4WD6 A;  3MD7 A;  2FU7 A;  5EVD A;  4P62 A;  2BFK A;  2BIB A;  2I7X A;  4Z6X A;  3I0V A;  2BG2 A;  2GFK A;  4RAM A;  3BV6 A;  3S0Z A;  3RKK A;  5LS3 A;  3T3O A;  5EH9 A;  2H6A A;  5HIQ A;  5K4K A;  1DXK A;  1E5D A;  2P1E A;  2R2D A;  2CBN A;  1HLK A;  2QDT A;  4AWZ A;  2DOO A;  4EFZ A;  1VJN A;  4UBQ A;  2NZE A;  4C1G A;  5ACT A;  2BFZ B;  5B15 A;  3LVZ A;  3I15 A;  5IQK A;  4FSB A;  5LLD A;  2BGA A;  1WUO A;  4DIK A;  2YNW A;  4TZE A;  1X8I A;  2WHG A;  1JJE A;  4GYU A;  2UYX A;  2YZ3 A;  4UAM A;  2ZZI A;  3A4Y A;  3AF6 A;  3PY5 A;  5LCA A;  3KNR A;  2BFL A;  5HIS A;  4U4L A;  3ZNB A;  2ZWR A;  5LE1 A;  3SW3 A;  4D1V A;  5EV8 A;  5LMC A;  4YSK A;  2XF4 A;  1K07 A;  2XR1 A;  4EYB A;  4TZ9 A;  3SPU A;  3ESH A;  3G1P A;  1DDK A;  1A7T A;  5EHT A;  1JJT A;  3SRX A;  1BMC A;  3BK2 A;  1XTO A;  4FR7 A;  2GKL A;  4D1W A;  2BG8 B;  3SD9 A;  4GCW A;  4Z5Y A;  4ZNB A;  3BC2 A;  4KEP A;  5HH5 A;  4EXY A;  2WYM C;  3FCZ A;  4NQ4 A;  1KO3 A;  2YNV B;  5EVB A;  5AHR A;  2GMN A;  2NZF A;  1X8H A;  4NQ2 A;  3FAI A;  3X2Z A;  2I7T A;  1KR3 A;  4AX1 B;  1MQO A;  4KEQ A;  5A87 A;  5ACX A;  5EV6 A;  4NQ6 A;  5KIL A;  2YCB A;  3F9O A;  3ADR A;  4CHL A;  4EY2 A;  2Q42 A;  5LM6 A;  4J5F A;  4UA4 A;  3QH8 A;  5AYA A;  2Y87 A;  2YNU A;  1X8G A;  3Q6V A;  5ACW A;  2WRS A;  2FU6 A;  2BG8 A;  1KO2 A;  5EW0 A;  3DH8 A;  5ACQ A;  4RBS A;  5ACR A;  4UWO B;  2YNV A;  3X2Y A;  2Q9U A;  5B1U A;  3I11 A;  1XM8 A;  2FHX B;  4XWT A;  5FQA A;  4HL2 A;  3IE0 A;  1A8T A;  1Y44 A;  2FK6 A;  5FQB A;  4J5H A;  3RKJ A;  3ZR9 A;  4ZEJ A;  3AF5 A;  4GYQ A;  4H0D A;  1DD6 A;  1P9E A;  2P4Z A;  2WYM A;  5HIP A;  3KL7 A;  5A0T A;  3P2U A;  2FU8 A;  5K0W A;  3DHC A;  4PVT A;  2YNT B;  4XUK A;  3IDZ A;  4LE6 A;  2AZ4 A;  4FEK A;  2A7M A;  1QH5 A;  5LCH A;  1VME A;  1SML A;  4TZB A;  3T9M A;  4ZO2 A;  4RL0 A;  2BFZ A;  5EVK A;  5ACV A;  4C09 A;  3SFP A;  2AIO A;  4Z60 A;  5ACU A;  4O98 A;  3ZQ4 A;  3T3N A;  2FHX A;  3VPE A;  2FU9 A;  4PVO A;  2BTN A;  5B3R A;  3VQZ A;  4XWW A;  2NXA A;  5ACS A;  5DPX A;  3DHB A;  4NQ5 A;  2GFJ A;  4DIL A;  4ZO3 A;  3IE2 A;  4C1H A;  2VW8 A;  4TYF A;  2ZNB A;  5LCF A;  2FM6 A;  2BC2 A;  4V0H A;  2Y8B A;  4YSB A;  5FQC A;  2BG7 A;  2DKF A;  2ZO4 A;  3IEK A;  3RPC A;  3TP9 A;  2QJS A;  4Z5Z A;  1ZTC A;  4B87 A;  3H3E A;  4Z7R A;  3IEM A;  4F6Z A;  4AX0 B;  3PY6 A;  2HB9 A;  2M5D A;  2QDS A;  2M5C A;  4RM5 A;  3X2X A;  5HIO A;  4EXS A;  4C1F A; 
#chains in the Genus database with same CATH topology
 3ZWF A;  2Y8A A;  3X30 A;  4D02 A;  4RL2 A;  1VGN A;  3R2U A;  1ZKP A;  2Q0I A;  4AD9 A;  4UWR B;  4JO0 A;  2Q0J A;  4D1T A;  2E7Y A;  2I7V A;  4EYL A;  2CFZ A;  1JT1 A;  4HKY A;  4BP0 A;  2BR6 A;  5KIK A;  1L9Y A;  4HL1 A;  5AHO A;  2CG3 A;  3I14 A;  3JXP A;  3IOF A;  5LSC A;  4RAW A;  2NYP A;  4D1U A;  1BVT A;  4BZ3 A;  5HH4 A;  3AJ3 A;  2OHH A;  4C1C A;  4UWP B;  2QED A;  2CFU A;  2P18 A;  2BMI A;  3IOG A;  2P97 A;  4YSL A;  1YCH A;  3SBL A;  2WYL A;  5ACP A;  5AEB A;  5A5Z A;  4TZF A;  3L6N A;  2BG6 A;  1YCG A;  5HH6 A;  1M2X A;  3DHA A;  1WW1 A;  5K4M A;  4F6H A;  5EWA A;  4C1D A;  5AXR A;  1YCF A;  4AWY B;  4UWS B;  4EYF A;  4TYT A;  5AXO A;  1ZNB A;  4C1E A;  2OHJ A;  3BK1 A;  1WRA A;  3IEL A;  1BC2 A;  2OHI A;  5AIJ A;  1WUP A;  2QIN A;  3KNS A;  3I13 A;  2YNT A;  4Z67 A;  3WXC A;  3PG4 A;  5A0V A;  1QH3 A;  2GCU A;  5K4N A;  3IE1 A;  4WD6 A;  3MD7 A;  2FU7 A;  5EVD A;  4P62 A;  2YHE A;  2BFK A;  2BIB A;  2I7X A;  4Z6X A;  3I0V A;  2BG2 A;  2GFK A;  4RAM A;  3BV6 A;  3S0Z A;  3RKK A;  5LS3 A;  3T3O A;  5EH9 A;  2H6A A;  5HIQ A;  4AXH A;  5K4K A;  1DXK A;  1E5D A;  2P1E A;  2R2D A;  2CBN A;  1HLK A;  2QDT A;  4AWZ A;  2DOO A;  4EFZ A;  1VJN A;  4UBQ A;  2NZE A;  4C1G A;  5ACT A;  2BFZ B;  5B15 A;  3LVZ A;  3I15 A;  5IQK A;  4FSB A;  5LLD A;  2BGA A;  1WUO A;  4DIK A;  2YNW A;  4TZE A;  1X8I A;  2WHG A;  1JJE A;  4GYU A;  2UYX A;  2YZ3 A;  4UAM A;  2ZZI A;  3A4Y A;  3AF6 A;  3PY5 A;  5LCA A;  3KNR A;  2BFL A;  5HIS A;  4U4L A;  3ZNB A;  2ZWR A;  5LE1 A;  3SW3 A;  4D1V A;  5EV8 A;  5LMC A;  4YSK A;  2XF4 A;  1K07 A;  2XR1 A;  4EYB A;  5AJL A;  4TZ9 A;  2CG2 A;  3SPU A;  3ESH A;  3G1P A;  1DDK A;  1A7T A;  5EHT A;  1JJT A;  3SRX A;  1BMC A;  3BK2 A;  1XTO A;  4FR7 A;  2GKL A;  4D1W A;  2BG8 B;  3SD9 A;  4GCW A;  4Z5Y A;  4ZNB A;  3BC2 A;  4KEP A;  5HH5 A;  4EXY A;  2WYM C;  3FCZ A;  4NQ4 A;  4AV7 A;  1KO3 A;  2YNV B;  5EVB A;  5AHR A;  2GMN A;  2NZF A;  1X8H A;  4NQ2 A;  3FAI A;  3X2Z A;  2I7T A;  1KR3 A;  4AX1 B;  1MQO A;  4KEQ A;  5A87 A;  5ACX A;  5EV6 A;  4NQ6 A;  5KIL A;  2YCB A;  3F9O A;  3ADR A;  4CHL A;  4EY2 A;  2Q42 A;  5LM6 A;  4J5F A;  4UA4 A;  3QH8 A;  5AYA A;  2Y87 A;  2YNU A;  1X8G A;  3Q6V A;  5ACW A;  2WRS A;  2FU6 A;  2BG8 A;  1KO2 A;  5EW0 A;  3DH8 A;  5ACQ A;  4RBS A;  5ACR A;  4UWO B;  2YNV A;  3X2Y A;  2Q9U A;  4NUR A;  5B1U A;  3I11 A;  1XM8 A;  4PDX A;  2FHX B;  4XWT A;  5FQA A;  4HL2 A;  3IE0 A;  1A8T A;  1Y44 A;  2FK6 A;  5FQB A;  4J5H A;  3RKJ A;  3ZR9 A;  4ZEJ A;  3AF5 A;  4GYQ A;  4H0D A;  1DD6 A;  1P9E A;  2P4Z A;  2WYM A;  5HIP A;  3KL7 A;  5A0T A;  3P2U A;  2FU8 A;  5K0W A;  3DHC A;  4PVT A;  2YNT B;  4XUK A;  3IDZ A;  4LE6 A;  2AZ4 A;  4FEK A;  2A7M A;  1QH5 A;  5LCH A;  1VME A;  1SML A;  4TZB A;  3T9M A;  4ZO2 A;  4RL0 A;  2BFZ A;  5EVK A;  5ACV A;  4C09 A;  3SFP A;  2AIO A;  4Z60 A;  5ACU A;  4O98 A;  3ZQ4 A;  3T3N A;  2FHX A;  3VPE A;  2FU9 A;  4PVO A;  2BTN A;  5B3R A;  3VQZ A;  4XWW A;  2NXA A;  5ACS A;  5DPX A;  3DHB A;  4NQ5 A;  2GFJ A;  4DIL A;  4ZO3 A;  3IE2 A;  4C1H A;  2VW8 A;  5A23 A;  4TYF A;  2ZNB A;  5LCF A;  2FM6 A;  2BC2 A;  4V0H A;  2Y8B A;  4YSB A;  5FQC A;  2BG7 A;  2DKF A;  2ZO4 A;  3IEK A;  3RPC A;  3TP9 A;  2QJS A;  4Z5Z A;  1ZTC A;  4B87 A;  3H3E A;  4Z7R A;  3IEM A;  4F6Z A;  4AX0 B;  3PY6 A;  2HB9 A;  2M5D A;  2QDS A;  2M5C A;  4RM5 A;  3X2X A;  5HIO A;  4EXS A;  4C1F A; 
#chains in the Genus database with same CATH homology
 3ZWF A;  2Y8A A;  3X30 A;  4D02 A;  4RL2 A;  1VGN A;  3R2U A;  1ZKP A;  2Q0I A;  4AD9 A;  4UWR B;  4JO0 A;  2Q0J A;  4D1T A;  2E7Y A;  2I7V A;  4EYL A;  1JT1 A;  4HKY A;  4BP0 A;  2BR6 A;  5KIK A;  1L9Y A;  4HL1 A;  5AHO A;  3I14 A;  3JXP A;  3IOF A;  5LSC A;  4RAW A;  2NYP A;  4D1U A;  1BVT A;  4BZ3 A;  5HH4 A;  3AJ3 A;  2OHH A;  4C1C A;  4UWP B;  2QED A;  2P18 A;  2BMI A;  3IOG A;  2P97 A;  4YSL A;  1YCH A;  3SBL A;  2WYL A;  5ACP A;  5AEB A;  5A5Z A;  4TZF A;  3L6N A;  2BG6 A;  1YCG A;  5HH6 A;  1M2X A;  3DHA A;  1WW1 A;  5K4M A;  4F6H A;  5EWA A;  4C1D A;  5AXR A;  1YCF A;  4AWY B;  4UWS B;  4EYF A;  4TYT A;  5AXO A;  1ZNB A;  4C1E A;  2OHJ A;  3BK1 A;  1WRA A;  3IEL A;  1BC2 A;  2OHI A;  1WUP A;  2QIN A;  3KNS A;  3I13 A;  2YNT A;  4Z67 A;  3WXC A;  3PG4 A;  5A0V A;  1QH3 A;  2GCU A;  5K4N A;  3IE1 A;  4WD6 A;  3MD7 A;  2FU7 A;  5EVD A;  4P62 A;  2BFK A;  2BIB A;  2I7X A;  4Z6X A;  3I0V A;  2BG2 A;  2GFK A;  4RAM A;  3BV6 A;  3S0Z A;  3RKK A;  5LS3 A;  3T3O A;  5EH9 A;  2H6A A;  5HIQ A;  5K4K A;  1DXK A;  1E5D A;  2P1E A;  2R2D A;  2CBN A;  1HLK A;  2QDT A;  4AWZ A;  2DOO A;  4EFZ A;  1VJN A;  4UBQ A;  2NZE A;  4C1G A;  5ACT A;  2BFZ B;  5B15 A;  3LVZ A;  3I15 A;  5IQK A;  4FSB A;  5LLD A;  2BGA A;  1WUO A;  4DIK A;  2YNW A;  4TZE A;  1X8I A;  2WHG A;  1JJE A;  4GYU A;  2UYX A;  2YZ3 A;  4UAM A;  2ZZI A;  3A4Y A;  3AF6 A;  3PY5 A;  5LCA A;  3KNR A;  2BFL A;  5HIS A;  4U4L A;  3ZNB A;  2ZWR A;  5LE1 A;  3SW3 A;  4D1V A;  5EV8 A;  5LMC A;  4YSK A;  2XF4 A;  1K07 A;  2XR1 A;  4EYB A;  4TZ9 A;  3SPU A;  3ESH A;  3G1P A;  1DDK A;  1A7T A;  5EHT A;  1JJT A;  3SRX A;  1BMC A;  3BK2 A;  1XTO A;  4FR7 A;  2GKL A;  4D1W A;  2BG8 B;  3SD9 A;  4GCW A;  4Z5Y A;  4ZNB A;  3BC2 A;  4KEP A;  5HH5 A;  4EXY A;  2WYM C;  3FCZ A;  4NQ4 A;  1KO3 A;  2YNV B;  5EVB A;  5AHR A;  2GMN A;  2NZF A;  1X8H A;  4NQ2 A;  3FAI A;  3X2Z A;  2I7T A;  1KR3 A;  4AX1 B;  1MQO A;  4KEQ A;  5A87 A;  5ACX A;  5EV6 A;  4NQ6 A;  5KIL A;  2YCB A;  3F9O A;  3ADR A;  4CHL A;  4EY2 A;  2Q42 A;  5LM6 A;  4J5F A;  4UA4 A;  3QH8 A;  5AYA A;  2Y87 A;  2YNU A;  1X8G A;  3Q6V A;  5ACW A;  2WRS A;  2FU6 A;  2BG8 A;  1KO2 A;  5EW0 A;  3DH8 A;  5ACQ A;  4RBS A;  5ACR A;  4UWO B;  2YNV A;  3X2Y A;  2Q9U A;  5B1U A;  3I11 A;  1XM8 A;  2FHX B;  4XWT A;  5FQA A;  4HL2 A;  3IE0 A;  1A8T A;  1Y44 A;  2FK6 A;  5FQB A;  4J5H A;  3RKJ A;  3ZR9 A;  4ZEJ A;  3AF5 A;  4GYQ A;  4H0D A;  1DD6 A;  1P9E A;  2P4Z A;  2WYM A;  5HIP A;  3KL7 A;  5A0T A;  3P2U A;  2FU8 A;  5K0W A;  3DHC A;  4PVT A;  2YNT B;  4XUK A;  3IDZ A;  4LE6 A;  2AZ4 A;  4FEK A;  2A7M A;  1QH5 A;  5LCH A;  1VME A;  1SML A;  4TZB A;  3T9M A;  4ZO2 A;  4RL0 A;  2BFZ A;  5EVK A;  5ACV A;  4C09 A;  3SFP A;  2AIO A;  4Z60 A;  5ACU A;  4O98 A;  3ZQ4 A;  3T3N A;  2FHX A;  3VPE A;  2FU9 A;  4PVO A;  2BTN A;  5B3R A;  3VQZ A;  4XWW A;  2NXA A;  5ACS A;  5DPX A;  3DHB A;  4NQ5 A;  2GFJ A;  4DIL A;  4ZO3 A;  3IE2 A;  4C1H A;  2VW8 A;  4TYF A;  2ZNB A;  5LCF A;  2FM6 A;  2BC2 A;  4V0H A;  2Y8B A;  4YSB A;  5FQC A;  2BG7 A;  2DKF A;  2ZO4 A;  3IEK A;  3RPC A;  3TP9 A;  2QJS A;  4Z5Z A;  1ZTC A;  4B87 A;  3H3E A;  4Z7R A;  3IEM A;  4F6Z A;  4AX0 B;  3PY6 A;  2HB9 A;  2M5D A;  2QDS A;  2M5C A;  4RM5 A;  3X2X A;  5HIO A;  4EXS A;  4C1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...