1YCGA

X-ray structures of moorella thermoacetica fpra. novel diiron site structure and mechanistic insights into a scavenging nitric oxide reductase
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
398
structure length
398
Chain Sequence
SQPVAITDGIYWVGAVDWNIRYFHGPAFSTHRGTTYNAYLIVDDKTALVDTVYEPFKEELIAKLKQIKDPVKLDYLVVNHTESDHAGAFPAIMELCPDAHVLCTQRAFDSLKAHYSHIDFNYTIVKTGTSVSLGKRSLTFIEAPMLHWPDSMFTYVPEEALLLPNDAFGQHIATSVRFDDQVDAGLIMDEAAKYYANILMPFSNLITKKLDEIQKINLAIKTIAPSHGIIWRKDPGRIIEAYARWAEGQGKAKAVIAYDTMWLSTEKMAHALMDGLVAGGCEVKLFKLSVSDRNDVIKEILDARAVLVGSPTINNDILPVVSPLLDDLVGLRPKNKVGLAFGAYGWGGGAQKILEERLKAAKIELIAEPGPTVQWVPRGEDLQRCYELGRKIAARIAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nitric oxide reductase
publication title X-ray crystal structures of Moorella thermoacetica FprA. Novel diiron site structure and mechanistic insights into a scavenging nitric oxide reductase.
pubmed doi rcsb
source organism Moorella thermoacetica
molecule tags Oxidoreductase
total genus 134
structure length 398
sequence length 398
chains with identical sequence B, C, D
ec nomenclature ec 1.-.-.-:
pdb deposition date 2004-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ycgA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1ycgA01
1V4BA 3L9XA 3W79A 5LBUA 1AKWA 5LCFA 2UYXA 1WSWA 5LBTA 2FLVA 2BTNA 5B3RA 3UXHA 3RKKA 5A87A 2FDXA 1FVXA 5HIQA 3KEGA 1WUOA 3P0RA 5ACQA 2M6RA 4ZVLA 4R81A 2Q0IA 4AWZA 2OHJA 3F6RA 5A0VA 5EMNA 1BC2A 4EY2A 1H69A 2Z9DA 4HL2A 5FQBA 2ZKIA 3QE2A 2R97A 5A0TA 5EVKA 3HR4A 2Q62A 2AMJA 1CZHA 3WXCA 1DXOA 1F4PA 5FA6A 3IOGA 4UAMA 2FU6A 5EHTA 2Q9UA 2BG8A 4BP0A 1JA0A 2R96A 1DXQA 2QEDA 3G1PA 4RAMA 4FEKA 4XUKA 1XYYA 4M0CA 5B15A 2QMZA 2OYSA 2OHIA 5LJIA 3GFQA 4AD9A 2XR1A 4YAOA 4C1FA 1I1OA 1AHNA 3NHKA 4GYUA 2ZWRA 4U7FA 1AKRA 1ZNBA 2BFLA 4D02A 3R6WA 2AIOA 1QH5A 4ZO3A 5ACRA 4RL0A 4Y9RA 1XM8A 2FK6A 2WC1A 4LTMA 4P62A 3NHUA 1CZNA 3T3NA 2BFZB 2DKFA 2QX8A 1SMLA 4XWWA 2F1OA 1FUEA 1JA1A 2A7MA 4CHLA 3NHPA 1C7FA 1BMCA 1P9EA 4PVOA 3AF5A 3QH8A 4TZFA 4TYFA 4EYLA 3GAMA 2WHGA 5K4MA 2WYMC 2FHXB 1RLIA 1H66A 4Y9UA 1D04A 1KO2A 2I7XA 5EW0A 1KBQA 1L9YA 5ACUA 3OJXA 3U7IA 2NYPA 3HA2A 5LSCA 4C1HA 3TEMA 1TLLA 4HEQA 1VGNA 5K4NA 1M2XA 2FOXA 2NZEA 1CZLA 3BK2A 4D1VA 4QOEA 3H3EA 1XI2A 1T5BA 1SQSA 4PTYA 4ZVKA 3FW1A 2YNVB 2YNWA 3IE0A 2FZ5A 4Y7CA 3TP9A 4C1CA 2M5CA 1TIKA 2M5DA 4GYQA 3F6SA 4ZVMA 3F9OA 1BVYF 3DHCA 4QOIA 5F51A 5ACVA 3B6MA 1DX9A 1FX1A 3BC2A 3FX2A 1A8TA 4ICIA 1YRHA 2HPVA 3X2XA 2V9CA 2QX6A 2ZNBA 3B6KA 4NULA 4QODA 2FCRA 3LCMA 2QDSA 2N1MA 1CZKA 2GKLA 5HIPA 3RPEA 4FGKA 5AXRA 4J5FA 3O2NA 3ADRA 5BUCA 5NLLA 3OX1A 2WYLA 4GR9A 3SRXA 2BFZA 2BMVA 3SPUA 4FGJA 3SD9A 1C7EA 4U4LA 4Z60A 3KAPA 1QR2A 5HH4A 1AKVA 3KLBA 2Z9BA 1ZKPA 2QX9A 3NHJA 3PG4A 3OJWA 3I15A 3O73A 4YSLA 2BG6A 2FHXA 4EXSA 2X2PA 3NLLA 2HNAA 2YZ3A 4OXXA 4U7HA 1ZTCA 4QOJA 2QDTA 5LM6A 4N9QA 1XYVA 2QWXA 2Y8BA 3KAQA 3QFRA 2BMIA 2KQUA 2QJSA 1K07A 1WSBA 5NULA 2X2OA 3X2YA 4AX0B 3R2UA 5LLDA 3X2ZA 3NHLA 4D1WA 2BR6A 3I11A 3B6JA 2I7VA 1DD6A 4O98A 4UBQA 2Y8AA 1YKGA 4LE6A 3FNIA 2MWMA 1D03A 1DDKA 1X77A 2MT9A 2WRSA 5A5ZA 3IELA 2A5LA 4QOGA 4GQIA 4NLLA 3BK1A 3ZQ4A 5ACSA 4LA4A 5HISA 1RCFA 2Q42A 3DH8A 3KL7A 4NQ4A 5FUQA 4Z7RA 4RAWA 2BIBA 2NXAA 4LTDA 2FAXA 3KNRA 3P2UA 4XDGA 3MD7A 2H6AA 3Q6VA 1AZLA 4RM5A 1B1CA 1T0IA 1YOBA 2YCBA 3BV6A 4EYBA 5ACPA 5ACXA 3NHYA 4UWOB 1MQOA 3AF6A 4DY4A 5LS3A 1KO3A 1JJEA 5EV8A 1QBGA 2R2DA 4LTNA 2BGAA 4EYFA 4C1EA 5TGZA 5FX2A 2GSWA 1VMEA 2E7YA 3LT5A 2FU9A 5LJLA 4FR7A 4C14A 1CZRA 5AHOA 2GMNA 1ZX1A 2D5IA 3UXEA 2NZFA 3NHFA 3EYWA 5ULLA 1WW1A 1OFVA 3VQZA 3B6IA 5EVBA 3EDOA 5JROA 4GCWA 2RG1A 4JO0A 4Z5ZA 3OWXA 3OX3A 1Y44A 2QMYA 1QRDA 4NQ5A 4YAUA 1CZOA 4XDHA 2HB9A 4S24A 4J8PA 5IQKA 2OHHA 3W78A 3DHBA 4LAFA 5DPXA 3IEKA 3D7NA 4H6PA 3FJOA 4YSBA 3ZWFA 3PY6A 4H2DA 4YAFA 4NQ2A 3SFPA 3X30A 3ES9A 3ESZA 4NQ6A 3RPCA 3S0ZA 3A4YA 5AYAA 5FQAA 5B1UA 2BFKA 3GFRA 3NHRA 5AXOA 4Z5YA 3S2YA 4AWYB 4Z6XA 3RKJA 2CBNA 1FLNA 2ZZIA 1AKQA 4ZVNA 2P1EA 5EV6A 1ZWKA 5LVAA 4KEPA 3IDZA 3W7AA 4TZEA 5EWAA 5EAIA 4BMOB 1BVTA 1WRAA 4HL1A 4BZ3A 4B87A 2Y87A 2Z98A 3I0VA 2BG7A 1YCHA 3NFRA 3SBLA 3ESHA 4F6ZA 1A7TA 3IEMA 1J9ZA 3FAIA 2WYMA 1WUPA 3ESYA 2AZ4A 5A4KA 2BPOA 3I13A 4C09A 2DOOA 3JXPA 3F90A 4UWSB 3IOFA 4DILA 2KLBA 5F4BA 3N3BC 5K4KA 1ZWLA 3IE2A 3ZNBA 4YALA 3N3AC 5ACTA 3AJ3A 3DHAA 2W5UA 2VW8A 4AX1B 4RL2A 1X8IA 5AEBA 2QX4A 1DXKA 4WD6A 1JT1A 4C0WA 2YNVA 1QH3A 4D1UA 4ZO2A 3K20A 3NHSA 4F8YA 4UWPB 4V0HA 1FLDA 5ACWA 5FQCA 1J8QA 4D1TA 4H0DA 2ZO4A 3SW3A 1YCGA 1SG0A 3G5MA 4Z67A 1J9GA 2BG2A 2FU7A 2BN4A 4FX2A 1FTGA 3L6NA 5B3KA 3NHWA 2XOEA 5HH6A 2HNBA 4QOFA 4PU0A 2M6SA 5AHRA 3K1YA 4DIKA 2YNTB 6NULA 4XWTA 3TE7A 4ZEJA 1D4AA 1BU5A 4YAWA 3F2VA 3QFCA 2Q0JA 1OBOA 1J9EA 3SVLA 5LCHA 1YCFA 2GFKA 4PTZA 5EH9A 2I7TA 1AKTA 4PVTA 2P4ZA 1RLJA 4BMPB 3KNSA 4F6HA 2ARKA 2B3DA 3ZR9A 5KIKA 5LMCA 2GFJA 3OX2A 1X8HA 1NNI1 4C76A 1CZUA 2FVXA 1AKUA 3U7RA 4ESEA 5B3LA 1X8GA 2BZSA 4TYTA 4RBSA 3OVMA 1QHEA 2FU8A 2XODA 4N65A 2FZVA 5LE1A 4C1GA 3FVWA 4EFZA 1XT6A 3OWHA 5EVDA 1AMOA 3LVZA 2YNUA 2FX2A 2QR2A 2FM6A 4FSBA 4EXYA 2XF4A 3ZHOA 3GFSA 2BF4A 4C0XA 2P97A 2BG8B 3L9WA 1FLVA 5HIOA 4UWRB 1XTOA 3JSXA 5HH5A 4UA4A 2MTBA 1KBOA 2P18A 2V5VA 1RTTA 3ESXA 5EA2A 2GCUA 4GI5A 4U7GA 1GG5A 3TZBA 4TZBA 2QINA 3HLYA 4J5HA 4KEQA 4C1DA 3FCZA 1YDGA 4ZNBA 1FLAA 4YQEA 4HKYA 4TZ9A 1OBVA 1VJNA 1KR3A 2MOKA 3VPEA 3T9MA 5F12A 4CETA 4CF6A 3T3OA 1AG9A 4HS4A 2V5UA 3N39C 2BC2A 1E5DA 4N82A 4YSKA 4FGLA 1HLKA 1JJTA 3I14A 2Z9CA 2YNTA 3PY5A 3IE1A 3W77A 4QOHA 5K0WA 5LCAA 5KILA
chains in the Genus database with same CATH superfamily
4LJ7A 2ISCA 4HYEA 1V4BA 4BBZA 3WWEA 5F7ZA 4LJKA 4KRFA 2A6PA 4PYMA 2YN4A 5HF5A 3CUVA 4FYHA 5DGXA 5H0IA 1JB9A 2VPYA 1QWOA 3VC2A 1EUQA 1XRPA 2ZWPA 3MN1A 5HF8A 4ER7A 4H7IA 5B3RA 3RBAA 1Q0RA 4LJ4A 4RSHA 1FVXA 2GJ4A 1NM5C 1P17A 4ZV7A 1M67A 2I3ZA 4Y1EA 3BXGA 3QYAA 1M2FA 2P27A 2HU5A 1RR6A 2PLFA 2ZPUA 4P3OA 3H7IA 1KH2A 2ATEA 1MRZA 3ZW9A 4BMVA 3GGOA 2CHUA 1F17A 1R10A 1U2SA 4R8KA 5LP6A 1O0BA 3D6VA 1MEEA 4KPYA 3WISA 2X23A 2VDUE 4JJFA 1EVEA 4JR2A 4XD7D 2BVNA 4FHEA 3VNRA 1Q6YA 5CJPA 4UDYX 5FL3A 3HUEA 3UANA 1SXJA 2OZLB 1XXHB 2OR3A 2Q50A 1CVRA 3HYCA 3O4FA 4RF2A 3A11A 3EFBA 1X0XA 3WO0A 4BP0A 1SC6A 4FJ0A 2QEDA 2BFDB 4YS6A 1MRNA 4GC9A 3GMSA 1KO5A 3VH3A 1LPMA 2C4TA 2F3SA 4US0R 4WERA 2Z6QA 2QQ5A 2VNJA 2GNAA 5IXSA 1TQ2A 1VE7A 3FAKA 2FEMA 1KNXA 1DL5A 2J9YB 3LX4A 4DYHA 5AHXA 3QNWA 3O8QA 4BVGA 3V4SA 4OUDB 4GYUA 4BX9A 1V1RB 1GRCA 3PLRA 4D3DA 1P3JA 3PGA1 4UE6A 3T4XA 3ANSA 3TD2A 1XVUA 1Q1QA 3ZLTA 4MR8A 4DBVO 4YXFA 2C2WA 1RWWA 2AMLA 3HM2A 5IDQA 4Y9RA 4RZSA 4OM8A 1UM9A 4WZBB 4P3XA 4IMRA 3IUEA 1UDRA 1XNRB 3W5BA 1PZMA 4TLLB 2BWJA 3FDZA 3I6QA 1O08A 2DKFA 3MINA 4KI0A 2Q6IA 1YBFA 4KR9A 3V8PA 4GF5A 4AO6A 1PWXA 2NLOA 2HRDA 2I62A 2I4RA 1DZIA 2OZPA 2R2GA 3NCTA 3QOXA 1AF4A 3TLZA 3UWMA 3DVLA 1O6GA 3T4UA 3RT7A 2XRZA 4RD0A 4CMEC 2Z83A 3ZDBA 3Q10A 2WSBA 2Z1DA 4RVHA 1E3QA 4EYLA 1LY1A 4FT2A 3T7AA 1GQOA 3PNOA 2H5IA 4RD6A 5CFPA 3OPYA 4QHSA 3EG9A 1MXFA 3ETCA 2BGNA 2SECE 1ZNXA 3A1FA 3BFKA 4KDFA 1MO2A 4H6VA 3CN9A 4E5UA 1NDQA 1SBCA 4ZICA 3WA7A 1VSUA 1C3VA 2XRMA 2QJRA 3RUAA 1P0IA 1Y8AA 3RANA 4ZI7A 1RWVA 5I7UA 2V45A 3BJEA 4ZU3A 3FD8A 3EMVA 3A6HA 3QBTA 2VP4A 3GI1A 4MQ6A 1ENYA 4Y0AA 3TL6A 4YPVA 2P1RA 4HEQA 1IAVA 1DE0A 1EUZA 2ZB8A 3JQCA 4LSGA 4EKDA 1XNQB 5AKGA 5ELXA 1SM4A 3M2TA 5EJ9A 3O8BA 1EVLA 3F5SA 4I3GA 1JIXA 1BGVA 2JCYA 3U9SA 4YRKA 2BBTA 4YP1A 4QPCA 1RXSA 1J21A 4G37A 4ZQEA 5HUQA 4IVRA 4NFSA 4URUR 1L7XA 1SD1A 3MPOA 2PUAA 1SRQA 3TIXB 2C9DA 2OBYA 2FZ5A 1U3DA 4Y7CA 4UCWA 3MLAA 3FOCA 2PFGA 3N8IA 2QZZA 1ZA2A 4MW7A 2KYRA 3E22A 3PJDA 5DJ5A 4N01A 4ZDKA 4EG8A 1D4FA 1TL7C 1G5FA 3TXXA 4HN4B 2ZU0C 1LBIA 2G28A 1KE1A 2XUPA 4BMZA 4HAVA 5I9IA 3GN2A 3ZDAA 4YMIA 2FV8A 3G82C 3DCNA 1H1TA 4XFDA 1SUAA 2TS1A 1R0XA 1VLQA 4X85A 1YRHA 2HPVA 4BQEA 3EFOB 3MWDA 4JBYA 4DA4A 3I5AA 2AOUB 2PDAA 3B6KA 3EULA 4G5FA 5FHRA 4H7JA 3EK2A 5KNLA 4WZAA 1KWGA 3OZEA 1CB0A 1RQNA 1Z47A 3USES 4GOMD 1PR0A 1OX5A 4YXWA 1DBIA 3GAAA 4XLTA 1LBHA 3R41A 2ZYHA 4L9RA 1VIAA 3FXAA 3KOYA 3TDKA 4O63O 2HF9A 1SNYA 4DA7A 2PZMA 4PQYA 3O2NA 3PUJA 3NRJA 4HDOB 1E5TA 5IKOA 1OX6A 2WYLA 2EFYA 3A25A 3DUFB 3ZE6A 1M34A 2BFZA 3HCPA 1A96A 1PSWA 4DV2B 4FGJA 4B0PA 3ZHRA 3OEHA 4FNGA 4KQ2A 5AIJA 1FFGA 1WSAA 3GJ5A 2OFWA 2I6UA 3JD2A 1DFHA 3UJ7A 1L5QA 1V2HE 3ZE2B 3H2GA 3NHJA 1E3JA 1OIWA 4RA6B 5EWJB 4ZOCA 1KFJB 1GGVA 2YC2C 3HN7A 1WB9A 1B6TA 2W22A 4I50A 2J9ZB 1SBYA 2QLBA 5JVDB 4D46A 5BW4A 4FGWA 5KQLA 3EGXB 1WETA 3GMTA 3RV4A 1PWHA 1R66A 1EFHA 2CXOA 4PC6A 5T4BA 1WHTA 2LWIA 5D7BA 3EQ6A 4IJKA 4OF4A 4N9QA 3DYVA 1UFOA 3VO2A 4PWYA 1HGXA 1J70A 3MJRA 2BMIA 3H13A 4NH4A 3EAQA 2ILTA 3OOHA 3NHAA 4NWIA 1MCZA 3P2JA 4XWGA 4RPHA 4DJ5X 4RE5A 2K5UA 1KEEA 4PG4A 3X1JA 1Y4ZA 1VJ0A 2OM6A 3NTLA 4C2TA 2HO4A 4ZU1X 3T9DA 1MBZA 3U7HB 5CT9A 3CRZA 2I7VA 3FAZA 2ZUBA 4KHPB 2RONA 1IZ0A 3Q41A 3IYLW 1E3TA 1HT3A 2B1RA 3QPAA 4MI9A 4NU5A 4HRXA 1WZCA 2Q4RA 1AT1A 2CUTA 2XJ4A 3AOEA 3QKRB 4NU8X 1LPPA 2O8FA 3IELA 4HPJB 1WW8A 4Z4QA 2X4LA 3I5UA 3B38A 4J4BA 3GGDA 3IOCA 1ZAYA 4JI3B 2TECE 1BCSB 3NETA 4PLCA 4BNIA 1VJRA 4JXZA 4BO5A 1RCFA 5JE8A 3EUAA 4TTSA 2EDAA 1ZIDA 1IZ9A 1TVCA 4BO3A 5E6UA 5L7YA 4FEGA 4E30A 4MVYA 2B5WA 8GPBA 4GX2A 2JD2A 1U4NA 3KKPA 5I48A 1U1GA 2PBZA 3GD5A 3JZDA 3CNEA 5DXFA 2LP4Y 1CX9B 2GKSA 4FE4A 4KFRA 1XFDA 4NECA 4ATNA 2XZOA 4XWAA 1FY2A 1HO3A 4OVKA 1KRHA 3FZGA 2UYYA 3PRYA 4FSDA 1MPXA 1E2PA 1U3CA 2AZMA 3O9VA 4QDOA 3MXOA 3TI9A 5ILOA 1VRWA 3BERA 4KEAA 4LW8A 4BVKA 2ZUEA 2P5YA 3EH1A 4X62B 1R6DA 1QQ7A 1V9CA 1Z6XA 3G0GA 5DYIA 3HO8A 1M0TA 4OKSA 1D2RA 5DTEA 2MMCA 1FJHA 2C4NA 4MVJI 1G3IA 1JMKC 1O4WA 1ZIPA 2ZB3A 4LFCB 2HA2A 3KOMA 3WSTA 2GRJA 1VPLA 3JWPA 1Q7EA 1MG0A 3EVFA 4LDAA 2L69A 1LDEA 4RHEA 3V4VB 3QXSA 2F17A 1I3LA 3EEIA 4YGXB 3R9XA 1YASA 5AJWA 3ZE9A 1FQJA 4DCNA 1LS6A 4ZQGA 2AD5A 2DE0X 1XKQA 1G8SA 2IXGA 3HJBA 3NGMA 3PTLA 4QSMA 2POCA 4UMFA 3RJMA 3DAPA 3TSAA 3R76A 2NZFA 1T5DX 1C0KA 4WVLA 3EZYA 3ZE0B 2P8JA 2F8SA 2J45A 2H9AA 4LG1A 1UKCA 5CDFE 4GP9A 1UFQA 3WWDA 3WMEA 4DBZA 5JROA 3OF2A 3ZQJA 1XQVA 1E96A 2XZLA 2P2DA 4Z4CA 2QLJA 1NQOA 1WRBA 1Z7WA 3ZJ5A 1QH9A 4K28A 4RW0A 2RAFA 1H1LA 1EA5A 4PBRA 3MBIA 2FQXA 3PTZA 4WHMA 4BVBA 4D96A 4QRDA 1PL0A 4OHMA 2Y1EA 3ENNA 3Q6MA 4YSBA 1DUIA 3IFSA 2HLPA 2B1JA 3CWQA 4LY3A 4KZKA 4H2DA 4ENVA 3CLSD 3A4MA 4M1SA 3DULA 3LC0A 3FDIA 4NYJQ 2O8EB 4GSYA 4G1UC 1II8B 5DW3A 3MCVA 1Z5OA 4L5YA 5FWAA 3DZFA 4KH0A 1TE2A 1H2XA 3HACA 5AK0A 3UWSA 1BWPA 3EIQA 1JU9A 1FXWA 3OQMA 3JPYA 5JS7A 3P7MA 5AOVA 5EP3A 2Q21A 4MRRA 2P11A 3IQHX 3NAGA 3JAWA 3KKKA 4R41A 5K9ZA 1GCAA 4EFLA 4JKIA 1Z68A 3HY3A 3CT6A 3N58A 4GMHA 4O2AB 1HZZA 1MOSA 2NO7A 1QRUA 1R4ZA 3ICVA 1DLIA 1E7MA 1SC1A 1Y1RA 3UMRA 1NP7A 1N0HA 4YJDA 1ZWKA 2B4AA 2QTMA 2HA7A 4C5BA 3W7AA 2WHPA 1WSDA 2VOJA 4LZNA 2ZBDA 1BO6A 3TGWA 5JXHA 5IVDA 1P6XA 1CUSA 2QX7A 4KJZA 1X2EA 4TV9B 2OA0A 2VBIA 4CL3A 2Y87A 1HNZB 1G5PA 3CO5A 3SZUA 1D2HA 4N8SA 4R7TA 4A91A 3HVRA 4BAZA 1X42A 2WWYA 3DQPA 4Q4JB 3LECA 5CBKA 4F72A 3ILVA 1G8MA 2RGYA 4C5CA 5JNVA 3EF1A 1UDBA 3KC2A 4CHGA 1XCLA 3SFVA 4EG5A 4QQKA 5FBVB 3V6MA 2QIOA 4Q4DA 1E63A 1LPBB 2BMWA 3STHA 3ITNA 2C31A 4TSFA 1CWUA 2FN9A 4OQ4A 1YZTA 4QD3A 4D97A 5TY0A 1XLUA 1NRWA 4BMDA 1HDOA 3AM4A 4LV8B 1DU4A 2GOYA 4ISCA 4JEMA 4PLHA 3J81A 2EKQA 4DCTA 1T6NA 4CU5A 5B1EA 5TSDA 4AY5A 1I6KA 3GUVA 4Z4FA 3ZCXA 4J16A 1BHO1 4PS0A 5DI3B 4F12A 3M4JA 5EFOA 1IHYA 3IAHA 1ZI9A 3B2NA 5JASA 1ZVKA 3CUYA 3U4MA 1ODSA 1W8IA 1QH3A 1JQ3A 1P4JA 1B15A 1ZNQO 4L5JA 4RVDA 3MD7A 2P79A 1KPHA 2NO9A 4EPRA 2FR8C 4ENTA 4LDZA 1MC8A 1J09A 3ZBPA 2YXPX 3N0VA 5F76A 1CRZA 4M0FA 4AJJA 2QN8A 3W6PA 5FORA 1MG5A 1GUYA 4LXYA 2DUJA 3FCCA 4IILA 2P2GA 4YMLA 1XTZA 2HUPA 2WF5A 3M4XA 3RYFA 3T1TA 1P7VA 1WDTA 1Z22A 3I9OA 4O4JB 4QBTA 3VDQA 1NXSA 1ESCA 3WJ2A 4M1QA 1NPYA 4PSVA 4C4SA 4YUZA 4A8JA 2ZBGA 4RETA 3CKYA 5D5HA 5DYNA 2QD2A 3L4BC 2FMHA 2M6SA 1F0KA 1BGWA 1SBIA 3G0IA 4R1MA 4DV3B 1N0UA 3S8MA 3SIXA 1AQNA 2W4MA 2ZKLA 4EDHA 4DY6A 1E8MA 1D4AA 3U56A 1RMTA 2IXDA 1MO3A 3LA8A 2VG8A 1NBIA 1R74A 3LGAA 5BVGA 1HOTA 3NX4A 1GITA 1JB1A 1YWGO 4MPTA 2A86A 3AL3A 4TRMA 4AZ0A 4POAA 1U9JA 1YACA 721PA 2BFFA 1IAQA 4PRLA 2VK1A 2DP4E 3RS8A 3VSDA 4QT4A 4X65B 2V7UA 2NXNA 3LIIA 4QPJC 5E7IA 3M3PA 2J3HA 3D2BA 1K06A 3U48A 1L7BA 1UBLS 1EAYA 4WKBA 1OLUA 3ICEA 1L7OA 2ONZA 3FF4A 4MMZB 3OU7A 3M1YA 3QX7A 4LRSB 3IKTA 2GHRA 2BMJA 4KP7A 4YMTA 1YVDA 1QQBA 1J5XA 1G0OA 4K9SA 1NKTA 3BMNB 1OJLA 3S27A 4C78A 3RYCA 1U9CA 4LRQA 4RBSA 4MULA 2YKGA 4GI3A 5AXCA 2XCSB 1V4VA 2J31A 1XJ0A 1EGAA 3I39X 4KSCA 4TMVA 1VE3A 4ZRMA 4EL5A 4QRHA 4D3YA 2IS6A 1VYUA 2B5OA 2XYGA 3TNLA 2FZKA 2NACA 3Q3JB 3QUSA 1T2FA 4YN3A 2IUUA 3GLFA 2DUNA 2AFIB 2LNDA 4L5CA 5DLQC 3E8MA 1QTIA 4F2PA 3ILSA 1OV6A 4MYHA 2QTZA 4P8RA 4QICA 5KOHB 1OHHD 2C4MA 4MJ7A 4IIVA 4C3OB 2JGAA 4YRBA 1Z29A 5KU7A 5K0EA 4AWAA 4WFJA 1WJGA 2RHHA 4QTUB 4K6OA 1CEXA 2O57A 1KHHA 2ESRA 2VK4A 4RHXA 4W5QA 1X3SA 1P3Y1 1GILA 1F9AA 5KOJA 4J1TC 4ARZB 4GI5A 4ZMBA 4RENA 1OC2A 3FSJX 3SG0A 4ETWA 5ELLA 3UY4A 2XTMA 4LDQA 4PX3A 3CT4A 1PHRA 2QINA 1I7QB 4KEQA 1Y8RA 5HF9A 5HDBB 5BQ5A 1GNRA 2IQIA 3P2IA 3P71T 3PDJA 5E6RA 3T8YA 4F0JA 1VJNA 3T7JA 4KPGA 1H2EA 2IFTA 5BVHA 3Q85A 1SCBA 2EP8A 1U2GA 2BF7A 5F12A 4MPPA 1DDIA 3W05A 2G5CA 5I45A 4WV3A 4FX5A 1E1LA 4IUBS 2P69A 2A3NA 2EFHB 1OSNA 3SXUA 2XYHA 3UF0A 4UTPA 3UYKA 3GNLA 1FUUA 1MTOA 4BFZA 2WNHA 2Q2WA 2IPAB 3I14A 2J0UB 4BPBA 3DXZA 3QKWA 3FCUB 4QA9A 4ZDIA 4TOIA 2EAUA 4O4LF 3W77A 5A02A 1V8OA 1JEOA 3WLSA 2CKMA 3HP7A 3ZU5A 2VSOA 3PNSA 4K88A 2XMQA 1SUEA 4BDSA 3PYLA 3ENZA 4ZGWA 3CQ9A 3JR7A 2ZVJA 5CIQA 1TYBE 3GRZA 4CFSA 5HDQA 2VSQA 4A6PA 3MJVA 1QHIA 1K63A 2DY1A 3BMCB 3ECCA 1W2GA 3QFTA 4ITUA 3RDPA 1ODTC 1Y5IA 1R6AA 3S68A 2FDXA 4M60A 4F38A 2UDPA 3QEMA 2IVZA 3ETHA 2PUBA 3NDJA 2PGIA 2P77A 2D8MA 3U4CA 4W82A 4DAOA 4TXMA 3RFCA 2HK6A 1EK0A 5KAPA 3CPEA 1BDIA 1OXBB 3I5YA 3K5IA 1WVGA 2E6KA 4JITA 4Q7MB 4RK1A 1JXOA 1P91A 5EC8A 3X3HA 2DZDA 4BO6A 4MLZA 5IT0A 4L50A 1JG3A 3C3EA 3B52X 1JLLA 1LLDA 3QRWA 1CY7A 5DTIA 1EUCB 1W4AA 2AMJA 1W4ZA 1DKMA 2JIZD 2ISQA 3K92A 4MAFA 1HE3A 3AOGA 2HWXA 5HKLA 3DZCA 4DNXA 1I0ZA 2PWYA 3AIIA 1Z6TA 4XVUA 1ZG3A 2QLTA 2G04A 1CY2A 3N07A 2R96A 3LFTA 5LBIA 5B4TA 1N9GB 1SZDA 5DEOA 3R0ZA 4DEXA 2E37A 2FWAA 2VNAA 4M99A 4DUGD 2BGGA 3SX4A 5BQ3A 1NJ1A 1YL5A 1XK6A 2IDZA 1AK1A 1ATZA 2CBGA 1CW2B 4D92A 1PD0A 5JCOA 2I9KA 1O97D 4OQZA 2OECA 3DZKA 4EECA 2A1TS 4Y1GA 4NF2A 2YASA 2CJWB 5KO2A 2P6UA 4L02A 3I2IA 1GFWA 3HJGA 2BLLA 3B6ZA 3EXAA 1VSTA 1QU2A 3EAGA 2QNRA 2WWFA 4CV2A 5DTQA 5GONF 1DRVA 4KR2A 1CP3A 1YZLA 2WZDA 3Q5DA 5JW6A 2GXSA 4BTLA 4HLUA 4D2IA 2BTNA 1RHQA 4GLLA 3TJMA 2IEBA 5H68A 1JA1A 4F9GA 1VE6A 2DQ4A 2VEOA 2PEYA 1STOA 2C3UA 4XUGB 4H3HB 4UPEA 5L53A 2OXFA 1P9EA 1VHJA 3BB1A 3AF5A 2GKGA 3DVRX 1QMGA 5GY7A 3Q6IA 2M32A 5ESRA 5ICSA 3QH8A 2BEUA 4KQKA 3O8RA 2BMAA 5K4MA 1IHUA 2CVFA 3QVXA 1EM8B 1M74A 4L5BA 2IYYA 1QIJA 2I7XA 4ROTA 3TG2A 2CDNA 1C8LA 2HBQA 3OZSA 3DV0A 1KBQA 1N0WA 4ZKEA 2D00A 3D59A 5LQSA 5HNKA 2WU1A 1XR3A 3ZWOA 4A4DA 2FZLA 5AI4A 1M5UA 1OB2A 1WKCA 1U2DC 2A67A 1XALA 2QAJA 1BMFA 4KXXA 1KZ1A 1ZXXA 5LD2C 1NVUQ 2BI4A 1K6EA 4W8GA 1M6NA 4G1FA 5C53B 4C0KA 1ICIA 2GILA 3EY9A 1F3LA 2RC5A 4J7XA 5BN4B 1Y8QB 1KZHA 3EIFA 3WWZA 1A8HA 2JK1A 3K1TA 3LLCA 7ABPA 1WBDA 3NW9A 1XP8A 3I28A 3MW8A 2Z43A 5FI0B 5K0CA 3OIFA 5BNTA 5BUSA 3M6WA 4ZVKA 2J6CA 1EK6A 1QB8A 1YBMA 2AD1A 3IKJA 5C4MA 3X1ZA 3ZV6A 1ISHA 4EA8A 3O7WA 3SE7A 1YZUA 3CZCA 3T7KA 4BTEA 3ZNPA 1T6YA 3GL9A 4LDNA 1QPBA 5KYKA 1QMPA 3W1WA 1B6SA 5KPJA 3OICA 2ZDGA 3U31A 4BNNA 1RC8A 4KYTA 4WKGA 3F6YA 3QLUA 3WHLA 4LYDA 1DX9A 4DWVA 1NFFA 3HA7A 4Y2SA 1SUIA 4ZVOA 3DEAA 4MROA 5FAXA 1Y7LA 2X9LA 1C8BA 3WLIA 1JHDA 1IHPA 4XW2A 2V9CA 2WK1A 3UJAA 5THKA 1EU1A 2RBKA 3IVRA 4OTZA 4B9EA 3IALA 4CMIB 3UB2A 2FZCA 4RPCA 3KXDA 5CT4A 2YQ5A 2BR3A 3FCSB 4QODA 3NWPA 3INYA 3KPJA 4MUJA 4MRPA 4B4KA 2GBIA 3BWCA 3LCJA 2FEOA 4DV7B 1M8FA 1MXHA 3SSMA 1RYHA 2GN4A 4HRAA 4DN6A 3IKVA 2ONKA 1F1BA 1N2CE 3TXYA 4DR7B 3RROA 4G2TA 2P9JA 4AY4A 1K6JA 3ADRA 5BUCA 3HB0A 3K5HA 4RKRA 4F4JA 2N0SA 5FV4A 5CCDA 3SFTA 2I65A 3QLTA 3HADA 3SPUA 5JAUA 3GVCA 2C3YA 2BFCB 4LC1A 1KVUA 2FW8A 3GJ0A 2YWHA 2GCIA 1EVYA 3D2CA 1SRRA 1E20A 3E0XA 2Y77A 4IHQA 3U5TA 4Z60A 4MYUA 1T4MA 4TMXA 4OA8A 4O3MA 1L5ZA 2O54A 1U3VA 4BMSA 5A1JA 4BN5A 3KJIA 4LV6A 1OE0A 1N8KA 2ZBQA 3A37A 3BT7A 5A3VA 1ODCA 3ZNNA 1RKXA 4UVGA 3UA3A 5JD6A 3QLVA 3GLIA 3D0QA 3ND7A 2I4OA 2O7VA 2HIMA 3DGFC 1KAHA 3BN3A 3IBGA 1JR3A 1I32A 1Q15A 2FHSA 2Q3BA 2XDYA 2QWXA 3N8NA 3O0TA 4G2NA 4KFSA 4EO4A 3CCCA 3SHOA 5E6SB 5DMHA 2FU5C 3GJXC 4X7RA 4Z49A 3K9QO 1PLJA 2VBFA 3WWCA 3L4EA 1I2CA 3SVZA 2REXB 3AFGA 2CNKA 1ZOPA 3DFKA 1YC2A 2AFHE 3LH5A 5C7OO 1EDZA 1G4HA 4YT5A 5DM2A 1Y37A 3X1DA 3P19A 4BIIA 4B5LA 5ED0A 4DQXA 2C7PA 3N6XA 2FJUA 4G0ZA 1SQ6A 5C7IO 2BSAA 4PDXA 4BV8A 4A6DA 2ZR8A 3VHRA 2GD2A 4M21A 2BJHA 4PV7A 2XWSA 2IF2A 3H11A 1K7CA 5K3FA 5IF9A 5JSQA 4RGVA 2QRMA 1F2UA 1JHVA 4G5RA 4DQUA 1RWMA 3EOBI 5DHRA 2IWHA 1NF2A 5A04A 2HWWA 4R5MA 4JKYA 4DLSA 4M9QA 4C6RA 3I9FA 4IFIA 3DNMA 2FFBA 1FNDA 4G24A 5PGMA 2D2EA 4G0PA 3AVUA 1R00A 3G59A 1LBQA 4LTDA 2W6ID 1RAIA 2YYYA 4O29A 1QE0A 2P9ZA 3MMZA 4YV2A 2ZI7A 4KVFA 4HZGA 2WJYA 1LLCA 2YWJA 3P4UA 4P32A 5E4TA 3G2IA 3LLSA 5DTJA 5LWHA 2PXXA 2RCYA 3LX5A 2NT4A 3IMGA 4Q02A 5EUCA 1JLHA 3UUGA 3K9NA 4EYBA 2KE5A 4M6WA 4AO8A 5HR5A 1U3FA 1UKAA 4JC0A 1IBKB 3NC0C 1K6IA 1E3LA 1IQRA 3HJTA 3MGGA 3MOSA 4E5DA 5JNSA 2ZSHA 1Z7BA 5TXGA 2C59A 2APJA 2CD9A 3QUAA 3UK0A 2Q2OA 3MBKA 4TKMA 2P6RA 3F0TA 1OKKD 1WA5A 3DDWA 1CJSA 3C16C 4MVCA 3ZHBA 2IE0A 4OHPA 4A2CA 4R2IA 1T10A 3JCZA 4BWVA 4CMAA 1LVGA 1VP9A 1YDHA 3R9KA 3PNMA 3C87A 3DLPX 5AHOA 1KI3A 4QTZA 4HCJA 1V7PC 3L7KA 3RUPA 3H5TA 4WLUA 4Y6QA 3HDTA 3ETLA 4X71A 2GBGA 1X8KA 1HDEA 3OTHA 4JBLA 1XPRA 1I9CA 1ODFA 3U61B 4D9CA 1K7EB 1U8YA 4Q4HA 5IMBA 4C20A 1Y6RA 4BKUA 4CV1A 3OWXA 4NABA 2HHCA 1MMFB 2PCLA 3ED1A 1AK2A 1SBTA 2OYCA 3LQFA 1IUNA 3B1XA 3IVGA 3KXPA 2HB9A 2E85A 3ZNQA 1GZHB 3ZWXA 4J8PA 4P0QB 2CF6A 3AI3A 1E6UA 2H2DA 3FFTA 4EO9A 1VXOA 1GQQA 4GQBA 4HO1X 3ZHSA 5DPXA 2X3YA 4AAYA 2Z56A 4M7PA 4MVJA 3G9TA 4OHRA 3UENA 4KE9A 1XLWA 4M4SA 5JH7B 4B3XA 5EZ5A 4XASA 3CZPA 1P1FA 4Y6PA 3EPHA 2BFWA 1FU7A 4YR9A 5L3SA 4QELA 1W9HA 3VI3B 3ZZ1A 2EHDA 2CUKA 2OXIA 1C41A 4HAZA 1KJ9A 4IOJA 4HSEA 1XB2A 5ECDA 4D4IA 1E9DA 4OUDA 4JS0A 1V1RA 1E4EB 3MB8A 1WXQA 3ZYCA 2WU4A 2GHTA 2RHOA 1UDCA 3H1GA 3BDAA 5DNAA 5KVVA 3OSZA 2HF2A 2XWBF 1RHJA 1USWA 2EBHX 3CZ4A 2BFKA 3L6EA 3TQSA 3NNDA 4LXGA 2CLOB 3OHSX 2O3RA 1KY4A 3WL5A 3GFRA 3SIRA 1YBHA 4C4RA 3MOIA 2P1EA 1H0KA 4D9MA 4KEPA 3HU1A 1TEVA 1HDIA 1AQ6A 3STWA 1SKYB 9LDBA 2D5LA 4NOJA 3P0JA 3D4NA 5F7OA 2O7QA 3UCXA 3UUWA 5I5GA 3B3JA 4NOKA 5A6SB 4B87A 4F7DA 3DXYA 1GZ4A 2BG7A 2R86A 1R6XA 2K4MA 4OQDA 2PXCA 2Q0SA 4YRNA 3BXOA 5LR6A 3RARA 5CNJA 5E1BA 1YVEI 3CF6R 4BNDA 1JHUA 1T2AA 2GZHA 1S9DA 3FAIA 4NS1A 1ISMA 3LXUX 4AYXA 1X3LA 3FYSA 2CNBA 3EWNA 1Z9BA 5HRCA 5HK9A 1QDEA 4ZN6A 5ELMA 3ROKA 1ORHA 2RHLA 4NV1A 1DXYA 1KY3A 2F8LA 3KQTA 5LP6F 5E4JA 1G9SA 3N3BC 2VHWA 5E3JA 3OO1A 3T94A 1VYHA 4A0SA 1IN1A 3AJDA 4CKCA 2OBFA 3T7RA 1QVAA 3C8ZA 4QASA 1UOPA 5JNUA 1E6CA 3DMHA 3VTKA 3H75A 1WW2A 5EE9A 1B0UA 1T5TA 5T67A 1GAXA 4WXEA 5B1SA 1T1EA 2ZB4A 3UAZA 1PF7E 1MAHA 2XUJA 4CUKA 2P5SA 2NU6B 4J07A 5FQNA 3U3XA 3WIOA 3K70B 5L8VA 1KEWA 2M1XA 5JDCC 4RHCA 2FQ1A 1GGJA 3BE6A 1N9KA 2ZIUB 3Q7IA 2ACEA 2H2HA 3DZHA 1XQ1A 1W52X 2GS9A 4DGQA 1VHTA 1NMSA 1B0PA 3AJEA 1R0WA 4TZTA 1TZCA 4V2UA 1O5OA 3IVXA 5BW5A 3P32A 3OT1B 2AOUA 4MR7B 4TYMA 5EHIA 5EJGA 3ZIAD 1Q1BA 4PXSA 4H0CA 4ER3A 5C7LO 5AR1A 3PQCA 1IBLB 1U3UA 2C5BA 2CHVA 4HQRA 3PA8A 2VPPA 1KHTA 2VUIB 3K1YA 3UTDA 4AJPA 1X7XA 1NDUA 5HRAA 2Y1KA 4YBZA 5JQWA 3QEBZ 4RKEA 5KDDA 1HFKA 1QYVA 2G71A 2E7ZA 2NUAA 2Q6OA 3D3JA 4EUSA 3F8SA 3HJAA 4MW2A 4UEOA 4BBJA 5LXTB 5TIIA 3OQNA 3NBKA 1M2NA 3DUFA 4ZQCB 1Y7HA 3RODA 1RXIA 1Z7GA 2MSCB 5AK5A 3HRHA 1KMMA 1AQLA 2ZSUA 4MSUA 3TPFA 4P34A 3FMOB 1NUSA 1VL5A 2GZSA 5KYTA 4BMPB 1FS5A 3GNQA 1FYDA 3NT5A 4Y1FA 1NVVR 1UMBA 4RA6A 3BM5A 4MH0R 4ZI7F 1DIBA 3AHHA 4RQTA 3EFHA 4JLMA 3AFOA 2Z08A 5KMGA 3HZHA 4Y2YA 3M8KA 5J9FA 1J7JA 3U7RA 1DELA 3LLMA 4Q9LA 5JVDA 3GFPA 3EGXA 1I1QB 4N8EA 4C0SA 2ZUVA 1PE0A 1YA6A 4NIMA 2VIIA 1L5RA 1Y3HA 2IKQA 3PLNA 1GSIA 1UCFA 3AUJB 4HJXA 4HLNA 4RGQA 1ZC3A 3AY7A 3X2EA 1NNEA 3RSGA 4TVSA 4RDXA 1DJPA 1CQJA 3IEVA 5CTJA 2ZS9A 6PFKA 3EPRA 1FFWA 2VDKB 3NWEA 2BHRA 3O4HA 2IH4A 1TJ3A 4OXNA 2XRYA 1XKTA 1Y1QA 3MTBA 5C3MA 1QBKC 1UMKA 3KK0A 5JPDA 3LP8A 3OTIA 4J9UE 5JCPA 4UWRB 1SXJD 1P60A 2XT6A 4HNQA 5C31A 2ZTLA 3UYLA 3DC2A 1ZH0A 5TPWA 3KSBC 3NBQA 1LPAB 1NIPA 4UCQA 4V39A 4QM7A 4LCJA 1RTTA 4LQCA 2FPMA 5BQPA 1ENZA 1XTPA 1T5SA 1HOXA 2ZQZA 3JQQA 4XPIB 3RABA 5JBIA 2XEXA 3KPWA 4DWJA 4R2MA 4L08A 3VTAA 4PSCA 4HPXB 2HOQA 4KMSA 2C4WA 1A76A 1NVVQ 3CWZA 3UCFA 5IUJC 2Q3JA 3QVVA 1Z2DA 4G26A 2FFRA 2QRVB 3SYMA 2C2MA 3E9QA 4CETA 2PFSA 4JROA 4ZGBA 1DX6A 2FZ4A 1T25A 1ZJ5A 4JASB 3S2EA 4GKKB 4MO2A 1PQYA 2G1AA 1UZAA 2P90A 2GM4A 3NDPA 3EVZA 5BN5A 3PHBE 4KAJA 5JWOA 1KRXA 4YC7A 3QXGA 4LDJA 4ARIA 3KEOA 1K5HA 1M6EX 1X1SA 3FPBA 1ETHA 4K6FA 4LGCA 1KIFA 1JLKA 3ASVA 4QOHA 1XZHA 1JBKA 1HQKA 3M82A 3MGAA 4QRIA 2J5KA 2VWPA 2FPGB 1XRLA 2D0DA 2HJRA 3CZ9A 1GQFA 2B4QA 3K16A 2YUIA 4LHEA 5T57A 4OK6A 1WXIA 3AHIA 3TW6A 1DKPA 1YS7A 3GNSA 1AZWA 1LRKA 3ABRB 1XQ9A 4I50F 4Y2JA 2V8BA 1UWCA 1G5QA 4FYKA 1FSFA 2XDWA 4E5PA 1FC0A 4N5LA 1QIMA 4DBLE 4BXOB 2I6SA 3ABZA 1NVFA 1LLFA 1VI2A 1BVRA 1OC4A 4Y2UA 1T35A 2OCPA 3MQ2A 4H4DA 4UXJA 3GW8A 2NUTB 2VTBB 4HEA1 5ILQA 3C24A 5ALGA 5DXAA 1TA0A 4QUJA 5EVKA 4R0VA 4LS3A 4B2PA 1I7PA 5K3SA 3HB9A 3TSYA 1TUGA 2Z4SA 2C9YA 1N2IA 3DEYX 6ADHA 2EKLA 3NV9A 2PWAA 3VKFA 2FU6A 1TD9A 2B4RO 4QQFA 4I1PA 1CF4A 2RI6A 5EHTA 1QPZA 3WSVA 5JXIA 1DXQA 3KJZA 5D00A 3B89A 4TKUA 1T0PA 4X7BA 4TLAA 1IIBA 1HL7A 1ZM9A 1DRUA 1YS6A 2O1WA 4BEBA 3QX9A 3N59A 4BQSA 5LZ8A 1ZM2A 4AECA 3NHKA 2GN9A 4CG1A 2R1VB 4HPWA 2WU3A 3KU4A 1F48A 3UMSA 1WUTA 3S1LA 1NT4A 3KEQA 1IHOA 4XCQA 5F33A 1JVNA 1Z35A 2B37A 5A5FA 3AVYA 1RABA 4YXWD 2PUVA 1WVMA 2ZBPA 4TS3A 1Q16A 4HGZA 2IYEA 1Y6ZA 1TLFA 1TJPB 1LK0A 2IY8A 5E3IA 1EWQA 4BGEA 4P62A 3ADKA 4EHHA 3LT2A 1CZNA 3FCOA 4V0OA 5FULA 1S2IA 2F9MA 3EQZA 3DEZA 1MB3A 1M8PA 4UNPA 1FUEA 2CDCA 3FPKA 4OBEA 2J3JA 5H16A 1PFUA 3QIAA 3EZNA 1GU7A 4IF4A 2EL7A 3OEHD 1Z6GA 2PANA 4M8IA 3WBKA 1HQCA 3PE3A 4TV9A 3EIOA 2Z5VA 1NI3A 4GYKA 2ZWVA 3FPHA 4RTLA 3OF5A 5E2IA 2F00A 2PGAA 1WF3A 2RDMA 4Q4JA 1ZL0A 5JDIA 4JP5A 3QWHA 1TYZA 3BE8A 2VK8A 3GFGA 3LYHA 3RG8A 4TL9A 3WRWA 2HDOA 2ISSD 3FB1A 2TMKA 3ICPA 1Y63A 2VWHA 1WEKA 1P7CA 4M0EA 2Y76A 5ACUA 4OYHA 4LBWA 2FRVA 4RIHA 3S2ZA 2D0OB 3HABA 4TL6A 1F6WA 5C1IA 3PEWA 3AVXA 1QXSA 2CHEA 2FSVC 1Y4UA 3UMFA 5M2QA 3RHTA 4LJYA 3WYEA 4J9VA 1EWVA 1UT8A 2IXEA 2Z5LA 3PWTA 1L7RA 2UUPA 2W42A 1XTKA 3K5PA 3NBAA 4ZTBA 2WT8A 3IDSA 2NXJA 1S9HA 1CJMA 3F71A 1NM5A 3KPUA 1YZQA 4K6GA 3GDGA 1U2RA 5L3VA 3QE4A 3A6ZA 1R4MB 2F43B 3WAGA 4J0KA 4MVWA 2VYFA 2XUQA 1CUUA 4JR1A 4NATA 2GZMA 4BVLA 4NKRA 4BQQA 5CA1B 5C9ZA 2M5DA 4FJ2A 2H08A 2V7XA 2WHQA 3DR3A 4Q9DA 1T13A 2ZJAA 5FD8A 1PR5A 3GGCA 5BRNA 5GV7A 2B6NA 2ZYSA 3PGLA 1AF7A 1CY4A 3BXPA 1IVYA 1FXWF 1OYWA 2TSYB 1C1HA 3GZNB 3MGKA 3OZXA 4O4JA 1BX3A 2QM0A 5B6IA 5HJ2A 4CN8A 4PS1A 2Q1TA 3M6FA 5JSZA 1QCZA 3U16A 3IEXA 3K5WA 5JU6A 3VNQA 5AVVA 2OPHA 5ALMA 1PZNA 1PFWA 1VJCA 1CZKA 2G3YA 4FHFA 4Z4IA 2X0JA 3GBSA 3K72B 3HQ4O 3WWOA 2A9JA 5JJIA 4BECA 3KLMX 1O8BA 1ORDA 2DSTA 2H4WA 3N76A 2MYNA 2V4ZA 2YIDA 4WDRA 3SZRA 2Z1NA 3WJ1A 4ETNA 1S1MA 4RZIA 3BVPA 2ZRQA 4L3WA 4OXIA 1QNFA 4JMLA 2HU2A 3M1IA 4YV0A 2X8WA 2VAPA 1T8SA 2QE6A 2RKWA 2XVXA 3FUCA 2IYNA 1BXKA 2XNSA 4O4HA 7ADHA 2ONCA 1TTPB 2MYTA 1NNSA 2EKDA 2RHWA 3AV3A 3BTOA 1AKVA 1AVTA 1OFTA 3AZOA 4Q18A 5INTA 1MGOA 2Q4BA 3G02A 1ND6A 4ZGGA 1PT9A 3E1SA 5AW4A 3A9SA 5MGBA 3HXQA 1ANKA 1MV8A 1TZBA 2OHOA 4NTZA 3NLLA 4XEHA 1NG9A 2FHXA 1AS3A 3S7TA 1MAWA 2G76A 5IWAB 2XVMA 4U7HA 3BXZA 3B9BA 4WRRA 2R8PA 8AT1A 2QYHA 3TUZC 3KT6A 1U4SA 4Z9FA 1O96B 1U8EA 1LXCA 3FROA 4B71A 3P0IA 2WJPA 2AFIA 3OHMA 2A0XA 4BB6A 2KQUA 2XTJA 4OGFA 1GZ5A 3OI7A 1GPBA 4J7CA 2G1JA 3CRRA 5KOHA 2EZ4A 3D8NA 2D2XA 1QF9A 4PGHA 4RVCA 4C21A 2YY7A 2E21A 3FPGA 1DV2A 3X2YA 4PLWA 4YRFA 3NHLA 1O3YA 1MABB 1E94E 3HDHA 4GKVA 4K0RA 1B2LA 4X1YB 1FP4A 7REQA 1V8PA 1Q44A 3R3UA 4MUEA 4KB5A 2QW1A 3G85A 1SJ9A 3HKCA 4CQLA 5K4GA 4PVCA 4F5ZA 1BCRB 3G0CA 3GOHA 1PQPA 2N42A 4M83A 4Q9JA 3UJPA 3ACDA 1USGA 5A5ZA 1P72A 1AB5A 4CZ2A 1JDBB 1RXCA 1JH8A 2UZ4A 4AB1A 4C3ZA 2ZANA 5TF0A 5IFKA 3AR7A 5ACSA 2AS0A 4J03A 1NN5A 3G23A 1LU9A 2QZJA 1CDEA 2Q42A 1JWBB 2GGSA 4ZU6X 3KL7A 3FVTA 1OZ0A 1P77A 1AHIA 3H9BA 4PPQA 1ZUWA 4RIFA 1YQWA 4P81A 1AGNA 1NJ5A 3DVQX 2GCEA 3PS9A 4PAQA 1JE0A 3WTCA 4F7WA 1SAYA 2V4UA 2J9RA 1IY8A 1J99A 1L7DA 3V2GA 1BTOA 4FR0A 4RYDA 1OT3A 4X8LA 4ZT2A 3WLNA 5ES3A 1R2QA 2G1KA 4BVJA 4CL0A 1HX7A 4N7RA 1AKEA 5CVVA 4F92B 1U1DA 4HWKA 1P9LA 2BM9A 4WX2B 1QFXA 5IC5A 3S1AA 3PUVA 4B0OA 5LOVA 2E49A 3FH0A 4DTCA 3K94A 1J49A 1HMPA 4MA4A 4EHAA 1IMJA 1H9AA 1N2GA 1QH0A 2W2OA 3BXEA 2E7YA 1V26A 2PT6A 2RGNA 3IBSA 5JS1A 2HXYA 4Z7OB 4XX0A 4K9PA 2PSFA 3UK1A 2R8OA 2GNPA 4FD2A 4K26A 3VR1A 3E5NA 4O08A 2D4HA 1EP3B 2FHPA 2QV0A 1ADCA 4RVGA 3L41A 5AK6A 2RJOA 2C54A 3RSFA 2BFEA 3DWFA 3AG5A 3CRW1 4TSFD 3I4FA 3UXEA 3L5KA 2XYVA 3E48A 2I1QA 3L07A 4GZ5A 3T3IA 4FYJA 5C52B 5AUOB 2BLNA 3FN4A 1EK5A 4HS9A 5KJ1A 4U7DA 1WLSA 1GNSA 3RSOA 1CULC 2Y68A 1A50B 4HNGA 3CLUD 4LNUA 2AW5A 2YHIB 4PR0A 1TM2A 2Y0DA 2V98A 3OTWA 1SVLA 4EPTA 3MWJA 4DV1B 4R1OA 3HNPA 1JFFB 5EQJB 1JXQA 2HMVA 1EM6A 1KGDA 2H0RA 3DPUA 1JFRA 4LAFA 4UM7A 1GDDA 1CDDA 3B3AA 4MWSA 1D3AA 3TLMA 4DR1B 2ATXA 4C7OB 3KAKA 2D2FA 3HB1A 2WJIA 1ZEMA 3MWKA 5I9TA 4CG3A 3UCEA 4DV5B 2LE0A 3VSCA 3AXSA 3R5JA 4LZOA 1DHTA 4YJ3A 4FBLA 1MX3A 2PCJA 2QN9A 3FG9A 1UBHS 4UM9B 1PT7A 2QJFA 1SOMA 2G5GX 3X30A 3SI7A 3N5CA 3HMKA 4DCCA 3V6LA 3V8QA 3LK7A 2AKEA 1EIWA 2NNLD 3KWJA 2XXAB 3P9IA 3ZD9A 3Q88A 3AB7A 3OZUA 3TRFA 4WBSA 1ZJJA 3E61A 4MTLA 1XZ8A 3AUXA 1L6RA 1V6SA 2BEKA 1I2MA 2NW6A 3AHJA 3VNVA 2DETA 2BDTA 1LPSA 2XF2A 1DG1G 3L7BA 4NMWA 4EHLA 2D74A 4AICA 2CHGA 4EVSA 3S2YA 1A9XA 2KHZA 4B3FX 2FKAA 1CY0A 3MS4A 3A06A 5I9MA 4YMUA 2QTRA 3K15A 4MV1A 5AUQA 1JR2A 5FYQA 1KAOA 3LF1A 3NJ8A 4Q82A 2X0FA 5DCLA 1O9HA 4ZVRA 1JAIA 3RGWS 2ZG6A 4QC2A 2GK7A 3PLAE 1EXVA 4PONA 1GNQA 3AQ4A 3DJFA 3LS2A 1YFJA 4MYCA 1GPMA 2BCGY 4K3UA 2ZRKA 3ROFA 3SGLA 2VJYA 2W8BB 2QUAA 4AZ3B 1XK7A 1OLXB 3RTDA 4DBLC 3OPQA 4BNLA 3ZWNA 2MINA 5ENDA 5KWJA 3LXXA 4EATA 2CXXA 2ZLBA 2AN5A 4E07A 4ZFNA 5KTKA 1TUIA 1K2VN 2FA9A 1ONOA 3A10A 3ZU2A 2IPOA 5JCZA 1SIBE 4M8SA 1O77A 2EJUA 4GYJA 1CIJA 1W8DA 3MOGA 4HXFB 4TTAA 3NVMB 1CNEA 1PDWA 4A0FA 1QHYA 3F1LA 4AIIA 1ZVJA 5G3ZA 1Y8QA 3CJQA 2ZSFA 5DHUA 4MIOA 3IAS1 1ADFA 4E1AA 3DHAA 4BFUA 5BQXA 4GPZA 3R7FA 2A1UA 5KZMB 4RULA 4NNPA 1HUQA 5I47A 5ITWA 5AW0A 5EG5A 2EFDB 3AC0A 2H3EA 3NRBA 3UZUA 2PJRA 4CEIA 1G66A 3T5GA 1PNOA 2WJJA 2G06A 1GEEA 3HJNA 4F11A 2GWRA 4GBGA 1EWRA 1T4BA 4WY8A 3WRXC 2ZO4A 4KJXA 4MW9A 4OMFG 1PR3A 5C46F 2FRDA 5FKJA 2OV2A 2PLNA 3JWGA 3SMVA 4P33A 3NDBB 1SKBA 2DTEA 2XYRA 4JFAA 4C1NA 1DARA 3A6GA 1UBUS 1TAUA 3ZH9B 3L6NA 4LOHA 4DR6B 3I37X 4F4IA 3KX2A 2YVKA 1Q7RA 2JVJA 3Q7EA 4JQCA 3KZXA 4PRKA 4ZQIA 3O82A 5HA5A 2G0TA 4FZJA 1QYIA 5AIAA 2EQ5A 3PV0A 4M7RA 4QOFA 1ZYUA 2YNTB 3ETJA 1HYBA 3UHPA 2OHXA 1JE1A 5CLIA 3A6DA 1HTBA 2PGOA 4P4NA 3HKEB 3I9NA 1QVVA 2VZ0A 2WILA 4RESA 1DO0A 3UEOA 3KDPA 1E6WA 1WCIB 1N6OA 2NG1A 2PE5A 4HDSA 4PSKA 4PAMA 4GVLA 2RB4A 5C8ZA 3AWDA 2C95A 3DS8A 4MS1B 5AH0A 4Z6KA 2A30A 4PHTA 5CH5A 4S04A 1HE4A 1EX1A 4XB1A 4LZJA 3EF3A 5I7RA 5HCIA 1E66A 1F4VA 2ZETA 3LCUA 3QI2A 1U99A 2OV6A 4KQXA 1EVZA 2ZSKA 4GLBA 1I6LA 4YJHA 3Q8LA 1H4VB 5BV8A 5GP1A 2FN4A 2XUOA 3GZTB 4U2EA 5BN1A 1SQ0A 1MH9A 1UXIA 1LI4A 2R1TB 3KKMA 4HRVA 4P08A 3KU1A 1ZICA 4RDIA 1OPRA 1BVHA 2FEKA 3I9MA 5CXSA 1QQTA 1ACMA 1BE1A 5F9MA 2ZVPX 3AM5A 3FLMA 3NM6B 1G6Q1 2YICA 5JAIA 2YNUA 1Z8FA 4KQ1A 1U11A 4P53A 2ZAMA 3RVSA 4U9UA 1NVMB 1GQSA 3VH2A 1NRJB 1Z2NX 2AG6A 3S81A 3LOQA 4L6AA 1BEEA 2ZTMA 4ALKA 2MTBA 3EVAA 4XJXA 4B45A 2JZNA 4FJ1A 1FFXA 3NWJA 3QK7A 1NHGA 4QGHA 4TTQA 1Z28A 5EA2A 5F21A 3CU5A 5IBQA 3AESB 2DUMA 2JANA 2XXBA 3D8HA 5G41A 3KYCA 3B12A 4MI1A 3VC1A 1WZUA 1ES9A 1FLAA 3NDRA 4X45A 5EJIA 2HKIA 1K6MA 2AE1A 5SY6A 3PQEA 5GGXA 2C2BA 1D6JA 1Z88A 3FZNA 2PMBA 3TMAA 1CQWA 3CUTA 1FMLA 3D3KA 2PO5A 3CNLA 1ZNWA 2AT1A 1N2BA 2RGCA 3KQQA 4ZAYA 1PV1A 3SJCA 1VCNA 4CKEB 2Z5GA 4QJBA 4ARSA 3HBAA 3DAGA 1E2NA 5KREA 4OHKA 4V0RA 3T1NA 3NO4A 1CVIA 1TGYA 3AR5A 4J29A 2C82A 1LVHA 1Q21A 2BW0A 4BJHB 3JRWA 2QTVB 4GL4A 2QG4A 2ZSBA 1QFYA 5L7TA 5HZGA 2UXBB 2MR5A 2B6HA 2RGGA 2FWBA 2WD7B 1V5IA 1AXRA 4IV8A 3OQVA 3U3DA 1L1QA 1P19A 1V48A 1VBNA 2ACWA 2ECOA 2D3TA 3TSWA 5JHGB 2IOHA 2XUGA 4D74A 2EZTA 4IDEA 1Y5MA 3IERA 3E3AA 4F1WA 5A7FA 1BMFD 5DVZA 5HIQA 3KEGA 4RQBA 2CLEB 2WHRA 2Z8YM 3R7LA 2CNLA 1WUOA 3BHNA 5ACQA 5ABPA 3C43A 2DWQA 4ZVLA 3D6HA 2AG5A 4Z7NB 4JI4B 2H3HA 3WLOA 5ED4A 1ZPDA 1IATA 4ZODA 4F2GA 4NHOA 4Q1DA 1GXSB 1X7WB 2WV7A 4FIZA 2NGRA 4IVQA 2XUAA 3QELB 3VKUA 3VZRA 3WTBA 1YRWA 4HL2A 1FDRA 1S8NA 4E6PA 4X63A 4ZCSA 1N2EA 1GCUA 3AUUA 3OCCA 1MF7A 1E0SA 1PNVA 1UM8A 2QG9A 3GEGA 3K0FB 4RA9B 4U00A 1IJFA 3ABSB 3WNQA 4AROA 4B6OA 5ICCA 4DR5B 1EFRA 3KTAA 4FWIB 2OSBA 4FXOA 3IJRA 2X4DA 1ZD4A 1C1DB 4UEQA 4M1ZA 5CFQA 2DKOA 3WZ2A 1Z6AA 1XYYA 3FR7A 5B15A 2WJAA 3IEUA 4IDGA 4D0NA 1ABEA 4F3TA 1F8UA 4EW3A 4ZV9A 1ZDMA 5DM0A 3L01A 5E9JA 4RZ2A 2OZKA 3FKJA 4IFEA 1ZC4A 4WJZA 1I1OA 1QX4A 1HY3A 2SNIE 4HNRA 4P5EA 1EE2A 2RHGB 1B3BA 1QF7A 1E4EA 5AJXA 5ICMA 3DVAB 4R1NA 3H2ZA 4U7FA 4YA6A 2BFNA 4HAUA 2OXTA 3W9BA 2WWTA 4D02A 3DT9A 3K2EA 3A6KA 1QH8B 2RMKA 2X41A 3BWVA 4IINA 4JSRA 4DRYA 4V03A 1XEXB 1Z5VA 9LDTA 4CIBA 1KYIA 1M2HA 1NX6A 1TMYA 1TQHA 1AMUA 5B3AA 1EFCA 1UBTS 3OMWA 3BYZA 4GGMX 4QPDA 2ID4A 2KMLA 3V7FA 2DFTA 2VHJA 1RPNA 2X42A 3HWWA 2NVUA 5IC4A 1YVUA 1EVQA 1VLVA 4OQEA 3NAQA 4Q66C 2YWXA 2ORYA 3QA9A 3T95A 4J0GA 2YJZA 3GRFA 3JQ6A 1FXUA 1Q0QA 3W5HA 4AN0A 3L7OA 1GAJA 2RAPA 4QULA 3SLKA 3ZDQA 5KINB 1U9IC 5ERGB 4DZTA 1DCTA 2WDZA 2GRUA 3WG9A 1JX6A 4M87A 4RPIA 4DDWA 2C98A 2XCRB 3IMFA 1G21A 1IZ7A 2XLCA 3N2KB 3ND6A 4AJEA 4XCXA 1L9YA 1JFSA 3U7IA 1VCOA 1SK8A 1DAEA 3JQFC 3U6KA 2O3UA 1S7CA 4BNZA 1P2BA 4MV9A 4DLWA 4PG8A 2NYPA 1JR3D 3SYNA 3CF2A 3UG6A 3BWEA 3FGOA 3KVVA 3WRVA 4YCSA 1YS1X 2A9VA 3LQ2A 4D4JA 2QYTA 4LWZA 1Z6ZA 4H3SA 3M0EA 4ALJA 4ESHA 4WCFB 5ITZA 5K3OA 2VCHA 5KQRA 3W2TA 4ND8A 4NSNA 2GAOA 1M5TA 2WQ7A 1T5BA 1DUSA 1A9ZA 1L2TA 3K8ZA 4MVJF 4O33A 3PGJA 1AHPA 4D6YA 1UMDB 4HUTA 4F91B 1U2QA 1YJAA 4KR6A 3CLSC 3RVNA 3WDSA 4PX5A 3EEQA 3DL7A 3WK6A 1QFSA 1ZGHA 4TT3A 1QO0A 1Z15A 1Q0SA 3AB8A 3W3AA 4LWQA 4U2DA 5F2OA 3OCXA 2FWJA 2QZ4A 3KZCA 2H4ZA 3ET5A 1PYDA 3VPAA 4HNAA 5F51A 3MGBA 4HWGA 1FX1A 4TWJA 5B4VA 4MB6A 1ZFNA 3OT1A 2VA8A 3FX2A 2AHOA 3CM0A 1A8TA 1QQAA 2VRWA 2MSWA 1F3OA 4DB2A 5KYGA 3A4NA 3U60B 4J0HA 3Q3HA 1EFVB 1V47A 3TVYA 2VHVA 3EQ7A 1QJCA 2OB1A 2R6HA 4JNKA 4Z51A 1SVMA 1ADJA 3C70A 3RUCA 1I9GA 3DDSA 3ENKA 1MENA 4HBGA 4IQFA 5GVRA 4X1KA 2NU8B 3TLGA 1UANA 4B2IA 3PPYA 4CM3A 4M76B 1HRDA 1I4EB 3FPCA 3SBDA 4DIFA 1JZSA 4MUBA 2QW0X 1T4GA 3KB8A 3VM6A 4DWOA 1FRZA 3K2IA 4YAEA 5EZQA 2BGKA 5C7YA 4TLMB 5I7AA 4EAAA 4Q4AA 1JYEA 2CVQA 2LDXA 3R7WB 2GJAA 3TQFA 3UAWA 3VZSA 1PNTA 2REQA 4Y6GB 1EWTA 4JLKA 4F4UA 3OJWA 1DC7A 5B7PA 1OB5A 5JZOA 1RRGA 3O73A 4A5OA 5LQMA 1IB0A 1W4BA 4TKVB 4ZOQI 1X94A 1R6UA 5AM5A 3AQIA 3TOZA 2HNAA 2E0IA 1E2FA 2X76A 1Z39A 4CUJA 5B4UA 1AV6A 1H9CA 2YZ3A 3RG2A 1YNOA 4ZYXA 2IYVA 3C5CA 2LDBA 4I2VA 2EXXA 1ZMBA 5IZCC 2V0CA 4W4TA 4RCYA 1XU9A 4BEJA 1EP9A 2OY0A 2CL5A 4DSUA 3UWKA 1YZYA 3U17A 3QW4B 1RXUA 4DGSA 4YP5A 5IZ4A 4K7JA 2E4ZA 2X2OA 1TT5B 1D07A 2SKEA 3T6KA 4AF8A 4KW7A 4BX3A 1U2DA 1QYCA 1UJMA 4Q3AA 4MVJD 3KFXA 4DQLA 1BX1A 3OOSA 4Y2GA 3C98A 1OF1A 2EOAA 3C6YA 5CDFA 3W8NA 3OETA 3BGVA 1YHYA 1AUOA 2QLNA 3A26A 3D4OA 4Q1AA 621PA 4LE6A 3SS7X 4RPLA 5GQSA 1NLFA 3ADCA 4DSOA 2JFVA 3OT5A 4DMLA 1P2SA 5FFFA 2CFSA 1UWVA 1JI0A 3PZRA 4H6WA 2AIRA 4KQCA 1UEXC 4Q03A 4RY0A 5EJFA 2O2ZA 3NC4A 1SN7A 1KRWA 3KELA 1GPNA 2HCTA 4QYTA 4CMBA 4NR0A 4UTOA 3KETA 2PIDA 1A7JA 1TB4A 3UJ8A 2BIBA 1P73A 4DQ0A 1IIRA 1D2GA 2JFYA 3U7EB 2J8ZA 1DAFA 1U5CA 4DG8A 2PZJA 4ZOAA 2VTKA 3VPFA 3ZGVA 2HH9A 1Q1EA 4NJOA 5KUTA 1Y4DE 1B1CA 2QZSA 3BJRA 1GUDA 4HDRB 4HGOA 3SICE 4BNYA 5ACPA 2G4VA 2XWJI 1IVSA 3TLBA 4RC9A 2TYSB 2FPGA 3IC5A 4R1QA 5LPNA 3L43A 1CNFA 2BH2A 3C3KA 4PLPA 1ZRMA 2EV9A 2PZBA 2JKVA 4L76A 2I1LA 3LTEA 4BNGA 4N6NA 3W4JA 1QZUA 5KHOC 5JVDF 1NZDA 3Q0TA 2OG1A 5SZIA 5LQUA 3Q11A 2ZCJA 5ALSA 4BXOA 4IG9A 4ERNA 5CB6A 4DR4B 1DWUA 4L3OA 5COAA 3USZA 5BSMA 4IM7A 2V6JA 1MJGA 4NDNE 3NHFA 2J6IA 4AV7A 1QK4A 5TQ0A 4ZZ3A 2R48A 1CUAA 1P1RA 3DBIA 5CH3A 3NMUF 5FBLB 4XJVA 2CSUA 1X1CA 2P2LA 2P2NA 1R0BA 3FR8A 3FYTA 4GMKA 4QUEA 5K2MA 4G01B 4CM8A 1NQ5A 3NAZA 4MP3A 1T24A 5K6AC 2IF0A 4D0RA 5L6MB 3LUDA 2BELA 3PEVA 3BWMA 1OFHA 4Y0NA 4FFOA 1UPTA 5IARA 4PWZA 4LNAA 3GLGB 3TJRA 1NJGA 2AYZA 3QHAA 3ZCQA 1RVV1 2R9VA 1Y34E 1VBFA 2L42A 5K0JA 4IJ5A 5J4VA 3ZHXA 4U2CA 4NMMA 3BFJA 2HNKA 1OTYA 2X5OA 4GKAA 1D4OA 2R1VA 2NAFA 2PX8A 2GN2A 4BZQA 2G09A 3NANA 5F2NA 1ULZA 1ZVVA 1MQ8B 5JC8A 3TOCA 1ADBA 5MF6A 1W5SA 2HN9A 3EPKA 4HFJA 2JAPA 1M0SA 1MORA 4JJEA 2OMEA 3KFVA 3RIYA 2ZSJA 1VJ5A 2BSQA 1R88A 3DBHA 2ZCUA 3DLAA 4X94A 5CJ2A 4N0DA 3A2MA 4JIMA 4YJKA 2QL9A 3BB4A 2Z5FA 1NXVA 2A5DA 2XNCA 3H5IA 3QE3A 4PHCA 4EF6A 2QU7A 4PHHA 4ENRA 1WUIS 4LOLA 3S28A 1BW9A 3V5NA 1EJBA 3NASA 3PHCA 3M1LA 5HMLA 4EJMA 5EAIA 5DMXA 2BEWB 4TPKA 4AP9A 3O38A 3SKYA 2H5EA 2ZI5A 1OLSB 1XVVA 2G40A 2ZRIA 3GMDA 3UW3A 1Y33E 2GYUA 1HETA 2B4KA 1FTYA 3P0EA 1G63A 1I14A 2B36A 3R0XA 3NP7A 4LSWA 1N33B 1WZEA 1AC5A 2JI8A 2PL9A 3H2YA 3OA2A 4HQLA 3HH8A 4RIGA 4ZC8A 4INJA 2BM8A 1SR8A 5HCNA 5A4KA 3KKLA 1ZD3A 1YGYA 1FF9A 4B3DA 1BDMA 1IULA 4DLTA 2FZGA 5JZMA 4MWDA 3ZZTA 5KYYB 4UWSB 2YY5A 1XAGA 4LOKA 4UFNA 2ZXUA 3BS4A 4BDTA 1YFKA 1W36D 5D51S 5DHQA 5A3SA 4EUHA 3ZY4A 2ZRCA 4DIUA 3BSWA 4Z3DA 2Q1YA 1T15A 4IGIA 3MT0A 4ZKDA 1IQPA 1B8VA 1JSXA 3TTUA 5DTRA 5JRZA 4ZANA 1NOKA 4B46A 1R4MA 3WGYA 5A71A 4A3SA 1O7JA 2IW3A 1Q0UA 3K20A 4V2IA 4DQKA 2XMDA 3CUWA 5JT1A 4TTRA 1P0CA 1HYEA 4JY7A 4X24A 1AGPA 1X7GA 2CEAA 4M0UA 3KXLA 3UWDA 3HEAA 4BATA 4KX5A 4M86A 3II6X 1DRKA 1JJVA 1O97C 3I6IA 4EA6A 3JATA 3IUPA 2OLEA 1YCGA 3OH8A 1LX7A 3A36A 1IN4A 2VQ6A 4RK0A 3W6OA 3WKAA 3G5MA 2JAQA 1EZZA 4QEKA 4UEWA 2VEDA 4PNEA 3GZNA 2ES4A 2ZTVA 4MV4A 1YXMA 3JQRA 4RHYA 4ZT4A 1A72A 4YHHB 4E0BA 2CV1A 4IICA 4B32A 3G0DA 3HKBA 2I2BA 3HC7A 1Z12A 2XOEA 4RJLA 3TK1A 2EEPA 2IZ5A 2O6HA 3N0WA 4YP9A 4FE3A 3T5PA 1Q11A 1G7SA 3SYKA 4BFLA 3OM9A 4DIKA 4L28A 4EIWA 3C3XA 3FUVA 2GEVA 2W2KA 1SBHA 3U4GA 1PSZA 2ZBEA 3KD2A 1ABFA 1WM1A 4TV8B 1R12A 4HLCA 4XIGS 3UAVA 1QIFA 1V9LA 4W9NC 1R9JA 1GYRA 4TV9F 1YQUA 4GOOD 5DV9A 2HSDA 3FFAA 5LCHA 4CJXA 1WUKS 4UMDA 2PX4A 4YUXA 4LWOA 1Q5PA 1U80A 2R8ZA 2QSUA 4NESA 1NW6A 4HEA6 1Z16A 3VZQA 2B34A 1T3HA 2IITA 2C4HA 5I4KA 4RWEA 2IXAA 4QSHA 4B6RA 3WFIA 1P9WA 5I4IA 4GXTA 3E18A 4DDHA 4ECAA 2JLVA 1I6MA 1RAGA 1ELOA 2Z57A 3PXDA 1CZUA 2A94A 3TI7A 5HGXA 3G9ZA 3W3AH 3WR5A 3WK5A 5BQFA 5ADWA 1D8AA 2AR7A 1W47A 2FZEA 5U4QA 3ZD6A 4LEIA 2FW1A 4FLFA 3LBHA 4G8CA 4DNFA 2RSLA 2YJTD 5LU9A 2I6XA 5GPBA 3A7EA 1GYPA 3WI7A 4HH1A 2I2XB 3EXHB 1SC3A 2LXNA 3UB4A 5HQJA 3AGQA 3QMWA 1NG1A 1MVNA 1GG8A 1WVIA 4KTVE 3GJ8A 1SXJE 5DX0A 3DNPA 4E7PA 4QO8A 1ZK2A 3GEPA 4LF8B 1GPAA 1FVOA 1G1MA 4PVDA 3U13A 4KFTA 4RFVA 2NSYA 5TNXA 2V1UA 2NU7A 4N4AA 3BQNB 1RM4A 1XTOA 2AJDA 1RWPA 3CJTA 4Y1RA 2COUA 4TXJA 3AYZB 5ALFA 2FSFA 5EESA 1JN0A 3ESXA 1RJDA 2WINI 2UZAA 4KXQA 5IP5A 3V46A 4DLRA 1BCRA 1I4WA 1K8ZB 1DV1A 2OKCA 2VH1A 4Q9HA 2I54A 3H9GA 4FCCA 3DD5A 4P7FA 5DBEX 1HE2A 2W98A 3T06B 5CFZA 3VR4A 4ZOBA 5KQSA 5CIYA 1CUCA 4E2FA 4O4JF 5L4LA 2DBQA 2ETXA 1R6BX 3V1UA 5B3JC 2UUAB 3T3PB 1V39A 2YC4C 1G8JA 5HJEA 2ODQA 3DPIA 1OH8A 1QGDA 2AB0A 1C50A 2BGIA 1FMTA 4RLQA 2NSLA 5DXJA 1DNPA 3TS1A 1AXGA 3T9FA 1E7RA 3UGTA 4W5NA 2FMUA 1FU4A 3EEYA 4I1UA 3MMNA 1BD4A 1QLHA 2W2LA 3DE4X 4JVNA 2XV1A 3D81A 5K2OA 4RMHA 3AXTA 3N6VA 4IDQA 1U0FA 3L0DA 3SXJA 1FSSA 2IYOA 3ULKA 1OWPA 3Q3VA 2XA2A 1BRMA 2PLRA 4ZCTA 2AG8A 2BR4A 1C2TA 3PENA 1Z5NA 2GHQA 2IUSA 4O4HF 5HS6A 3CUUA 1CEYA 3E03A 1YUBA 4WBXC 1NRIA 4QBHA 4XWOA 4FDUA 1OIXA 1G5TA 1E1RA 2NVBA 1AKWA 1XEWX 2BGLA 1TCCA 2JJ8A 3GF4A 3GEBA 4L78A 3D43A 4HWOA 4WNAB 1MW8X 1CLUA 1XWIA 3AFNA 1J1ZA 2QP9X 4GM1A 4WGFA 3WDLA 3QSYA 4G36A 1X87A 2HJGA 3DOUA 3VR0A 1V5WA 5SYAA 3IQIX 4ZVTA 1F8GA 3NB0A 4FQ7A 1IQUA 1RVDA 3OC6A 4XTRA 2CXHA 4PPYA 3D0KA 1MW9X 1YNSA 5F7JA 5WRFA 2M6RA 1G41A 4OHVA 4LJRA 1BMDA 4D79A 4AWZA 3F6RA 2JRCA 3WS7A 1AQYA 3WKCA 1Q84A 3OIUA 3D4PA 4EY2A 2PKEA 2ZBRA 3BMOB 1VSQA 4TVOA 2R97A 3ZZ0A 2Q4EA 2YHIA 2O2IA 3Q12A 5K03A 4G0XA 4URWR 1NBMA 1HNWB 3SPXA 2ZATA 4HB3A 4UHFA 1JFFA 3AEQB 4JI6B 1F4PA 3FYUC 1EUDB 1ULAA 5KVCA 3HXLA 1N1EA 3NNSA 4C7OA 2QT9A 2AW3A 1QFMA 2BG8A 4J1NA 2IPXA 3HLTA 4KV9A 4BY9E 4D26A 1GDTA 5LFAA 3M9WA 3REFA 4O1HA 1A9PA 1XTRA 4IIDA 4IFBA 4QOSA 3EA4A 4YTEA 5LKAA 3UBTA 2F3PA 1UFRA 3FM9A 1CUGA 2WT9A 3VO9A 2EF1A 1J4AA 1KETA 3N53A 4XM2A 4PQRA 1P33A 4L5AA 4WZAE 3UAOA 2EYUA 1U9YA 1XZPA 2GVZC 2PGLA 3LPAA 4BQRA 4TSRA 1V41E 1H05A 2CFRA 2RARA 1AUVA 4B79A 2MSKA 1CUIA 2JCVA 3IJ5A 4UUMA 2BTOA 1THMA 2G9RA 2O6LA 4R8LA 3TLEA 1Q1NA 2Z8XA 1PJCA 3T3GA 2AIOA 1WKBA 2WT4A 2JEYA 4Z9YA 2I76A 4L8LA 1JG1A 2JIQA 1OXSC 1UH5A 3HMQA 3LDFA 4P3YA 2V5AA 5ES4B 3VHXB 1M34E 1M3SA 3AO0B 2BKAA 1PQWA 4AULA 1YMQA 4ZXFA 1NATA 2OP0A 5LOVF 3QYFA 3IVAA 3H6HA 4IL5A 4PFSA 1LDYA 3P1JA 3BEDA 4JLSA 4NJMA 1N7HA 3P96A 3N8HA 3SC4A 4B4OA 5BV7A 2FW7A 4DLAA 3HM9A 1BMCA 3SJUA 5F1OA 1N5IA 4C87A 4LMAA 4ZCQA 5JMOA 4PVOA 3A6FA 3T54A 3H2JA 1NKVA 4MITA 2WYMC 2W8BA 4AZ3A 2N75A 3BWXA 3CJRA 2FN3A 2CL0X 3LWBA 1KO2A 3BFVA 5AKIA 2VT2A 3OOJA 4KSBA 3ERCA 5C8DA 4BPRA 3RVQA 1E5QA 3E23A 4MPRA 3X1MA 4A16A 1O1YA 2PKWA 1CQIB 3IL2A 3UT5B 3SC2A 1N0VC 2DLDA 1RKVA 1JL3A 3DQQA 1TM3E 4L57A 4BGVA 1Z74A 4MTCA 4M88A 3RVPA 1V1MA 1DOZA 1JQAA 4DSTA 4OQNA 5EWLA 4LWPA 3GYGA 3NPAA 4M0LA 1U7OA 2E1RA 3SZ3A 3WQQA 5LDGA 3DE7X 3KYDB 4YX9A 4LE2A 4M0PA 4LXTA 3RVLA 5FWYB 2WTEA 1R37A 1YJCA 2BGUA 1BH2A 4W8OA 3S44A 4AK9A 4UNNA 2YNVB 2HV8A 1NVWQ 3ORHA 3PWSA 5DNYB 2P2CA 1QANA 4YJ3F 2XMBA 3QF4B 4ABTA 3SP1A 4UUQA 3G8AA 3DM9B 2EFJA 4J1QA 2XF8A 4QGBA 3ZE7A 1S3FA 1MJFA 1E1KA 3MJHA 4PYNA 4JYMA 4B4UA 1JPJA 2VP3A 1Z0SA 1G38A 4W5JA 5F98A 4BNKA 4W63A 1LSJA 1Z4KA 2VDMB 4H1WA 4ZYWA 5FTLA 1R5NA 3DP9A 1YU9A 2VP5A 5KPDA 2R751 4D45A 3VVCA 3RS2A 2BYTA 3CCBA 1UK8A 1P8AA 3QEOA 1ECLA 3F6BX 4FOOA 1ACJA 1Z56C 1S96A 5JYCA 2YJNA 1E1DA 4G5YA 2GLUA 1ZBDA 3AU8A 3EXFB 5EWMA 3S5JA 5A5EA 3KR1A 1E9AA 2V7QA 4DLLA 3A2NA 1JJ7A 4UBNA 1OAOA 4C7VA 1Y1KE 3JPWA 2GKLA 4UU7A 3WLEA 2R87A 3PDIB 4IVPA 3ZTWA 4JLUA 1NT2A 3QU9A 1Y7TA 2P7IA 4CMGA 3H4MA 4JJIA 1XZFA 4JUCA 4KLRA 1W85A 1FEZA 2V9PA 4DDUA 3DP7A 4ID3A 1FP1D 4KGVA 3RYIB 4DCMA 4F8JA 5AVOA 5LWQA 2ECFA 2RJNA 3QOYA 1VG9B 2O2DA 4UCXA 5DPMA 1HR0B 2B69A 4JKOA 2EJVA 4URHA 3SJZA 3K0SA 1EGMB 5JISA 4NV0A 4ZT6A 3G89A 3A04A 1Z8HA 4Q05A 5EJ8A 5KNBA 3I6ZA 3U4QB 3QP9A 3BRQA 2W2MA 2C92A 1FX0B 4ON9A 3P52A 3AERB 5CB4B 3HK2A 1J39A 1SUWA 3H83A 4C4ZA 4LGVA 4R9VA 2ETVA 1WU7A 4MQFA 3MTQA 3U0VA 3TWOA 2YZNA 2Y4NA 2NZ8A 3DKPA 2Q07A 3TZLA 1NR7A 4GVPA 1F60A 5KEIA 2AN1A 4R7GA 2R8EA 3EGEA 1RRPA 4RM3A 5B30A 2GF9A 1YCDA 2ATVA 2B2CA 4MKRA 3SZLA 2N9UA 5IEBA 3H8WA 5JPCA 2I2WA 2VXYA 2IWRA 3DC7A 4L2IA 2Z3WA 5L3QA 4B6JA 2I66A 4JP1A 1F0PA 2WFZA 3IKLA 1GZDA 4JLJA 3U26A 2IHNA 3BDIA 1PS8A 4KPFC 1DCMA 2RK3A 1KS9A 1YKGA 3WGHA 4YI5A 3B82A 3T9AA 1D9XA 3A3NA 3JX9A 1KJQA 2AJBA 4B44A 2HLNA 3GT7A 5TMEA 3QZUA 2JI4A 4LCEA 4C4AA 1PR2A 4O1MA 5EXTA 3QE9Y 2VH5R 2RK6A 3EISA 1PWYE 4LQDA 4YJ2A 2YJ6A 4DL9A 4HNUA 1B6GA 5KKNB 4FDAA 4ZDWA 2BKEA 2Q7XA 1U90A 4I4TA 4OQMA 4YEDA 4GIBA 1NNUA 5CXQA 3A6PC 4WQMA 1WO8A 3PQ3A 4D9BA 1PX0A 4DEYA 3MT9A 2IYXA 4TWAA 2QBYB 2QK4A 4RK6A 4Q47A 1DEKA 2J7KA 4YJGA 4MPDA 1TQ6A 2HIHA 2C8JA 4P4SB 1F4LA 1UPXA 2GM5A 3AZPA 2XCOA 4HNTA 3LC7O 3K70D 5I4CA 4NNOA 3RRBA 4GL2A 1Q0HA 1R0LA 3IV9A 2WD7A 4Z4HA 1K8RA 2I4TA 4WH0A 5E4FA 2BEVA 2YJGA 2VJPA 3FIJA 2CCKA 4EJSB 1ZJWA 3PNKA 3IAS6 1PBTA 2EGUA 1VMEA 4HEHA 3OM1A 4FFBB 2ZP1A 5AHKA 4Z0PA 5K01A 4JBWA 4CEJB 3GCXA 3Q72A 1KSFX 5EIXA 3C3JA 3VR4H 1QC5A 1X9HA 5K8IA 1W87A 1P4HA 3A1WA 4H7HA 4KQEA 4Z8YA 3T1YB 1CE8B 1C3JA 2NOAA 3GFVA 4GMXA 4CKBB 1OBFO 3CBGA 5ALKA 3EDOA 3SKXA 2GXAA 4MW0A 1GXSA 1WY5A 1X7WA 1ISIA 3SQMA 1JIIA 4Z5ZA 3PFKA 1SXJC 4QUGA 3OEYA 1L5KA 1DOAA 1ZBQA 4NONA 3RFUA 4NQ5A 1OU4A 2X40A 4M49A 3V7NA 4GP7A 4XCVA 3DMNA 1Z25A 3CX8A 3H5RA 4RA9A 4RAOA 3EZ7A 5DM1A 4AC9A 3Q3GE 2X8AA 3G7NA 4A7PA 1MU0A 5KOIA 2PA0A 1TECE 3BL8A 3G2KA 4WAUA 1VPWA 3DE2X 3JY6A 1TYDE 3ZWFA 3T12A 3EIEA 4QTYA 1W2WB 2CUZA 4OBWA 3SM3A 3SR3A 4JYBA 5CDTA 2WTMA 3DTTA 3N2GB 4CE6A 3SEZA 2GA9A 4CMHA 3HV0A 2BIFA 4Y2XA 3RSSA 1YKFA 2FW9A 3T9BA 3B1YA 3SEQA 1QAQA 4CUZA 2Q29A 4PCVA 3BGOS 2J0QA 1O9BA 1KP9A 3ZCVA 3DVAA 2GN6A 5I5EA 2G83A 4UQLA 2X1LA 2IE8A 4V38A 2G1UA 1NURA 1XQ6A 2Y2VA 1UXGA 2V59A 4ZT7A 3COYA 4YFVA 1X0VA 2QG6A 2ERXA 1REQB 2V0NA 2VC2B 1H3FA 3G79A 3LUKA 1E1QA 4RF3A 5DBIA 1L9XA 4QUDA 3HU3A 4K87A 4PSDA 3TSZA 1P7WA 1CLEA 1CK4A 3GLHB 5LYJB 3BWYA 3NBYC 2OCAA 5LLSA 3ZEIA 1U94A 5ERXA 2VZ9A 2DR0A 3ZN2A 1QQ6A 4GM0A 5DT2A 5C34B 3S8YA 3K6SA 5BSFA 2IEYA 2BD0A 3DE0X 3W5IA 4A10A 2AFVA 1U0EA 3LKBA 4ETIA 4RZ3A 5EWAA 1LFAA 3ZI0A 4ZP1A 1DQSA 2C4KA 3LSYA 1Z4MA 4G5QA 1ODJA 1BKYA 2DCUA 4YPOA 1U8FO 2X5JO 2EKZA 1G8FA 1VHLA 2OMKA 3NFRA 4X9XA 4IS2A 4CXMA 1JR6A 3MS2A 1E7QA 1WPGA 2QSYA 2ZUWA 1XRSB 1EDEA 3N2KA 2HPZA 4R31A 3KKNA 4Y8VA 3RW9A 3BOSA 5FNZA 1I4LD 3K6KA 3KQKA 3GT0A 4ZO6A 3PXUA 5EN4A 1W30A 4TSKA 3VYVA 1KBZA 5LZ7A 2D5AA 2DOOA 1P6UA 3BG5A 1X1AA 3F90A 3TDNA 2B94A 2JPDA 3BMXA 3D7MA 3BJMA 2AG0A 4XVCA 3LIPA 5EJMA 1NVTA 2WYHA 5DIFA 2IYAA 5AXBA 5F77A 5EZ6B 3LJKA 4IQ4A 5FBQB 3THXA 1YHZA