1YCGA

X-ray structures of moorella thermoacetica fpra. novel diiron site structure and mechanistic insights into a scavenging nitric oxide reductase
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
398
structure length
398
Chain Sequence
SQPVAITDGIYWVGAVDWNIRYFHGPAFSTHRGTTYNAYLIVDDKTALVDTVYEPFKEELIAKLKQIKDPVKLDYLVVNHTESDHAGAFPAIMELCPDAHVLCTQRAFDSLKAHYSHIDFNYTIVKTGTSVSLGKRSLTFIEAPMLHWPDSMFTYVPEEALLLPNDAFGQHIATSVRFDDQVDAGLIMDEAAKYYANILMPFSNLITKKLDEIQKINLAIKTIAPSHGIIWRKDPGRIIEAYARWAEGQGKAKAVIAYDTMWLSTEKMAHALMDGLVAGGCEVKLFKLSVSDRNDVIKEILDARAVLVGSPTINNDILPVVSPLLDDLVGLRPKNKVGLAFGAYGWGGGAQKILEERLKAAKIELIAEPGPTVQWVPRGEDLQRCYELGRKIAARIAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray crystal structures of Moorella thermoacetica FprA. Novel diiron site structure and mechanistic insights into a scavenging nitric oxide reductase.
pubmed doi rcsb
source organism Moorella thermoacetica
molecule tags Oxidoreductase
molecule keywords Nitric oxide reductase
total genus 134
structure length 398
sequence length 398
chains with identical sequence B, C, D
ec nomenclature ec 1.-.-.-:
pdb deposition date 2004-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ycgA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1ycgA01
5HH4A 2BIBA 2GSWA 2MT9A 4PU0A 4C1FA 1QH3A 4GYUA 2A5LA 1XYYA 2AIOA 1JJTA 2BFKA 3FVWA 4RAWA 4Z60A 1XM8A 2NXAA 1VMEA 1XI2A 4M0CA 1SMLA 2QEDA 3W79A 3IEKA 3PY6A 4BMOB 1OBVA 4UWOB 3EDOA 4TZ9A 5ACXA 1ZWLA 2AMJA 4AX1B 2X2PA 3KAPA 2WYLA 1QBGA 3BK1A 3OX3A 1GG5A 5IQKA 3N39C 3N3BC 4FGJA 3I0VA 4NQ6A 5LJLA 5FX2A 5ACRA 3IE0A 1YCFA 4QOGA 2P1EA 2ZNBA 1ZKPA 1AHNA 2Z9DA 5TGZA 2FOXA 5KIKA 3T3NA 3G1PA 1QR2A 4C76A 4D1TA 2FHXB 3S0ZA 3GAMA 5HH5A 2FCRA 3KAQA 2NYPA 4PTZA 3IOGA 1BMCA 2Z9CA 1HLKA 3ADRA 5K0WA 3AJ3A 4OXXA 4HKYA 3DH8A 2FZVA 1TIKA 4YSBA 3NHKA 2WC1A 1XYVA 2XOEA 4EFZA 1XTOA 4ZO3A 4RL0A 3F2VA 2QWXA 1YCGA 4C14A 1YOBA 2Q9UA 2X2OA 1CZRA 4EXSA 1AKQA 4Y9RA 5HH6A 4HS4A 1FLNA 4ZVMA 1AKTA 4R81A 4Z67A 1WW1A 4F6ZA 2YNVB 1D4AA 2HB9A 4C1EA 2BTNA 1A7TA 2QMZA 3JSXA 5BUCA 4XUKA 4FGKA 2I7VA 4AWYB 4F8YA 1X8GA 1CZLA 4NQ4A 3S2YA 4RAMA 3P2UA 1SG0A 1A8TA 2FU7A 3FJOA 2P4ZA 4LE6A 1RLIA 1KO2A 5B3LA 3NHUA 4CHLA 3I11A 4D1VA 5EMNA 5A0TA 4RBSA 2FU6A 4GCWA 4C09A 3NHYA 2CBNA 3Q6VA 2Z98A 2RG1A 3QFCA 1X77A 2HNAA 2ZKIA 3KNSA 4D02A 3AF5A 3FNIA 3B6MA 4N9QA 5AEBA 5HIOA 2QX9A 1B1CA 1YRHA 2FHXA 1L9YA 1FLVA 5EH9A 3AF6A 4WD6A 4S24A 3X2ZA 1KBQA 1FLAA 3DHCA 4Z5YA 3IEMA 3IELA 5AYAA 2P97A 2UYXA 4DILA 1FLDA 1KO3A 2QMYA 2DOOA 5FQBA 5HIQA 1KBOA 1ZX1A 1WRAA 4Y9UA 3SRXA 3HR4A 4YAOA 4H2DA 2WYMC 3B6KA 3X30A 3GFQA 3N3AC 5A87A 5A5ZA 4YSLA 3VQZA 4UBQA 2QR2A 1J8QA 4PVOA 1CZOA 4GR9A 1FX1A 3NHRA 1M2XA 4QOEA 4C0XA 5A4KA 5LVAA 2A7MA 3SD9A 1X8IA 1D04A 3U7RA 4UWPB 2YNUA 4EYLA 5EWAA 3UXEA 2BZSA 4N82A 4C0WA 1DD6A 2BG8A 3SPUA 5LM6A 3OWXA 2Q0JA 4LTNA 4TYFA 1MQOA 4ZVKA 4J5FA 4D1WA 1V4BA 3HLYA 5K4NA 5ACVA 4YSKA 4H0DA 3T9MA 1FVXA 4QOHA 5K4KA 1I1OA 4GYQA 3LCMA 4QOJA 2M5DA 3SW3A 3DHBA 1DXOA 2FU9A 2GFJA 5ACWA 3KL7A 1J9ZA 5LJIA 4HEQA 5FQCA 2R96A 2R97A 2YZ3A 2XR1A 2P18A 2V5UA 4NULA 1SQSA 1QH5A 4QOFA 1XT6A 2FVXA 4QOIA 2YNTB 1CZKA 1RLJA 2V9CA 2DKFA 4LTDA 3KLBA 1WUPA 4ICIA 4YAFA 1T5BA 4J5HA 2MTBA 3ZHOA 2BGAA 5LBTA 2AZ4A 1J9GA 3NLLA 2D5IA 4BZ3A 4ZEJA 1H69A 1DXKA 2FLVA 2V5VA 3L9XA 1ZWKA 2BF4A 5LE1A 4NQ5A 5LSCA 1WUOA 3NHFA 1RCFA 3F9OA 2ZZIA 4TYTA 2QX8A 4RL2A 3I13A 1K07A 2BFZA 4ESEA 2VW8A 4FR7A 2KLBA 3BC2A 3F6RA 2BMVA 2BN4A 4LA4A 3I14A 1VJNA 4Y7CA 4FEKA 4XWTA 2WHGA 4PTYA 3SFPA 2I7XA 2M6SA 3LT5A 3PY5A 1H66A 2QJSA 4UA4A 4NLLA 3OX2A 3T3OA 2Y8AA 2OHIA 2FK6A 4U7GA 3B6JA 5K4MA 1WSBA 2QX4A 3KEGA 3EYWA 3QFRA 2YNWA 3F6SA 2Q0IA 3ESXA 4D1UA 5AXOA 2GCUA 3IOFA 1YCHA 4HL2A 1P9EA 3ESYA 4N65A 4EY2A 1VGNA 5NULA 3LVZA 3H3EA 1OFVA 2YNTA 3ESZA 4U7FA 3FAIA 5EHTA 3X2XA 4NQ2A 4QODA 1Y44A 2GFKA 1DX9A 5ACSA 3F90A 2BG8B 5FUQA 3ZR9A 2BR6A 4DIKA 5ACTA 3JXPA 4GI5A 3O2NA 1WSWA 3TZBA 5LBUA 3BV6A 2FDXA 5B3KA 5LLDA 1KR3A 5AXRA 3IE2A 4JO0A 4AD9A 4CF6A 1TLLA 1JJEA 4C1HA 1DXQA 4U7HA 2ZWRA 5AHOA 2NZFA 2MOKA 1NNI1 2BG7A 5B3RA 4H6PA 4BMPB 2ZO4A 2OHJA 2YCBA 4KEQA 5JROA 4UWSB 5EV6A 1JT1A 4RM5A 5B1UA 5EVBA 2HPVA 4PVTA 1J9EA 2H6AA 5HISA 3KNRA 1BU5A 2BMIA 1C7FA 4KEPA 2OYSA 4UWRB 3VPEA 4B87A 5ACUA 5LMCA 2OHHA 2E7YA 2MWMA 3K1YA 2GMNA 4C1CA 1YDGA 2YNVA 3D7NA 5DPXA 3NHJA 3NFRA 4FGLA 3UXHA 5AHRA 4CETA 3OVMA 2FAXA 4UAMA 4J8PA 1DDKA 3B6IA 3O73A 5FA6A 4XDGA 2Z9BA 3W7AA 3OJWA 3WXCA 2Q42A 1BVYF 4YAWA 3ESHA 3GFRA 3RPCA 1BC2A 4BP0A 5EVDA 5EV8A 4ZNBA 2QDSA 4P62A 5F4BA 3U7IA 1E5DA 3OX1A 3FW1A 5FQAA 3R6WA 3X2YA 3IDZA 3FCZA 2BC2A 4LAFA 1CZNA 4TZEA 4ZO2A 3MD7A 2ARKA 4F6HA 5B15A 1QHEA 5LS3A 5F12A 2FX2A 4FSBA 3A4YA 5HIPA 1FTGA 3K20A 4AWZA 2HNBA 3TEMA 3L6NA 4TZFA 2B3DA 3OWHA 3W77A 4XDHA 4YQEA 3PG4A 2N1MA 1AMOA 1T0IA 4AX0B 5LCAA 1JA0A 5EA2A 2BPOA 1AG9A 2WYMA 1ZNBA 1RTTA 3NHSA 3I15A 4Z6XA 4C1GA 5ACQA 1AZLA 1AKRA 2FU8A 2Y8BA 3SVLA 3OJXA 3NHLA 2GKLA 2FZ5A 5ULLA 4ZVLA 5F51A 2BFZB 3R2UA 3IE1A 5NLLA 4Z5ZA 4FX2A 4O98A 3ZQ4A 3DHAA 1F4PA 2M6RA 5EAIA 5LCFA 2KQUA 3ZWFA 3RKJA 1C7EA 3TP9A 4ZVNA 4TZBA 4YAUA 2NZEA 2XODA 2Y87A 2WRSA 2BG6A 5ACPA 3P0RA 4Z7RA 3RPEA 1CZHA 1OBOA 3FX2A 4DY4A 5LCHA 3G5MA 3ZNBA 1AKVA 2QINA 3BK2A 2R2DA 2Q62A 3NHPA 1CZUA 5EW0A 2F1OA 2M5CA 4HL1A 1FUEA 4EYFA 2QX6A 1BVTA 4U4LA 3ES9A 4XWWA 1ZTCA 2I7TA 4EYBA 2BFLA 1X8HA 5EVKA 5A0VA 3L9WA 4LTMA 3HA2A 4EXYA 3SBLA 6NULA 2FM6A 5KILA 1D03A 2XF4A 4C1DA 2QDTA 4V0HA 3QH8A 1AKWA 4GQIA 4YALA 3GFSA 1YKGA 1AKUA 2W5UA 3TE7A 2BG2A 3W78A 3QE2A 1JA1A 3NHWA 1QRDA 3RKKA
chains in the Genus database with same CATH superfamily
1KFKB 3K9WA 2YWGA 1V5EA 1YWGO 2MT9A 4H6WA 3ZE6A 5DCLA 3G02A 1P1JA 3NVAA 1XFAA 1B6TA 2WWHA 3B8EA 1EUQA 3R3JA 3DM9B 3DV9A 4LJ8A 1UC5B 3FVWA 1X42A 1A8QA 5BWCA 5IYZF 4DLNA 1P7PA 1V71A 5ARBA 3DDUA 2YJ4A 3HJHA 3IQGX 5DNCA 3HR7A 1GU0A 2QTVB 3PYMA 4RORA 3W79A 1IULA 2CDNA 2X3YA 3SR3A 1IB6A 4QUKA 3X1JA 4NEGA 3TLJA 2KB0A 5ALPA 3ZDXB 5IJ0B 2AKYA 2F8MA 4FIZA 4HQNA 4TYNA 2JB9A 3V1KA 4B71A 4E4TA 2JVIA 4TYYA 3U7FB 2OHGA 1JSXA 5ACRA 1RJFA 3LHKA 2P1EA 4CMIA 3D8SA 3PRJA 2G83A 1UPBA 1AHNA 4YRTA 2YV5A 4LJ5A 1T2DA 2QTMA 5EZSA 3TBFA 3WGHA 3BVPA 4PQFA 1KMHA 3NAZA 1ODLA 5TARA 3H16A 1GXSB 4P7BA 5HM6A 2R7LA 4RS3A 4J91A 3A1WA 1IIBA 2ZE6A 3KWJA 4MTLA 2WWVD 1KSFX 3I8XA 4NDNE 5DULA 2WSMA 2G06A 4L4ZA 5HIAA 2HK7A 1XC7A 2Y2VA 5CJPA 5AICA 4AJ1A 1BHO1 4OSEA 2B5VA 4EB8A 1AA6A 2QRKA 2QRVB 3DNPA 1SM4A 1FYWA 1YA4A 1W49A 3EGCA 3ANMA 4RTLA 3M7IA 1VYVA 3W1VA 4ZRNA 3NX4A 1GGVA 1JDBC 5SICE 4EA8A 4GM0A 1ZSVA 2AV6A 3L7OA 4F9TA 4RGBA 4I5DA 2QYHA 2W8BA 1QONA 1QZUA 3ZGOA 4EFZA 1RQPA 2WB4A 4L74A 4L50A 2IFTA 5D5HA 3U44A 3EIWA 3T5AA 4UTOA 4DDVA 1OLUB 1U5BB 2ODBA 2R65A 1ZOLA 2X76A 4I3GA 4NZMA 3WMXA 3NHBA 5B7GA 4AXHA 1ZM2A 4QSMA 1UKVY 4NRDA 3U17A 3WS7A 1WF3A 1PR2A 3C3EA 5AKJA 4BJHB 5HH6A 1OA0A 1YONA 4ZVMA 2YWXA 1WCV1 3JQ6A 5C52B 2JCGA 4H9GA 2AYXA 1QMGA 2Q9AA 1P7WA 2DUUA 2F9FA 4FUTA 4G4GA 4GI3A 5TT0A 2IWHA 2G40A 3T7EA 3TGWA 3LZDA 1FVHA 1GO2A 4OO3A 2XYQA 1NJ8A 1A9YA 1VLJA 2O0KA 1SOAA 1HG0A 3W9BA 2D62A 1B42A 4BNGA 1H9CA 4EKNB 2HWWA 3QTBA 4Y1RB 4FGKA 1E98A 5I51A 2BJHA 4HDSB 3HDTA 1M34E 2ZSUA 1ZONA 5EI5A 4URYR 2QG6A 3ZUGA 1TI7A 4PYIA 1ZMBA 4RVHA 2BCGY 2FU7A 2A3NA 4MA0A 5B64A 4CHLA 2SBTA 3HKBB 3KXKA 1HDXA 3DFMA 4D1VA 1PGPA 1OSNA 2H5JA 3ZHVA 2ONZA 1XQYA 4IIGA 1E1MA 4QUDA 1QOPB 4K28A 4Q82A 3OD5A 4XQ9A 1XMJA 3G0OA 3LKBA 3U3XA 4EL5A 3W1EA 4AQDA 1PJ4A 1EIWA 4JD5A 1M6EX 4XIJA 4ARZA 4O0MA 3A2NA 4CM1A 1YBVA 1RYBA 1J2RA 2OCIA 5HTKA 2AOXA 3B6MA 3R3HA 3PJFA 3JZFA 2O19A 1CYDA 3O47A 5K0TA 5JDCA 4HX2A 4M9CA 2VQDA 1ETUA 3LWNA 4RJIA 3T3EA 1R0XA 1N3YA 3B82A 3SYMA 2OCGA 5J4KA 4DR1B 3IVCA 4QOFA 3RGGA 4BATA 3OZ7A 4U3JA 1RD4A 2QGFA 1JDTA 5BSRA 2XNHA 3A7DA 3ENQA 1YFLA 4OHOA 3OCXA 4EG5A 3SQNA 1OI3A 4RMJA 1FY2A 1ZCFA 2HW8A 5B53A 2VHWA 4IRMA 1QE3A 2ZI4A 4R83A 5ICEA 3HS3A 4WY8A 2W6JD 4CR7A 1AQYA 4Q4JA 4PZZA 2P8SA 5AIAA 2AG5A 2PLRA 4RA9B 2ZRLA 1COZA 2PGXA 4G2NA 5LOVA 1FUUA 2OXEA 3E3MA 1BFUA 1Z3IX 3HUEA 1S9HA 3HXPA 5B3AA 3RTAA 2ISSD 3D9QX 5F3DA 3RRJA 4CM4A 3U4HA 4ENRA 3DVAB 3FHCB 1UJCA 3NWJA 5AP9A 3E1GA 1BDMA 1XA3A 2YUTA 2FPXA 3BTVA 2DR3A 3F7OA 5TRTA 4R5MA 1W87A 1WMDA 5KNBD 2O5CA 2I2XB 4DJTA 3MOIA 2PTHA 4E1AA 5LQNA 5LM6A 3KJIA 1TJPB 2H2DA 3IP3A 4KWHA 4J5FA 4TYFA 1KP2A 3GY0A 1UC8A 4Q00A 4V38A 5A4DA 5K4NA 4HSGA 1ICIA 2E6UX 4FMDF 3TL3A 4EAQA 5AESA 4IIJA 3O94A 4OFZA 4IVQA 821PA 4MHOA 1ZVMA 1JMYA 3HU1A 5FLXA 1XXLA 2HQ1A 4PX5A 4I19A 4XPZA 4DQXA 4L1KA 1GQ2A 2HIMA 3EUFA 1Z4OA 2Z6QA 4FYHA 3MLEA 2WIBA 4IX1A 1YRLA 3IAM1 3CRW1 1XZIA 4IFTA 5KPDA 1M2VA 1SQFA 3VR6A 4NYMR 5BN4A 3V1UA 4QBHA 1XZEA 3MB5A 2DHDA 5IEJA 4ANFA 3Q1LA 5EJ2A 5FQCA 1Q0SA 3C7AA 4EYBA 2QN2A 2FQYA 3JZDA 4KHZA 4P53A 4WKCA 2HB6A 2FHSA 4LGMA 2GEVA 4QAJA 4AULA 4ES6A 4HNGA 4Q47A 3AP3A 2OEPA 1KAGA 5JS2A 1ABBA 5IKEA 3U2QA 2NU9B 3LXXA 3WGNA 3ORHA 4P3PA 4PC3A 4B5LA 4J2TA 3NV9A 1EX9A 4EHAA 4NJOA 2H4HA 2VP4A 1KO1A 1SQ5A 4RF5A 4DJEC 5C18A 4YUWA 1ZJJA 3NBYC 4WOPA 3TRIA 3AF1A 3FIJA 5DBFA 3VMFA 2Q3EA 4EY8A 4LMRA 4XUCA 4E5PA 1DFGA 2BGAA 2VHQA 3GIWA 4YACA 3MJ4A 1O8BA 2BI7A 3IAHA 4H7JA 4BBJA 1K9SA 4ZEJA 1IJEA 2DWUA 3FTPA 2J46A 4LVCA 4NONA 2XBMA 1G7TA 1BE6A 1ZWKA 3SICE 1NBEA 4BMCA 2PH5A 4NZZA 4AP9A 5HUJA 4NQ5A 3GWGA 3ILXA 2Q9CA 1NR1A 3K94A 4WOBA 4LFCB 1LDYA 4QBFA 3FNGA 4KTVE 5LQAA 1CDDA 1H2XA 1CUEA 1K07A 1GZ3A 3CXRA 4OP2A 4C29A 4QYTA 2JIRA 4WVFA 5AM2A 4PXYA 3D0RA 1T4GA 1ICEA 4O5OA 1IPFA 4LA4A 1KEZA 4NF2A 2KWIA 1X7GA 5CT6A 3QXCA 2ZANA 5H16A 8AT1A 4NV0A 3V8RA 1N78A 2ONJA 4HWRA 1M75A 1Y5NA 1E2KA 1HV8A 1CUAA 1YS6A 2W4MA 1VKJA 3KXDA 2RKWA 3LT5A 3T35A 4FOLA 1IN1A 3T3MB 1PS0A 3QA9A 4G07A 3ZLVA 1Q77A 4KV7A 3OE4A 2REQA 2W58A 4BV2A 4RSGA 1MIOB 5MF6A 3AL0C 5AUOB 1IVNA 4K9QA 3T99A 5IZ4A 4XA8A 3FCXA 5I48A 4NLLA 5H4GA 4QXMA 5A6SA 4LYEA 4BE9A 2HLDA 4MCJA 5GJBA 2VKQA 1JV2B 2QN1A 1WABA 3DVQX 3K05A 2QF7A 4XGQA 2BMFA 5JANA 4DR4B 5EIFA 1OAAA 1RJEA 2C4VA 3SBOA 1WBDA 2C7BA 1AV7A 1H23A 4P81A 4BQRA 3M81A 4GXRA 1Y3AA 1L5YA 4KGXA 3H1EA 4OATA 4BJ1A 5JDIC 1K68A 5TQJA 1QIFA 1G0NA 4EY2A 2XDQB 4TLAA 5EZYB 4Y0AA 1KI2A 1IONA 1Z0IA 2HEGA 4M1KA 5JZOA 4HI0E 5ALQA 5K01A 4FX5A 3FAIA 2DFPA 1T8RA 2ZIGA 1URPA 1R6XA 3SP1A 3STYA 4B80A 1BO6A 1ULZA 1P4JA 3RADC 1LSJA 3FG9A 2AL7A 3R5SA 2A6PA 2WF5A 4DC1A 4DCVA 1E62A 1V8FA 1VRVA 2ETXA 1RQ7A 2ECKA 1QKJA 2H8GA 2H5EA 3O4JA 1LF5A 3O90A 2PX2A 3P9XA 2G77B 4IJ5A 2C96A 1E7MA 4MVJH 4GG1A 5BMVA 2RHDA 3QVMA 2HDNB 2J0SA 1O95D 4BVEA 1PG2A 3BILA 3GRVA 3ZE2B 2XNCA 3EAQA 3OOSA 5B1SA 3UHFA 5IKPA 1I1HA 3A1EA 2ZVDA 2QZZA 5DHQA 4O2AF 3UWKA 1TVMA 4D42A 5KX5B 5AXRA 2WWXA 4D8YA 4ZV4A 3VR5H 3PENA 2IYXA 4CF6A 1RBYA 2RIRA 3DEKA 5ALDA 1XNRB 1XJ0A 4KO8A 5FV7A 3B8HA 1V3UA 1VIVA 1ZBQA 4JJIA 4EGQA 4DCUA 5HW0A 3JQFA 2R1VA 4TRRA 2IV7A 3VJLA 3ZGYA 1PL6A 3O0DA 3ZDRA 3LU1A 2AI1A 1Z6AA 2IJGX 2OXFA 2XQJA 3EH2A 5FIUA 3GP5A 1VJ5A 3P27A 2HKIA 5E7JA 5JDIA 3DFUA 4ZP1A 2PUGA 4DZZA 4CMBA 2BGTA 3RB8A 2V3CC 5DGCA 5THKA 4D4GA 2LKDA 2IUTA 2C4UA 3PUHA 2AI3A 4R4JA 3H1FA 3RARA 3TW8A 5CITA 1KI6B 4PZDA 2E4VA 3O8QA 4EECA 5KTPA 4D0RA 4AG6A 2ZUFA 4YDRA 1JIQA 3RUHA 3F8WA 3KQTA 1Y7PA 1BU5A 1GKYA 1W1UA 3Q3EA 4MMZB 4RGQA 5G02A 1J49A 1YQDA 1YA8A 4DMGA 5T7BA 1OAOA 2P77A 1T91A 4QFDA 1W36C 2UVQA 4MW4A 3KZNA 2FHPA 2PNJA 5HJ7A 3ILVA 4PNZA 2BEUA 2FUG1 4MPPA 4XFDA 5C46F 2AHOA 4IH9A 4IUDS 5JQGA 2W93A 3K7EA 3C6QA 4Q3OA 1ZN2A 4EEXA 2J3LA 1NMSA 3CV3A 1X80B 3GJQA 3GOQA 3IV7A 3WXCA 3QE4A 4IEFB 1E7RA 3C41J 2NSLA 3UBMA 2OYCA 4JASB 3C87A 2FR0A 4RVOA 5DN9A 3UJNA 5KTKA 1D1SA 1QX4A 4BP0A 1H2HA 2ZAYA 1EXVA 3SYTA 3U7IA 4OIFA 3T3GA 1EE2A 2FMUA 3LUCA 3MJEA 2OQIA 3QFFA 1RXCA 4KK3A 4CTKA 1KO2A 3WP0A 4RULA 1M8JA 4IHAA 3HWWA 3I64A 3VNQA 1JBKA 2YASA 1YZVA 1DG1G 3IMKA 3N8KA 4QPJC 5IEBA 2W2QA 1SVIA 2CLHB 2HMWA 3CHYA 4F84A 2YIJA 2C9DA 4YRQA 1GYRA 4PPNA 1QB8A 3ML1A 1RAIA 4CKZA 3BHMA 4DC0A 4PX2A 2WM9B 3GZTB 2OV1A 1LBQA 2J87A 5BN3A 2EG5A 3BE6A 3VNSA 2GRUA 4GLFA 3HPRA 4LS3A 1YF3A 1NXQA 3E58A 3EFOA 2EL9A 3COVA 3KR2A 3R5HA 1QRAA 5GINE 5CVUA 2QP9X 1U0SY 3NEPX 1DIBA 2N1MA 1BDJA 4HXGA 1N2CB 3LUAA 3CSDA 1E6LA 1QV6A 3EY4A 4XRRA 4XQCA 1JA0A 5TQ0A 5EA2A 1U2RA 1TQ8A 2ILTA 1B8UA 3OPXA 5EHNA 1WXGA 2Q49A 2REBA 1QVVA 3BUSA 1RTTA 3AUYA 2GKSA 1FRFS 3CE9A 2Q0QA 3KNZA 4GP7A 5KTRA 2R87A 3CN7A 2K6GA 1J1ZA 4UBLA 2ATVA 1ZD8A 2BSQA 3WRXC 4INOA 2G08A 1FTWA 3IPLA 2FPMA 5LYJF 4I4NA 3AFNA 2R6FA 2ACVA 3HVRA 2GAJA 1XEFA 1M1NB 3I76A 2F17A 2HHAA 1MPTA 2R3SA 4I4TB 4ZODA 4CL0A 5A4JA 5LA6A 2WU8A 3H75A 3MWDB 1E2QA 8OHMA 1T8YA 4FQ8A 1QHSA 2YOGA 2XIJA 4G84A 4CVNA 2VFAA 4N41A 4R7TA 5TQ0B 4I08A 4D0SA 2DVMA 4RESA 1EIZA 3AEQB 1QAOA 5P21A 1QO0D 1ZIPA 2IYWA 2Z2XA 2FOIA 2JIBA 2R44A 2Z58A 3ESQA 5SZHB 4O08A 2FZKA 2JFNA 2Z2JA 5ENZA 5LP6C 3CNLA 2ZJ4A 3P19A 4H4DA 3M33A 3EOZA 4Q1DA 3VZSA 4BX3A 5JASA 4H6XA 2WRSA 5AUNB 3Q5GA 4NBNA 1MAAA 4CE6A 3SWWA 4ZT2A 2ZETA 5ARCA 2A5FA 2I8CA 2IX9A 3E27A 1HOXA 1X7XB 3LV8A 1NBOA 4XSVA 2J6BA 3TQRA 1K3TA 4EHJA 3L4JA 1XQVA 2OA0A 3WMRA 1DPGA 1RWNA 1U0JA 2NV0A 2WD9A 1BCSA 1AGXA 4WXYB 3ZNQA 3NH9A 1TOAA 1KMIY 3ABRB 3MTQA 2VNIA 4IKPA 5F4ZA 3Q72A 5FI5A 3WLHA 2ZUWA 4DXAA 4JC5A 2GCOB 4UTRA 3C7KA 4HL1A 4JT4A 3PNOA 4TL8A 1X15A 4OBXA 3NP7A 3STHA 2VZEA 1PGOA 2EFJA 4JP2A 2LD4A 4U4LA 4BNWA 2J9ZB 4XWWA 2V0NA 5HVNA 4AK9A 1HSOA 2EJBA 1QQBA 4EABA 4INZA 5KDOA 5CM8B 2QBYA 2I6UA 1PG0A 3LQQA 3M6XA 2G71A 4LMPA 3CEPB 1DKOA 1GRNA 2R79A 4CNQA 5B7NA 1OH8A 2Q1UA 2PBFA 3R0IA 4CT0A 1CQJB 2R8OA 4ZT7A 4AZSA 1YKSA 2B5OA 1USKA 3PGA1 4GQIA 4URFA 3T7IA 3BXHA 3VGPA 3WGZA 1UBKS 2FF7A 3EAGA 1DAKA 2W9XA 4XYMA 3VPCA 1CY0A 1UWKA 4P5DA 1DEXA 5BN5B 2DPXA 3W78A 3OD1A 4GO1A 4A8PA 5HF6A 3GEDA 2EZ4A 4B35A 4B74A 4L9WA 2PGDA 5EYPB 4AG5A 5FA5A 5LQDA 1OT5A 1MIOA 1GNTA 1U99A 2H54A 1OZGA 1ZUHA 3GG2A 3KT0A 2BAGA 4L5AA 4TYMA 3ZDFA 4LFAB 1C0IA 1JAIA 3CMMA 3I6MA 1WKBA 3FCYA 4MKZA 2RK3A 4HYTA 5FOVA 1WCXA 4B0PA 1SBNE 4URXR 3ANNA 3KOOA 2PT7A 3IEKA 3P2OA 2X0FA 3LZCA 4JSYA 2K87A 5DNYB 2ZJBA 2N46A 2ZROA 4R1NA 2PUDA 1DSSG 3ZXXA 4C2UA 3B2QA 4US2R 1YL7A 1SUPA 2CWWA 3BGSA 3AR6A 1VHDA 4AIIA 1NC3A 2WABA 1X9GA 5BR8B 3A1VA 10MHA 2IEBA 4FLMA 3LVQE 4TV8F 4ZAWA 1R27A 3N39C 1RHMA 3JYOA 3F7TA 2GF9A 3RQIA 4DV1B 1G3UA 3HKDB 3EBOA 3DF9A 4F8EA 1R16A 1ECGA 2WJIA 4QOGA 2GA8A 1J24A 1R8JA 3I9JA 3JV7A 3MUNA 3O8OB 5EMKA 3OX4A 3TRHA 3ZY2A 1IBMB 4XDYA 5KSZA 3AEUA 3V8VA 1K2WA 3NHAA 4DLLA 3H17A 4OHYA 1Q1NA 3DZHA 3R7AA 2XB2A 3EVAA 3E7DA 4LBYA 3GQVA 1MD9A 5AW3A 1IOVA 1PNQA 4HMOA 3ZU3A 4P58A 5IJAA 1R8YA 2DFVA 5BSHA 5BSUA 1J7JA 3V6LA 3SG0A 1RNLA 1AMUA 4R2XA 5BSMA 3BSWA 2HF7A 4ZVRA 4OQLA 1ODCA 3TTYA 1G20E 4E3ZA 1DIRA 2IPLA 5I7HA 2OBYA 2J0QA 3KD2A 1YC5A 2JFZA 2IZ7A 3ELWA 3GMDA 1XYVA 4HNUA 2XMBA 2FU5C 3EQ6A 3NM4A 4TS3A 3G6WA 1R8QA 2WE7A 4D6PA 2UXCB 2I6QA 1I4TD 3M6AA 4RE6A 4C14A 3S6JA 2Q9UA 1ZK2A 1NP6A 3UB4A 1JZQA 1CD5A 1QS0A 4C0QC 4DM7A 5HKKD 1PVVA 2IHJA 1MXFA 4Y9DA 4AV7A 1ORVA 4O6VA 2WICA 4K6KA 1ODKA 4TSFA 3D6HA 1XIVA 2RGGA 2B2CA 1ZXLA 3RVQA 1VE3A 4LV5B 2R6DA 5AOVA 5JSQA 1EAYA 5DHSA 4X24A 2AOUA 4YP7A 3GT3A 4KWEA 3ZOKA 4GLOA 4KRXA 2ZG6A 2YVQA 2MSNA 3TOVA 4CU2A 3VR6D 2H9IA 3M0EA 1VKNA 4WLFA 2HSEA 3CUKA 1AV6A 1NW3A 4GDFA 2ZRMA 4TYQA 3PRYA 3L7IA 4TUYA 1I14A 3C1TA 1MFZA 1V11A 4QDKA 1V11B 1HZZC 2D54A 3I9LA 4DCSA 1K5PA 4EH1A 5CT5A 3QW4B 3DXZA 4GKBA 4NOMA 3CM0A 4RABA 3C3WA 3VR2D 4Z3OA 4LOHA 2PGJA 2PBLA 4ZGGA 1GILA 1IUKA 5LQRA 3KZOA 1YIOA 4HRVA 3URMA 2B6NA 3PX3A 1JH8A 4O4LA 5SY9A 2WVJA 3U56A 4MV9A 1W2HA 2VTVA 2WJAA 2PQMA 3E18A 3I3OA 1TKRA 1R0KA 2AJBA 3B36A 1LC0A 3FAZA 4QTUB 1VJDA 3AIKA 3IMGA 4BB9A 4D4KA 2VJAA 4Z5YA 4MQFB 5EHIA 2YIVX 1H4QA 1JBEA 3DZFA 2IYUA 2GEFA 3PNKA 1MP0A 3R7SA 4ALNA 3RC1A 1DTEA 3PEEA 4JI3B 4XJXA 5HXAA 3INYA 1ISSA 4ID3A 3KLNA 2EIXA 1VJRA 4YPFA 4UE3S 5JH7F 5EHQA 4B2IA 5FNVB 1FC0A 3U4GA 4ZHQF 1P29A 2J6IA 4N5MA 3SC3A 3U4CA 2NW6A 2HA7A 3VKHA 2B82A 5IP5A 3N2KB 1F1BA 1BS1A 1LI5A 5KNBH 1TQ6A 2F3SA 1HT1E 4UQOA 4ZHQB 1T34A 3CNHA 2YZ7A 2R1VB 2H59A 1N5RA 3FJ1A 4PRZA 3W9SA 3Q3IA 3TLEA 2XCRB 4I4TA 2JNWA 2I99A 3CRNA 3IESA 2R00A 5EERA 2NTEA 1IZ0A 1T10A 2NZUG 1IBCA 5EWAA 1ACLA 2CJWB 4RZHA 1FNDA 3SR0A 5JZBA 3GX1A 4AKEA 2CV1A 2BZSA 1E2EA 1Y9JA 4KK4A 4QFBA 5G40A 4F5ZA 2G5CA 2ERXA 3D8UA 5TGDA 1M2WA 3R3ZA 4HEJA 2AZMA 1WIWA 1QG4A 4JT9A 4PSUA 3DCIA 4YP6A 5D8DA 4KE6A 2Q28A 1TJ3A 5CDFA 4P08A 3QLUC 2R1TB 2C2OA 5A02A 4Z53A 221PA 4IIHA 1E1KA 1XPRA 1E3LA 3ADCA 4QOHA 2Y3IA 4PBTA 4J1QA 3TAUA 3TZEA 1OYWA 1UBSB 4V3CA 1YJQA 3SJBA 4BWVA 2G0NA 3EMKA 4ZOBA 4CCSA 4E5SA 2IZZA 1RHQA 2QQEA 3VVBA 4B34A 1E2PA 1YL5A 1P0FA 3CUYA 2R0QC 2G88A 3NGXA 1V9LA 1PV4A 4CUJA 4GPEA 1HUQA 2HT1A 1ZY2A 3AFIA 3IVXA 3Q9NA 4C6HA 4QEDA 5DTQA 4K1LA 2BHNA 2XR1A 4H1WA 1N75A 1PX2A 5CLHA 3UOGA 3QVWA 3E9MA 3ZVNA 3U19A 3WK5A 2H4JA 4UDYX 3FR8A 3KSAC 3HACA 3ZGXA 3PC3A 1HEYA 5HWSA 1Z7EA 4MZXA 4M2LA 3ZGLA 5D5QA 3KSDO 3X1MA 1UKYA 4XEUA 4LHZA 2O3SA 2VAMA 2I87A 2JD1A 4US1R 4MVJE 3EBPA 4GBJA 4B46A 1WRBA 5BV8A 3Q8WA 4WRRA 3BD8A 3UMJA 3NORA 1KQ3A 4LZLA 1DRKA 3EXAA 3IXQA 1N6NA 3JZIA 3NLLA 1Z2CA 4MR8A 2F62A 4BEBA 1PL8A 1MQ8B 2GNOA 4XB1A 1BMDA 3I83A 3CNQS 4A8JB 4MQ6A 4CCAA 4ZA2A 2HF8A 5JQGB 2D3TA 2W22A 4KMOA 3H65A 3TFWA 5A03A 2CXQA 1U0LA 1K3UB 2JAOA 3ODPA 4UDNA 1Z35A 2EX1A 2LVBA 2GLTA 4LOLA 3F9OA 4YJ3F 2JLSA 1DFHA 4FONA 1OAOC 1HDZA 2FR1A 5T8KA 2FPKA 4QU0A 4NI5A 2JAUA 1MHPA 3LP8A 2IYSA 1TO1E 1G8JA 1PUIA 1S01A 3NYWA 1M9NA 2ZJYA 2RGBA 4IQ0A 1Q7CA 2OB1A 4OBBA 1YDMA 1GDDA 3ANSA 3D8NA 1E2HA 4GL4A 4JI2B 1EP1B 3EXHB 3GD5A 1EXDA 3OU6A 4QELA 2ZPTX 1SU6A 4CRWB 5BUSA 2ALJA 4QL3A 4ZT3A 2Z08A 3AHDA 4ZCTA 4BNDA 5LWHA 1P0PA 4BLQA 1P5FA 3RJMA 3ZLUA 5D7BA 1Z0ZA 1GAEO 3MYRA 1JALA 1YR7A 3BKWA 3PXGA 2NV6A 4ROTA 2J0VA 4YYEA 1TECE 2FK6A 1U0RA 4YJGA 5BN4B 4JLMA 3RUFA 1KERA 4Y3UA 4L5CA 1QGOA 4M0MA 1G7RA 1Z08A 2NWQA 2E85A 3ZDAA 1S3SA 2O3RA 3OMLA 5LU9A 5JSZA 1G21E 1A9RA 4ENSA 1S2OA 4YMUA 3CLKA 3MTGA 3FNHA 3FRJA 4N65A 2DCMA 2JIDA 1NHWA 2PT9A 1U7UA 2R8EA 3G8BA 2YOHA 4KSBA 5NULA 1GPYA 1N34B 2CD7A 3QHQA 4FE7A 4F2GA 1BEUB 4RKYA 4HJRA 3L7YA 3MSCA 4NQ2A 2W6NA 1R12A 1LI4A 1TZKA 1V5GA 4FBGA 4GFDA 2P2YA 4HX9A 3IQDB 3F4BA 5ISMA 3R7LA 4BE7B 2VYND 1TXGA 1O3YA 2POCA 3QTTA 1H5QA 3LX5A 4DIKA 2C5LA 2VXCA 3RKSA 2E0IA 1QC5A 1A76A 1DDGA 3ZN2A 3OFVA 4UNPA 4Q93A 3KKKA 4B33A 5DP1A 1RLOA 3IV9A 2VJYA 3TZBA 1E6WA 2JBAA 2OTCA 4N0QA 4OYHA 3UGQA 3WOVA 3TXYA 3RIYA 3EDCA 2OORA 1VC2A 2G82A 4UZFA 4Y18A 4EQZA 2CJPA 4WCVA 2IUSA 3MJDA 4K5QA 4CG3A 4IVRA 2QN3A 3DBVO 3NTXA 5T41A 3UK0A 1VP3A 2W2KA 5EIXA 1ADYA 4MW5A 3PEYA 2NO0A 4FLFA 3L0ZA 3X0DA 4LE2A 2O0JA 5F1KA 2VJDA 1PUXA 1NNI1 3UA4A 3VHRA 3VX4A 2BSAA 3PGKA 5T67A 1JG4A 2QZ9A 3OOHA 2CT8A 1HDOA 2EP5A 2K2WA 2PG3A 2RGDA 1NV9A 3ADOA 3PHBE 4I5IA 1VFNA 2H2IA 1RQRA 2VT7A 3C1OA 5K8IA 1FFDA 1P5ZB 3LHDA 5EV6A 3Q3VA 5ERYA 3TEJA 2PRZA 4Q3KA 1TO2E 5KYTA 3OJCA 4LUCA 1X1TA 2FPGA 3BFJA 5E9QA 4S2EA 3RNLA 3MJHA 1NBHA 3TYXA 1J2YA 3ZEAA 2JATA 5J58A 2C9OA 1QGUB 2Q6VA 4TTPA 4R7GA 3I1IA 4PWZA 2PSJA 2UXBB 5D3ZA 5JH7B 5K0ZA 1V39A 3FH0A 4OLHA 5FP0A 1ZN8A 5DKFA 3E3AA 3EB9A 1SUAA 2DRIA 3TX6A 1TVKA 3DO8A 5IX8A 5C80A 4MROA 3E23A 5JXGA 2CHFA 2PWBA 1FW8A 2RMKA 1N0WA 3IA7A 3AU9A 4EMSA 2R5NA 3P96A 2PZBA 3ZIDA 3GJ4A 5LIRA 1TADA 2FJPA 3R9IA 3K0AA 3NBMA 2QD4A 3MRTA 4LZAA 1WNFA 2YBDA 4Z2AA 4JIGA 3E7XA 3RR2A 1EUCB 1MAWA 4NSNA 3FCCA 4MPDA 1DJMA 2BFFA 2HJVA 2JBWA 1QVZA 3BERA 1S6YA 2DPMA 3IALA 1AUVA 3MAJA 2D1FA 2GEUA 4J1NA 2BGRA 4Q7KA 3UJDA 3V7NA 1HE3A 2JHAA 1YZLA 1GPBA 3D7KA 3MK31 5TMPA 1MPXA 2NZXA 3CF2A 3SF0A 2YFQA 5B15A 3WWDA 5KYYB 1NG9A 5JY6A 2H07A 3HUDA 4A5OA 4ETMA 3DFFA 2J6CA 4B85A 5KVSA 5HSGA 3W5DA 4KAAA 3ENKA 1CRPA 5DBGA 5A1JA 4UQPA 2V03A 1R4NA 4TL7A 1T35A 3T7AA 1KJQA 3PBKA 4G09A 2I6XA 4LYAA 1QZXA 3ETJA 2QQ5A 3JXPA 1R50A 3ONNA 1DEHA 3NV7A 1XZPA 2LW7A 2NO5A 1Q16A 1PT8A 4ZOLA 1ENYA 5LXTB 4HJXA 4UULA 2O8NA 2VDPB 1ETHA 5E4JA 5K0BA 1GFZA 3QXXA 2H18A 3R5JA 4AT1A 5KQGA 1OWLA 1AMOA 2H3EA 2C2KA 1NI4A 1FS6A 2J7PD 2CSXA 4RFSB 2AC2A 4HLQB 4V0SA 4TV8A 5I9SA 1HLFA 1ND6A 4I1IA 4ZC8A 2IU0A 1ZR4A 5J2TF 4QXPA 3DT8A 4L73A 5ALUA 1T3ZA 3RTGA 4NMXB 4DCPA 3I15A 3BJIC 4Z6XA 4X93A 1P2SA 5IAJA 1EFHA 2F8TA 1OPRA 4HVAA 5GGXA 3WJ1A 5KB3A 3NHLA 2HO5A 2XQKA 3EZ9A 4ENVA 4H3SA 3CKYA 1UOQA 3R4CA 2ASEA 1LQ2A 2LDBA 3A6FA 3RHFA 4I1VA 5EWLA 3RYTC 4JA0A 3H1PA 5JFGA 4G4IA 1TUBB 3VZRA 1P74A 1KE1A 1F5NA 5BYBA 2P4HX 1CUJA 2CW5A 4EYQA 3T94A 2R47A 1KI9A 2O5EA 3CO0S 3WDSA 1XCOA 1G18A 4DUGA 5KVVA 3GA0A 2PH1A 4D3ZA 4UHHA 1RAEA 3DNFA 3M5WA 3QU4A 2DJIA 3BEOA 3NTLA 4FT4A 1PYOA 3DZIA 3RPEA 4E21A 4YCCA 1VXRA 2Q5HA 1X8XA 3F9IA 4UE2A 4XYBA 1FF9A 1G6Q1 1T5LA 1U28C 4BMVA 5LZ4A 3KPJA 1O0SA 1M8KA 1UM9B 4QYIB 2JLCA 2QSJA 4K3UA 5BUQA 1SELA 2COEA 4KMRA 3LW7A 1JA9A 1UBEA 1F48A 1P4HA 4G24A 4B44A 5IHPA 1BQ3A 2V4UA 5ICFA 1JDZA 1RXWA 2QPLA 3KE8A 1CDEA 3Q11A 1U6JA 4JBGA 3LWDA 2I7TA 2VRWA 3LYHA 1YD7A 2PMEA 5LKRA 1Q3TA 3LK7A 1A96A 4ALLA 3TAXA 3F6PA 3NVMB 2EFDB 3RW9A 1KH3A 3FWPA 1E1NA 4UU8A 3RBXA 3WDLA 2FM6A 3IJPA 4KIJA 4PR0A 3JAMA 2B1IA 4B3SB 4WH0A 1N2CA 4U2FA 4B6SA 1KO5A 3COPA 3WMFA 3QH8A 5DWVA 6ADHA 5CHEA 4DMFA 2BD0A 4TKVA 3ICQB 4U7TB 3AESA 5AHKA 3WBBA 1UFKA 3GDWA 4D81A 1C2TA 4GOND 2NYAA 2REOA 3NKLA 1ISMA 4GZ5A 2C3UA 2P91A 1MOZA 2B2NA 1OXTA 1UANA 2ZOSA 3C5VA 3QPUA 2KE5A 2XHEA 4IMIB 5G3YA 3WWOA 4BNDB 1RYFA 4B79A 1Z2NX 1TIPA 4JL6A 5AJXA 1X38A 1W8DA 1CCWA 3QUAA 4F06A 1Q0UA 2FRDC 1TA4A 2HV8A 4O1HA 4BLUA 3EZYA 3UG6A 2ADMA 1QG2A 1SKBA 3LM8A 4MYTA 3B53X 2PA3A 4Y1EA 3D8BA 1HF3A 3D4NA 1GUAA 4AFNA 1HE5A 2YWEA 4X71A 1DQRA 1E66A 2IDMA 1OGJA 2IK8A 3E03A 4MO9A 3U13A 4A27A 1B8OA 3QXSA 1WHTA 4RY8A 3UUGA 4AJEA 2YXBA 1ULUA 1TIBA 4NMWA 3M1IA 4AX4A 1A8IA 1L7VC 3E35A 4M8NE 1ISJA 4X63A 4X45A 1JJBA 4RE5A 4QUHA 5BSGA 2QSYA 1HPLA 2TS1A 1E6UA 3GMIA 3KDAA 3DLHA 5MN4A 2B83A 2I2FA 4FNGA 1HDIA 2AN5A 4MJ7A 4NU6A 4YP1A 4YAIA 5FX2A 4RZUA 4F0JA 4ZHQA 3QKTA 1FMCA 1WXQA 4GHWA 5CK5A 4G1MB 5CXQA 1CEYA 3F74A 4HWGA 2XNSA 2WZDA 4B7CA 5BYKA 2C7RA 1M1ZA 4JSRA 3FCUB 4EJ2A 2ORED 2XZLA 3G1WA 4WNAB 4RA6A 1PDWA 1Q95A 4W8GA 5EP1A 1JFSA 4D1TA 2ZSFA 2F7SA 3OM0A 3UWSA 3MMZA 1V3TA 2O9JA 1PU2A 1SH7A 3KAQA 5LB2A 3WFJA 4JEUA 4RD0A 4B6PA 3G2MA 1T25A 1AQUA 2Z3ZA 2YWCA 1T9HA 3B3FA 4QTTB 4BNLA 3ZR4B 1GFWA 2RGYA 2XGSA 4COKA 5K0JA 2QM7A 4KRFA 3WNCA 3K6KA 4FHZA 5EHGA 3VYWA 1TB4A 1U6KA 3IB6A 1CE8B 1KYVA 1L7EA 1A77A 2A8YA 1TRKA 2P2GA 2Y4NA 2YW9A 3D3NA 1ID1A 3O2JA 3QNMA 2PRKA 2HWYA 3HLTA 4M7RA 2F48A 4DV4B 1DAEA 4QO8A 3DE5X 2LTAA 5BNIA 1YQEA 4CLOB 3AHCA 1ZJ6A 4YPVA 4TZ6A 3WJ7A 5IM4F 3FDZB 2ADFA 2WPDA 3GEMA 2NZWA 4O2RA 5AI0A 1KDTA 1KY4A 1M8PA 5BWLA 5CB4F 1LJLA 1JAXA 1SPXA 4RTNA 4YT8A 1M73E 5DNVA 4L3VA 1QP0A 1JNXX 3GJ5A 4R2MA 4EB6A 1AY0A 4EFMA 3MTIA 3U3ZA 1Z2OX 2OBXA 4LF6B 2GD6A 3H9CA 5HEKA 2QMZA 3EG9B 2ATEA 4HWTA 3D5QA 3H8JA 4KPUB 2ID4A 4XRGA 4MPJA 4Z1OA 1RS0A 4CMEA 2DHCA 3ICCA 2GPTA 4NFHA 2ZUBA 1FP7A 1G6OA 1XP5A 2GN2A 3F71A 3HI6A 4MIOA 1OZ0A 1R88A 5AKKA 3CVJA 3MWYW 1PUJA 4N5IX 4EUFA 1E3IA 3I5UA 1IQ0A 4KB5A 4JWKA 3GZJA 2FEWB 3P2JA 5DZSA 2QZJA 1CIJA 1EWRA 4FXOA 2HA4A 4A8JA 5IUJC 3T1OA 4BB6A 3CIOA 3PQ8A 3QOXA 3K72B 1NVUQ 3DTVA 2Y1GA 3P71T 3GNSA 1SIUA 4D02A 4W8HA 5LYJA 3MT0A 1XEXB 5K2OA 2DQ4A 1HQYE 3BE4A 3PRHA 1Q14A 3O1LA 4UCWA 5JS7A 4RPIA 1YRHA 3ISVA 3ABSB 3SZMA 5G4KB 2NZVG 1JHPA 2JCBA 3Q3CA 3ZV3A 1LJUA 4Q9NA 6YASA 2C8LA 1KZYC 1TZJA 1F2DA 1PWHA 3PQ3A 3LKZA 3RODA 4IS3A 3IELA 3TKAA 4QTZA 2NACA 2BJVA 3AUSA 1J5PA 3FAKA 1YB4A 1BX0A 2OZPA 2FEMA 3GELA 3NW9A 4WE3A 2DKNA 2QPTA 4FVTA 3QV2A 3PDIA 1FDUA 4HRAA 2FZCA 1JJAA 4KGVA 4KKXB 4NY1A 4BNIA 4AJHA 5AKYA 1J0DA 3PDJA 3ZIAA 4EPYA 3IEPA 3N75A 4HZUA 1FP2A 2XUFA 5FA8A 5CIYA 1M2JA 3HVKA 5FBWB 3LLSA 2Q8NA 1A7JA 4LJAA 3IV6A 3KQHA 1W88B 2P69A 3OZTA 4LQDA 4UNSA 4AKTA 3PF9A 4FFDA 4I4CA 1T9KA 1JQJC 2VH5R 2HYIC 4DDWA 2ID9A 4NNOA 2CHVA 5BRJA 4GR9A 4XUDA 1L9XA 4FSDA 3FUUA 1JNYA 4TMYA 1XKTA 4BQPA 1A9XB 1CG6A 3HCOA 4TN1A 3WJ2A 1Y3CE 4CM8B 1Y1SA 1DI0A 1T9BA 2ORYA 5K03A 1GG2A 3NAMA 1J2EA 4HAOA 4JKIA 4ZPJA 2Y1DA 4A0RA 2OV8A 1IJBA 1B1AA 1YR6A 2FW8A 2IEYA 3TLMA 3X3HA 2WAYA 3D1VA 3E70C 3L8MA 1O6CA 1COWA 3EXHC 1V4BA 3UK7A 4HG2A 5KCZA 4I6GA 3HJUA 1SCUB 3LD9A 4ZAZA 4DM4A 3CR3C 4LY9A 3SS7X 1DZIA 1ECBA 5B1EA 5CLFA 2YL2A 1V9SA 3E9QA 2HAEA 4R2WA 4DNOA 1G2IA 1JG7A 2FEPA 3P9SA 3T34A 1I1OA 1D6NA 4NOJA 2RARA 3P4UA 4IDEA 3WGYA 4MYDA 2PJDA 4RH0A 5CT4A 1KU0A 2RBKA 4NFYA 1OLXB 3AR4A 1P7VA 4B1FA 1RAGA 1UT6A 2GFJA 1EVEA 3ROTA 4M22A 3O8CA 1JR3E 4RLSA 4LYDA 1CR4A 1SCJA 2BWJA 3BZBA 2KX7A 4NL4H 1Y7HA 1BXGA 2R96A 3OJ0A 4ABTA 3M5PA 1GFSA 1KH1A 1VMIA 4LI3X 4BMSA 4KIUA 4C2AA 3L2OB 3EEIA 2NVUB 3WSTA 1OFGA 1KOJA 5EJGA 1CQZA 4NBWA 3CW9A 5KC8A 1T29A 2VPPA 1FJGB 1I2MA 5DM2A 2RI0A 2VR1A 2RHOA 5EZYF 4YXWD 3PE4A 1XTRA 3MMNA 5E6SA 4YDQA 5IVPA 5T57A 4XEHA 4ETIA 2W0MA 2X5OA 5DXFA 5LZ2A 2AXEA 2QAGB 1NJ5A 1NOKA 3V7FA 4MUYA 3F2IA 4YO8A 5TDHA 4GZ3A 1MC5A 1ZINA 2CLFB 2C9MA 1KXJA 1LXCA 3SHOA 4RY2A 2QJOA 5JBQA 2QSUA 1XTVA 4JK3A 4NARA 1HT2E 1I5RA 2F6RA 4J43A 4DIMA 1IDOA 2RC5A 3PNLA 2A35A 2NVWA 2V0CA 4FZ3A 2QVYX 3I1JA 4ENTA 5AVYA 2BBSA 1FB5A 1L3BA 2IYEA 1O58A 3A10A 2MYNA 4CTOA 2IT1A 3AFMA 4PBRA 1W0JA 4D44A 3VH4A 5F23A 1M33A 1WPGA 2LP4Y 4P4SA 4WCFA 3PRKE 5KQSA 1ZD1A 3I9FA 3I14A 2G72A 5CVEA 4L8LA 3URKA 2QUZA 3CCFA 3G9ZA 5L51A 5AO9A 4C20A 1ZD4A 1XCLA 2QMOA 1I0LA 2AR9A 3H5VA 1IG0A 2CDCA 2O07A 3GCWA 2XYPA 5KU7A 3KEMA 5DLQC 4TSFD 3TOXA 3CH6A 4BO9A 4IGIA 4YT2A 5CW1A 3RVOA 3V4RA 1X8LA 2OO7A 4Z4QA 1TZBA 2FK7A 2P78A 4M6WA 3OX2A 2Y8AA 3GK3A 3RVBA 2WWIA 1E69A 3C8UA 1XAHA 1FDVA 2AG1A 2GN4A 2V6JA 1TUBA 3KEGA 4V0NA 4KR0A 5ARDA 5FAKA 1BIFA 2WU3A 5A6VA 2ZIUB 3IP7A 3RJTA 3WA6A 3QF7A 3RHZA 3VDMA 3WBFA 1KXZA 3AR5A 4RVSA 1G63A 3IOCA 2C4TA 1V45E 3AZPA 3LPAA 2HQBA 3RI3A 1MUUA 1BC5A 1GGEA 4N6NA 1ELOA 3MINA 3V4ZA 3DULA 5A9TA 9LDBA 2VTEA 2IZ6A 2DB3A 1RYHA 2GFKA 1ZZGA 1Y6GA 5FI3A 3RVJA 4ITRC 5C9ZA 2BFFB 2ZYGA 3R2JA 2ZI9A 5AW2A 3SMQA 2JIPA 3H5TA 3MUEA 1J21A 3KKQA 4A2PA 2P9JA 4GI1A 1DC3A 1E5QA 1SVUA 2BR6A 5KOJA 4TUYF 5E2BA 5DHUA 3SQOA 1NI5A 4RAQA 3F3MA 1H3EA 4J1SA 2RBGA 4YC7A 4HX5A 5KYYA 3BV6A 3HKDA 2AJLI 3A36A 3FYUA 3UAOA 4R69A 4TLLB 1W1IA 2VK4A 3FSGA 2ZBUA 3DZDA 4U2DA 3QOYA 3SSOA 3NTUA 5BV7A 1E1RD 4U39A 4RTRA 1DBSA 1Q7RA 3OAAD 1GQOA 3VAYA 4CV2A 2FWPA 4D8WA 1DOZA 4G9EA 1BN7A 3EXIA 4MK4A 5KSYA 1GUYA 3R23A 1JWBB 4Q66C 1E0AA 1ODTC 2MOKA 2XWJI 4MCHA 1FQJA 2C3MA 2GYYA 2JZOA 4QGFA 4REQA 5EE1A 5TGTA 4UCQA 4Y1RA 4TMXA 2IOYA 4B3HA 1JFVA 1K0FA 2CXTA 2GZAA 2H1HA 1Z4PX 1L5FA 1MF7A 5AKIA 2PXXA 3M6MD 2RSLA 4DL9A 1IRIA 3DF7A 3DSRA 4BDTA 1KZ7B 4RSHA 3HN2A 2D06A 2A3RA 2GYWA 3TNDA 4IGEA 2C98A 3V42A 3VTFA 1HFJA 3B1YA 5JAHA 2NU7B 3KNRA 1Z29A 3WYAA 4PQRA 3AUAA 3L43A 4G5XA 4PC6A 3VPEA 2XKKA 1T0JB 1AQIA 3CNEA 1DUSA 1H5NA 4H6VA 3LX6A 1A97A 3U26A 1X8KA 4JXKA 1U7HA 2I1VB 1RP7A 1NF9A 1J8VA 4P4LA 2QL6A 1DC5A 1W88A 3H42B 4IM7A 5BOSB 4CETA 2FUKA 2VP2A 3PE6A 3MEQA 2UXDB 1KF0A 2O7NA 3FPAA 4IZOA 3O73A 2V97A 1KRHA 3D54D 3UY4A 5F76A 3W7AA 3H11A 3ADPA 2Q42A 5HDBB 5DM0A 4N3CA 4GYJA 2EJUA 1PKEA 5G0UA 3H4TA 4ZNBA 2DQZA 1NXWA 3LBAA 4MR9B 2Y9PB 1SQGA 4IILA 4ZCIA 3W3AA 5SV2A 3UNXA 1PQPA 3BC1A 4HAWA 4CL2A 2P9QA 2JK0A 4OAPA 2GCIA 1WTAA 2ZQ5A 4A91A 1EFLA 2HBRA 1ATIA 1ZKMA 4IR7A 1U80A 5I4CA 3AXSA 3I04A 4OJMX 3FF1A 3OPVA 2V7EA 1V0JA 3OE7D 2HLNA 2ZSHA 3AV3A 3LC7O 5K20A 3GA7A 4PX3A 4QT4A 3CNBA 2IGTA 3MW8A 3ZE0B 2PZEA 1X7ZB 1KEPA 4KIGA 3PL1A 4QHSA 1OWMA 3EGOA 3GRRA 1IG3A 4DV6B 3NNSA 4DJDC 3SQDA 1B74A 3QYJA 4RGVA 4RUKA 1WB4A 5LZ7A 3WV5A 4IJWA 4C21A 3EGEA 1VBMA 1L1QA 4DIOA 3T5DA 1MEJA 5A3JA 1E9SA 1QYVA 1W5AA 3PDCA 2BM8A 1LVHA 1Z6ZA 1H2BA 2QOEA 4EGAA 4F60A 1O95C 3P5BA 3JQAD 4R1SA 3VDNB 1WNTA 2C5EA 3MHPA 3P52A 1NUUA 1KK3A 1TL7C 4HYQA 2CFUA 1AZLA 1RXSA 2XVXA 3H9UA 4UOZA 1CERA 5EJ4A 3L0BA 1S5PA 3DZJA 4KFSA 1CUZA 1TKAA 2PAAA 2PV0A 2WA1A 4NNJA 1JLLB 2JFHA 4RA6B 1H1TA 3H19A 3R8XA 3NQ41 4YI5A 3VTAA 1CS0B 1ZCAA 1ZJYA 2NYRA 3EZLA 4DW8A 4ER7A 1P4GA 2EBFX 4EX7A 5BNFA 1YZKA 2DFLA 3ICWA 4WK6A 1SXJC 4BBZA 1YB2A 4KYTA 4U63A 3W1WA 1EQAA 2O2GA 4IQ4A 3SYKA 1N9GA 4BRWA 1L8AA 1P5RA 1QOQB 1UKEA 4MVJM 1IM2A 1Y1LA 3HUTA 2IXEA 4TM7A 1A2BA 2P9EA 4Z9AA 5EAIA 1YQQA 4FFBA 4GRDA 5DWDA 1QANA 4HPJB 2J45A 3TW4A 4XWKA 5JCXA 1A27A 1PO7A 1QFYA 3E8MA 1W6UA 3E9YA 4FFOA 3G0BA 4HY3A 1IOZA 1UT8A 2XODA 1IN7A 1H9BA 2Y87A 4B3XA 4HFNA 3RKRA 1QX3A 4NCJA 3KEOA 3C70A 2VDWB 4OH7A 4MVWA 3V34A 4IWYA 1P6UA 4NZOA 1G3RA 3SX4A 4BNFA 1UDWA 2YVAA 2GO7A 4K6HA 3SQWA 1HNNA 5LIPA 4LX0A 4MPRA 1N0HA 1YGPA 5B58T 1TCCA 3OIDA 4OHPA 1AXRA 4CKBB 1R6BX 3L7JA 1FUEA 1FRNA 3RJZA 4EYFA 3CG0A 3OESA 2P9YA 3PFGA 4EYOA 2JHFA 1LZKA 3MWGA 1G5RA 3ES9A 4NOLA 3G0GA 3IKTA 1MQ9A 2ZE8A 2OM6A 4X00A 5ELMA 1FTQA 3SKVA 4LZOA 2XUQA 4IMPA 4X97A 1QR6A 3FYCA 1OBFO 1EG7A 4OQQA 4PIMA 3VZQA 4C4OA 4MW1A 3EIOA 4PZPA 1Z6PA 3LC1O 4QPDA 3O92A 2ZJ1A 3FGPA 1O5OA 4FYIA 2JC3A 4GMDA 4CFSA 1AKWA 1USWA 1WJGA 2CNNA 2E4ZA 3BIJA 3FKJA 3FGOA 4EUSA 721PA 5CH8A 1QRTA 1K7FB 1RKVA 4C78A 1JA1A 4KTTE 1P1FA 2W6CX 4Q1EA 3SBEA 3ZQKA 5HUQA 2OP1A 3HA3A 2IDZA 5KTYA 2PUCA 1FMJA 2KM1A 4PU0A 2B4QA 4BC0A 4OY3A 2QT0A 5I9LA 3DDCA 5FF9A 1M1XB 2JDID 2ODNA 4HXEB 3S40A 2IYZA 2ONKA 3ABOB 3WFZA 4YJ3B 5C8ZA 4UTNA 1DQSA 3OPMA 6REQA 4S1PA 5A7GA 4TLMB 3IRUA 1TKCA 5EJMA 3RIXA 4IDCA 3R6DA 4FGUA 3WYBA 3OIVA 5AW9A 4AYXA 2NPOA 5KEIA 1VJCA 1WY7A 2G1UA 2PSFA 3KUXA 4JJAA 5DIFA 2QZPA 3JVUA 3SQLA 4AJLA 2WA2A 1NATA 1UAGA 1GG5A 1EJ6A 5K8JB 5IQKA 1PK8A 3I2GA 2IYPA 1DCKA 3I04M 3P2EA 4GM1A 1BH6A 1RZVA 2NSHA 3FPJA 1XCMA 3F6CA 4HYEA 1YCFA 4TV8B 2RHCA 2NSJA 4WUTA 2Q4DA 5A3VA 3CJRA 5TGZA 3KS9A 1UPXA 5C4MA 4DCGA 3NBKA 1WTCA 1K6XA 2JI9A 4AICA 5HE9A 5EJFA 5AK3A 3WK7A 3LUFA 3CPEA 3R3YA 5JO9A 1HH4A 3B9PA 4X9XA 2X1HA 3ET5A 2BGGA 3G49A 4WACA 4PTZA 2GEKA 3DEFA 1ZRSA 2WF8A 1TD9A 4I50A 3ADRA 5JUWA 2FA9A 3OMXA 5TIIA 3E8SA 5HCUA 5KWEA 3BMNA 3P94A 3TQIA 1KS2A 1NW4A 4O4HB 3G2NA 2QTZA 5EE9A 1Z8HA 2OWEA 2XI4A 2AMYA 1NIPA 5L8VA 3OC0A 5KIAA 3KVYA 3HWX1 4C4PA 1U7ZA 3B1WA 5CEEA 3NBQA 3FETA 3V48A 3KVVA 1O9BA 2YYSA 4TRJA 4RL0A 1J4AA 4O2BB 2WJHA 5HG0A 2LRHA 3E81A 1QRSA 1LWOA 2QY6A 2LCFA 3EF1A 2QROA 3VUFA 3B85A 2HBQA 4ILEA 4MLZA 1R8SA 2R60A 1U2GC 3DOIA 2ZJOA 3QBJA 1ZVVA 4EUKA 2FPRA 4OI4A 4TROA 5TMDA 1BEEA 3PR2B 4LGVA 4UUMA 1ZI6A 3T0GA 4YROA 2VSQA 4ID9A 5KMGB 2P2SA 1JPVA 1IB0A 7GPBA 2PVPA 2V7WA 2HRZA 2GMWA 1PF7E 2GK6A 3TR0A 1V6CA 1JN0A 5DYTA 1SAYA 4CTMA 1IN8A 1RHRA 1WHTB 1TJNA 3WRWA 2FH5B 2HDHA 3VFDA 3KHSA 3SX2A 1KYWA 1NURA 3ZCSA 1FQKA 4LC0A 5K3BA 4P5PA 3RBZA 3GRYA 3BSSA 4RZSA 1GCGA 2ZYVX 4BJ3A 1ZCBA 3KSBC 5G41A 3KKZA 4TS9A 3ZXSA 5KWVA 2WMDA 2ZRQA 3ZI0A 1P62B 1DKRA 1VSVA 2RB4A 1M54A 2VYVD 1X1QA 1WX1A 2V7XA 4YNBA 4D45A 1MNAA 5KOYA 3IVMA 1DT3A 2B4AA 3IFSA 2WTEA 2R8PA 4KQIA 3ZS9A 4UHFA 2O20A 2Y2UA 3HN6A 5IZCC 2VEDA 1HDCA 1X19A 4LQLA 4MV5A 1OFHA 3ZK8A 4HF7A 1RACA 4HH0A 4IJ6A 1E0SA 2W2NA 4OK5A 3WK8A 2M1ZA 3I9NA 4CI9A 5BSFA 4UM9B 4N8EA 2W71A 4FFNA 4F97A 2W6ZA 1W581 4X85A 1PBNA 2ZWPA 2WKQA 3JQ7B 3E53A 5ENDA 2PVCA 2W6QA 4TL9A 3AETB 3DXFA 3KQQA 2H1SA 1SBZA 2J4DA 2W43A 1ESCA 5AI5A 4GS5A 4AO6A 5TJHA 4S1NA 2B61A 2HBZA 4OLBA 4O8ZA 1T36B 4DNXA 1I36A 4PSVA 5A62A 2UYYA 3PC2A 1D8AA 1GA4A 1I6MA 1N6KA 1WXHA 3EXG2 3UANA 5B58C 3BJZA 2V7VA 4WMLA 3WVNA 1NF3A 4X90A 2ZUDA 3GEBA 1MR3F 4WBNB 4NCBA 1O5TA 4FDMA 4TQGA 4DLSA 4MS4B 3FF4A 1M6YA 4QO7A 5KNBA 5A87A 1SY7A 1OMOA 3OUUA 1C81A 2G09A 5CCXA 2HWKA 2QR2A 1TZMA 1OLSA 2QENA 3RYCB 4LVNA 1N36B 5EJ7A 4UD6A 3EIFA 4GPTA 2JLYA 1OGIA 3FOCA 5A4KA 1O54A 2CDBA 2QBYB 2GAIA 4Z0HO 4XIGS 4FZRA 4U2KA 2H48A 3OJEA 5BURA 3LBFA 4IL5A 3UXEA 2YNMC 1L5ZA 3GBPA 4WHMA 4ZDJA 1P2VA 2QZ4A 2GEJA 1NBME 2NO4A 1G5PA 3DEAA 2UZ1A 2DUNA 3JQCA 2FUCA 3QVTA 1C9NA 5EJ9A 4ZVKA 4N18A 4X91A 3DL0A 2GLUA 3SMVA 5J2TB 5BN5A 1D4ZA 1G3IA 1LLUA 2IIPA 3N0TA 1DHTA 2PYDA 1OLUA 1U5BA 1CJBA 2BCEA 3HRIA 4FNAA 1SB8A 2Q2VA 4ND3A 4HATA 5IKMA 5K4KA 1UJNA 1Z0SA 3OZBA 2H11A 4ZWNA 1TTTA 2HOQA 1JFTA 3IUJA 4LBWA 2G5GX 3EYAA 3LXRA 4IX9A 5K0CA 1HDRA 1ZI8A 4D92A 4Z51A 2NNWB 3T5PA 1XA4A 3Q12A 1GTVA 4C0HA 2VDLB 2WUWE 4GKAA 3P0JA 1QP8A 1U0FA 2GAFA 4E4YA 2A57A 3I2IA 3LHSA 4F8JA 3C15C 1V7ZA 2WSBA 1DT5A 1ZQ1A 2BW0A 1EHIA 1WCWA 2P3OA 4OYYA 5FKJA 1Z56C 3N8IA 1S2LA 4BO8A 1V1JA 2B9VA 2ET6A 4IZ6A 4PLGA 2NXWA 4M98A 4Q05A 3U4QA 1XRPA 1YTUA 4X3CA 3IAAA 1UKCA 3F78A 3VR1A 3KZXA 2OFXA 4ZCSA 2QTGA 1Z2DA 3A4IA 3PWKA 3U09A 3G1TA 3W5AA 1TTHA 4LC1A 4BQEA 2QLNA 4CFYA 4HFMA 1LJ8A 5EUQB 3U0VA 1G8PA 2GA9A 1Y89A 1I9GA 2D8MA 3GJSA 3QPDA 2Q6OA 3TRFA 1KC1A 4JVMA 1QPGA 3DPUA 4ARZB 2AZ4A 2VXBA 2O05A 4W1RA 4DSNA 2R68A 3R0XA 2I8LA 2NOAA 4G9GA 1IPHA 4DWWA 4E13A 2J7PA 3ZDBA 3K0BA 4M36A 1AS2A 3RANA 2HXYA 1NV8A 4TVBA 4DNPA 2WVGA 1IM8A 4ZT6A 5A3SA 2VP0A 1SWVA 5E8JA 4C4ZA 2ECPA 1NJGA 2RKOA 4M83A 4NQZA 4CGZA 4KI7A 1JR6A 2QX8A 4RENA 2AC4A 2BHSA 5BSKA 1Z75A 1JKXA 4TTSA 2XTAA 3JD3A 2J3DA 1LV8A 2BMVA 1KEEB 2XOKA 4N8DA 1TGVA 2ZUEA 4U00A 2O2JA 1SCQA 4IHQA 3GJ7A 1HNXB 4B4VA 1UMDA 2CXOA 3FOZA 4V2UA 3CTMA 3RUAA 3SE7A 4UEOA 3G82C 5C1BA 3BEDA 2I29A 3KSUA 3ENZA 5T5QA 1NMEA 3TJZA 4ZXFA 4HEA6 7ABPA 3LKDA 5D3KA 1ZIDA 3BD7A 2AZTA 3VKWA 3OLCX 4QQFA 1XD2A 2II6A 4M55A 5JDCC 2HRRA 3FSRA 3BCSA 4FHGA 4HGRA 5C5IA 3A4LA 2XXAA 3EGWA 1EBBA 2W2KB 4GGMX 4EHIA 3NYIA 4HB4A 1AZTA 4MNTA 3RK1A 1JTVA 2JLWA 3OCUA 1NR5A 3DC2A 3F6SA 3COYA 4U5XA 4M54A 4FFBB 2H1WA 4G5FA 3MAAC 2YH2A 3EISA 4KH1A 1UWVA 4WKGA 1NKVA 3RK0A 5E1MA 4D1UA 4XX0A 3V4OA 1OC4A 4AWAA 5AIBA 3DYIA 4GAEA 1A1VA 4FXPA 3REFA 4FMBB 1KP3A 2CLSA 2P6OA 3G85A 5DF1A 3V8MA 1XBTA 4CM8A 1ZUIA 3W5SA 4AO7A 3EWNA 4G8BA 4DDMA 1I0ZA 1W4BA 4P31A 2A4MA 1R64A 5CT8A 3ROKA 4HNVA 5FUQA 1SUEA 2Z5VA 1OILA 2FWNA 4GDMA 3OIWA 4HD8A 3VOBA 3VYRB 4HQKA 4B7ZA 4ESHA 5L3RA 2B30A 3PU6A 2XTMA 2H17A 1PJ2A 2INGX 2Z2KA 4MUEA 4R8RA 4RPHA 3TWOA 4OI0A 2QTFA 5B57C 3I61A 5L53A 4QYXA 5SY4A 3EFEA 1A9OA 3H8SA 3D6FA 1NXSA 4OKNA 4PSKA 3WISA 4L76A 5HZGA 4ALJA 4TLCA 2OCXA 4M9ZA 3D3QA 1IVSA 3CISA 1AD2A 4FQ5A 1VYTA 4X84A 3D8TA 1EFCA 4U7HA 3GNLA 3DFIA 3ZPXA 5AHOA 3N87A 5IT4A 2I0FA 4L5BA 1KJWA 1LVGA 3BRSA 3EC7A 1JSZA 2PRSA 1M1YE 3LKVA 2BR4A 3MWKA 3N2YA 3QVUA 4EUNA 2O7QA 5KNDA 1R1DA 2C00A 3KJQA 4LNAA 1TW2A 5B36A 1PN3A 1AOXA 3MC1A 4O33A 3F4KA 1AGPA 4M88A 4B2LA 3Q5EA 4IHJB 1Z82A 2VTBA 5EVBA 1NBAA 1OTYA 2R4UA 2WU4A 3ANLA 3L8EA 3LRXA 2NM0A 3LYUA 5JAQA 2BFWA 3KZ1E 4RU1A 3P4YA 4R8SA 4TMVA 2J5KA 1C7FA 4UM8B 2OYSA 5JBNA 5LLTA 2MWMA 1UOOA 1NVFA 4BZQA 2C5SA 4QXQA 4H7DA 1A5BB 2X4LA 3F73A 3RU3A 1LF0A 4PAWA 2ZWMA 2W83A 3H4VA 3D3KA 3L7NA 3EDMA 4QQNA 1M6WA 4D7AA 5JSYA 2CUKA 3FPBA 1WMFA 3IDFA 1EMDA 3AUJB 4H3KB 5AVTA 1FQWA 3KYDB 4KHPB 2YJGA 4QYWA 2VXYA 3UEOA 1JW9B 5TPWA 4D41A 5CFQA 1U3DA 3AILA 1BC2A 3FVVA 3NJ4A 2AG8A 5DXJA 3WLPA 5EV8A 1TA9A 1B43A 2Q2WA 1S2NA 4MQFA 4A4DA 5I4IA 4J9UE 4ZIRB 1V1RA 4JMPA 5IVDA 3FOFC 5KO2A 2REQB 4LXIA 3KB8A 2YICA 4HOYA 4CG0A 3FHJA 3UF0A 5FOTA 5AJLA 4LAFA 4XWOA 4J07A 1WF6A 3L82B 1E7WA 3AUXA 3D1JA 3K2QA 3PUYA 8ATCA 2ZWIA 3BIWA 1U8XX 3CA8A 4PC7A 2XHZA 1QIJA 4POOA 2PCJA 5F5XA 3PPIA 3DKVA 3ZZ1A 5TY0A 2PT6A 1Y8ZA 1ZVKA 4KXMA 5HIPA 4MUAA 5IAGA 1T2UA 2Q5EA 3INRA 1E2MA 3J80A 4TMZA 3GVIA 4MUXA 3T15A 3RSLA 2VP6A 3S3TA 3UCEA 4H7KA 4EW6A 3UAWA 3CX4A 3GARA 3NT5A 3UMGA 2BFAA 3VGJA 1XMXA 5CFOA 1RWPA 2PV7A 2X7JA 3GVPA 3P0EA 1P61B 1X1AA 4N9WA 4GI2A 3AKEA 3E3LA 4G5GA 4OHVA 3KKNA 3IJ5A 1TQHA 3QKRB 2BBTA 3S2GA 3UAVA 4B8YA 1ZA2A 2QK4A 2VAXA 1Z6GA 2GCGA 2H0AA 4YMHA 2XCTB 4R0VA 1VLZA 3VHXB 1PJAA 4EZBA 4RY0A 3GJ0A 4GP6A 1CUDA 2QT9A 4AMGA 3FTEA 1G5QA 1BMFD 3OJXA 2UUOA 3FYUB 3TXAA 1F0YA 4M7WA 2DH5A 2ILVA 3ESRA 1KIMA 3U7GA 3V32A 3AKZA 1JF8A 2G4CA 3MGGA 2MR5A 2O23A 3S27A 3LLMA 3B6ZA 1NE2A 3MOGA 4NBVA 1G59A 2DSTA 1F20A 5LFAA 2IBTA 4R3UC 1H2RS 2GK4A 3K0CA 1YJCA 5SYAA 4RETA 3WMWA 4UEWA 3WYCA 1HORA 1IEXA 1JX6A 3E82A 4MS3A 4A8HA 1BU8A 2VQ3A 4JUFA 4PPFA 1NYTA 2QAIA 3WWPA 5BWMA 4YMWA 3H5AA 1R74A 1N3BA 4RHCA 1GPMA 3ZY3A 4URWR 4C87A 1N2BA 5TMBA 2CFCA 4J3FA 5CJJA 3OETA 2H4WA 1QHGA 3Q1KA 1EWKA 3TN7A 4MUHA 4E2XA 1U2DC 3FFAA 4EMUA 5CDFE 3S2FA 3BIFA 4EY4A 4JX9A 5CTAA 3UN1A 2R2DA 4O29A 2A88A 4YONB 1JDNA 4JBXA 1VL0A 3JCZA 3NJ8A 1FNCA 3KU4A 1KZ9A 2C99A 2PEZA 4H3VA 4XLLA 3ZBTA 2IU6A 2QVGA 1Y7LA 2VA8A 3I5MA 2C58A 3UMMA 4BDSA 4C2BA 1ZGJA 1NRJB 3DUWA 1JHQA 1HE8B 3IPYA 3L6UA 3R5FA 4FNMA 4Z4CA 3TLCA 5K6AA 5C5CA 4PWYA 4LTMA 4UM5A 1GNQA 4BJ6A 5KILA 3FYTA 4XIFA 1P3Y1 5AW7A 1O8CA 4CM9D 1HY3A 3TQCA 1FU7A 2ABWA 1S8OA 2VNHA 3RD5A 2FWJA 4MUIA 3R77A 2DTEA 3VH3A 2ZRNA 3DKIA 1W85A 5I7RA 5C1OA 2OMEA 5E3IA 1O94A 1IZZA 3GYBA 5DCWA 4HDRA 4OQEA 4QC2A 4LDQA 1L6IA 3OAAA 3R3XA 3VR0A 5IVKA 5IF9A 3EIEA 3IOGA 3AVTA 3SC4A 4PIVA 2FTKE 2D5LA 2V1XA 1R00A 2CLEB 4MJ3A 1CY6A 1G8AA 2JI6A 1GTG1 1XOIA 2PL1A 4LOIA 2I2BA 5L4NA 3DCNA 3OFJA 4KDCA 3V6MA 2D7DA 1FJHA 1QIEA 4YYZA 2W2TA 1US8B 4BXOA 1EZZA 5EG5A 4XUEA 4AQ7A 1MAVA 2Q3LA 4BNMA 1HA3A 2EFCB 1K6IA 4CV3A 2KYRA 3CVYA 5K05A 3FLEA 2O2YA 5ED0A 2A7QA 3U61B 1QBGA 2FQQA 2G67A 1MORA 3LK6A 2YFHA 4UBOA 1XD9A 2WYVA 3ZLTA 1GV1A 4PYKA 3DGFC 1BA3A 2BEVB 2W7TA 4KAFA 4ZI3A 2XRZA 4A03A 2IHKA 3QHPA 4K9DA 1JEEA 4LDJA 3HSYA 1DJPA 2Z3WA 1GQFA 1IY1A 1WKVA 4YXWA 2EJCA 4AMZA 4C4TA 3HGMA 4X7BA 5KIKA 3HYCA 3VZCA 3DMFA 1I10A 2RG7A 4W63A 4PAOA 2A9RA 5HA5A 1W36D 2GDZA 5CFNA 5IK2D 2ZRAA 1SVNA 2B8TA 3BTUA 3OPYB 1JHMA 2P40A 4NYJQ 5A5EA 1DGQA 1E7QA 2ANCA 2WJJA 3D4PA 5L3QA 4Y2SA 2QUJA 5HHTA 3E9CA 2OCBA 2SKEA 4MQMA 3LUJA 4I46A 4WKBA 3UTCA 2Z9CA 3TLZA 5CCBA 4BXOB 5LUAA 5ALMA 1RBZA 2F43A 3JQ8A 4FB4A 5IANA 3HCDA 2YXLA 4YR9A 5EMHA 2HF2A 5JPDA 2OUKA 2BE7A 2HJ9A 3HY4A 3NB0A 5A5GA 1NXVA 2CDRA 4C3VA 1SZCA 4AJJA 5ALWA 2O54A 2GD0A 4FDVA 1YGYA 1YR1A 2CMDA 1F17A 3HGTA 1C4OA 1E9AA 3JASB 4OUDA 1QDEA 4Y2XA 1A8SA 1JDJA 3EHEA 2GM3A 5LCXA 3TR6A 3ZHXA 2AT1A 3GZNB 3TFQA 3COSA 1CDOA 4L6CA 5KQMA 1HOTA 1X7YB 2OCDA 3K15A 4ZMBA 2IKQA 3G2HA 2Z2ZA 2P68A 1MTZA 2XE4A 4YRDA 2V7BA 4R81A 1L5KA 1R0CA 2H9YA 1CK4A 4BNXA 2PL5A 1NI3A 2GHQA 3L8CA 1A7TA 3DONA 4W7HA 4KMSA 2Y1KA 3FKSA 3LH5A 2O1SA 2BHLA 3D59A 4BU0A 1OX6A 4E5MA 4CM7A 2FMHA 2JGFA 4D3DA 1P6XA 3UJ9A 3VR2A 1SUBA 1QE0A 1PDOA 1B0AA 2HADA 4UVHA 4QDTA 4EFNA 3P97A 3DOJA 4GBMA 2D4AA 4LKOA 5JS8A 3TMAA 1CRZA 4FM9A 5L9AA 4FS8A 1HDEA 4UHDA 3K9CA 1YL6A 2BM9A 1EUCA 1FXWF 1QIIA 1H6DA 2UUPA 1V41E 1WD7A 2NUTB 1DWUA 4L6IA 4MLCA 4RK4A 5C31A 4DG8A 4XJVA 1JDVA 3KLMX 1A4UA 1TAQA 3K8YA 4LNUA 3ROZA 2WUGA 3VXKA 3A1DA 3EXFB 5HR5A 2Z4SA 4JB8A 4ZEWA 1NWCA 1T9GS 3GNQA 1BTOA 1CR6A 1QIGA 1PTJA 4N9QA 2JJ2D 3FOAA 3LY8A 1B1CA 4J16C 4DV5B 2C4NA 1BSVA 2ZFUA 2TECE 2ORVA 3KHTA 1JQ5A 4IIVA 4ALIA 3S2ZA 1WZEA 1Y1RA 1O6ZA 3BZWA 5JJBA 4A1FA 5FBKA 4PS0A 1Y9ZA 2G4VA 3AR2A 4FCTA 3BWDD 4JR2A 3UO8B 4ER5A 5F9MA 3BMNB 1Z0DA 2P90A 2EJWA 3OT5A 4DILA 4OXRA 4RHUA 1E1RA 1TAUA 1E2DA 4PLZA 4LZWA 2DR0A 4FD3A 3FCOA 4B6QA 3ZI7A 4GPIB 2X40A 2F9MA 1WRAA 4F7DA 4KQGA 3M8KA 1NFQA 3KJXA 5B1DA 2ZTLA 1E0JA 3GAAA 2VSOA 3O9VA 3TIGA 1XHEA 1CSEE 2AQKA 2E9SA 1Y4SA 1BHSA 2C7GA 3GL9A 3JW8A 3MSXA 3N3AC 2PJZA 3R6GA 1ECPA 5CVVA 1SFRA 1STOA 3RS4A 3PHGA 1UM8A 4L28A 4ZAVA 2FG5A 3SD9A 4MI3A 1SBHA 3KZCA 4RQTA 2AE1A 3D4IA 2JAHA 3OEHD 1EBFA 2QTHA 1P18A 2H1VA 2AQHA 1FFXB 1IAVA 2EWVA 5KTSA 3KC2A 2MCFA 3TVDA 1GTZA 4BIMA 7ADHA 4Y6RA 4JHXA 3W5VA 2O1XA 4A8TA 4V03A 4YLGA 2GO1A 1C9YA 1GZ4A 2F4VB 1LFAA 1PWYE 2BKVA 3CWZA 4H77A 4RV5A 4S1WA 3S1LA 3TM5A 3I3SR 3ITDA 3WGGA 3S2SA 3B20A 1W5EA 1LDGA 1UCFA 2FETA 3OZIA 4B4DA 1XVUA 1AKEA 2FW9A 2EU8A 2OAQ1 3HUUA 4MW0A 3TMKA 4UZEA 1ZMRA 3FOEC 1HM5A 4WY5A 3U3MA 1CJSA 2EEZA 3I6YA 3LFUA 1Z0AA 2YWJA 1RSZA 3ZTWA 2Z6AA 1EWTA 2VJQA 3NOQA 1U8TA 1SUFA 2VP3A 1DNPA 5JD3A 3B9QA 3M82A 1EP3B 2DTDA 2Q6KA 3LE8A 4FHDA 3HJAA 4H15A 2C82A 3HDHA 3QGMA 4HEQA 3C6BA 1QXSA 3L92A 3TSYA 1YZQA 5DFAA 3OA0A 3WIEA 1RQNA 3I8OA 3TZLA 2P18A 1I7LA 4W5OA 4ZEOA 2XXBA 1V8OA 1UFVA 2O57A 2I34A 1NVKA 3HV0A 1GG9A 3NC0C 3G0DA 3BFVA 1VPDA 4MQ4A 1RADA 1KK1A 4TYPA 1QPZA 1KOGA 5HMLA 2I54A 1I7QB 1X2EA 4IEIA 2CF5A 5DP2A 1C1XB 3W2HA 5ALKA 1RLJA 3DYVA 2NZYA 5I9MA 1ZGGA 4I9NA 4S0ZA 2WHRA 1UXGA 3FMOB 4M0PA 5CP8A 2Y1LA 1ZPDA 2AMLA 4MMXB 4YAFA 3H9QA 2BEWB 3CZMA 1QWSA 1W94A 5A06A 1CNFA 5FYDA 3IKMB 5JVDA 1E8MA 1ZBDA 3AVQA 4XM0A 2IYVA 2OLKA 2QRLA 3HJTA 2FLVA 3N1UA 1JLSA 4Q15A 1ABFA 1DVRA 2O5RA 2X1MA 3ICVA 3QTLA 4FILA 5ILOA 4PZLA 1MOSA 4ZMSA 3R0VA 1EK2A 1G8GA 5JJCA 1OKKD 1AIPA 2C8JA 3DG9A 3UOAB 3PHHA 4ZD6A 4CIBA 4LDPA 4YDSA 5DX8A 1U63A 4FR7A 2QMHA 2XF2A 3GLKA 3L4KA 1KJ9A 4GICA 4D9EA 1DAOA 2YMPA 3T9FA 3MCWA 2QEQA 2FSPA 1R0ZA 2YRFA 1D7OA 1DAFA 4ED9A 2C2YA 1XCPA 2CD9A 1ZN9A 4O25A 2QN7A 1L4HA 2I7XA 3S44A 3O4VA 2W6ID 4LWQA 1F6WA 2BEWA 4V0QA 4C30A 1JP7A 3RSSA 3U39A 2QP3A 3OKCA 5EP3A 1ZRMA 1YH3A 3A6KA 3SKYA 1Z2AA 1LK0A 4CMAA 2PQ6A 3SJZA 5CB4B 2ZYAA 2O8BB 3T61A 3ZHRA 2RK6A 4BEWA 5B3JC 5TEVA 1QV9A 5J2UF 2E1PA 1OWPA 3SC6A 4Y6OA 1PV1A 4YRPA 4PNEA 4LF9B 1LD3A 1XGKA 4MLDA 1LVUA 4U9UA 3VDRA 1HYBA 4AUEA 4BMNA 2AZXA 2ZBVA 3CONA 2WRZA 2YV2A 2L69A 3WR5A 4MINA 6PFKA 4U9HS 2R6HA 4I9HA 3AOEA 1WBJB 3P9RA 2SECE 3UENA 1Q91A 5AKZA 4G0WA 1GVNB 3KWFA 3K4PA 4BFTA 1PGNA 4NC9A 2C59A 3E3OA 1R2QA 1YR2A 1BROA 2GZDA 3ICOA 1A8UA 1AU9A 3K2EA 5AI4A 5D6NA 4BU1A 1MC1A 3OF2A 3J81k 1WU8A 3GPLA 1C41A 1B00A 3X1KA 3KTDA 3GB9A 4PLVA 1T43A 2FZGA 1DC6A 2DFNA 2QZSA 3A2LA 1AE1A 2YTZA 3O4HA 2HPAA 3UQZA 1FSGA 1G8MA 3SI7A 3DTVB 5P8WA 1WAMA 3UVEA 3JTEA 2VWHA 1D5WA 4PV7A 4YJDA 4N7RA 2F1HA 4YRIA 3L1JA 4EFDA 3M5DA 1QF7A 1VLLA 2AMFA 4D97A 2B6HA 2QVXX 4GBED 2AUTA 4GR5A 1CIPA 2C4MA 3GAFA 2Z56A 3U9LA 1WCYA 1WKCA 5ESWA 2J9GA 2ZS9A 5A1TA 4PZEA 1JHOA 4UU1A 5G4LA 3FPFA 1NSYA 2BG7A 4RGYA 4UKDA 1I6WA 3K31A 1YDEA 1N4AA 4AJ2A 5ADHA 2O2CA 5IRCD 2YCBA 3BDAA 1XNHA 3GH3A 3OCVA 1OZHA 3U4QB 2Q8PA 1X8JA 3HBMA 4JENA 2HEIA 2UYQA 2ZE5A 1WOMA 2Z8XA 4K9OA 4NE2A 5L3ZA 1QVAA 1SURA 1TX4B 2CZQA 1J56A 4L8GA 4JB2A 4DWJA 4WN9A 3OFNA 1MX1A 1VBNA 3CRVA 2QRHA 3O4FA 4QECA 4YI3A 1GTSA 3OQIB 4AIRA 4PHGA 5C3UA 4B4UA 5LQCA 1LLQA 5AI6A 3E9RA 4Q4AA 2ZJ5A 3G8DA 2GMNA 2IUFA 3RF7A 6CHYA 2VNJA 2WOOA 3P2KA 4P3NA 4DHEA 1ID8A 1EGAA 4CQMA 4WPGA 1BGXT