1YCGA

X-ray structures of moorella thermoacetica fpra. novel diiron site structure and mechanistic insights into a scavenging nitric oxide reductase
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
398
structure length
398
Chain Sequence
b'SQPVAITDGIYWVGAVDWNIRYFHGPAFSTHRGTTYNAYLIVDDKTALVDTVYEPFKEELIAKLKQIKDPVKLDYLVVNHTESDHAGAFPAIMELCPDAHVLCTQRAFDSLKAHYSHIDFNYTIVKTGTSVSLGKRSLTFIEAPMLHWPDSMFTYVPEEALLLPNDAFGQHIATSVRFDDQVDAGLIMDEAAKYYANILMPFSNLITKKLDEIQKINLAIKTIAPSHGIIWRKDPGRIIEAYARWAEGQGKAKAVIAYDTMWLSTEKMAHALMDGLVAGGCEVKLFKLSVSDRNDVIKEILDARAVLVGSPTINNDILPVVSPLLDDLVGLRPKNKVGLAFGAYGWGGGAQKILEERLKAAKIELIAEPGPTVQWVPRGEDLQRCYELGRKIAARIAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nitric oxide reductase
publication title X-ray crystal structures of Moorella thermoacetica FprA. Novel diiron site structure and mechanistic insights into a scavenging nitric oxide reductase.
pubmed doi rcsb
source organism Moorella thermoacetica
molecule tags Oxidoreductase
total genus 134
structure length 398
sequence length 398
chains with identical sequence B, C, D
ec nomenclature ec 1.-.-.-:
pdb deposition date 2004-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ycgA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1ycgA01
5DPXA 3N3BC 3ES9A 1ZWKA 1GG5A 2A7MA 4QOHA 2KLBA 4FR7A 5JROA 1HLKA 5A4KA 4KEQA 6NULA 2XODA 5EW0A 4WD6A 1CZHA 3P2UA 4U7GA 3FNIA 4BZ3A 2Z9BA 1YCGA 4LA4A 1WUOA 3F6SA 3NHPA 4QODA 3RKJA 4DY4A 4XUKA 4D1VA 5LJLA 4FX2A 2QJSA 5LMCA 1KR3A 3N3AC 3DHCA 3T3OA 2BF4A 1AG9A 2YNVA 2V5VA 1YKGA 3NHSA 5LM6A 3NHRA 1SQSA 3LVZA 4KEPA 1AKQA 3NHKA 4HKYA 3K20A 2FDXA 1YCHA 4ZO3A 5ACUA 2VW8A 3TEMA 1YRHA 3HA2A 3R2UA 3TP9A 5KILA 4C1GA 4O98A 5ACSA 1K07A 3KL7A 1JA0A 5EV8A 1QBGA 5F12A 1YCFA 5HIOA 3ESXA 1KO3A 3W79A 1AKVA 1BVTA 3BC2A 1WSWA 5EHTA 4H2DA 5NULA 1QHEA 3FCZA 5LCHA 4Y9UA 2BG2A 4U4LA 2FZ5A 5NLLA 3SFPA 2YNTA 2AMJA 4UWOB 3NHUA 1WUPA 4H6PA 3NHYA 1RLJA 3IE0A 1XM8A 1RLIA 2ZO4A 1CZOA 4UBQA 1T0IA 2QWXA 2B3DA 1C7FA 2WC1A 3OX3A 4H0DA 1ZWLA 2HNBA 3L9XA 5ACXA 4DILA 4AX1B 3F2VA 2R96A 2YNWA 5ULLA 2BFZA 2AIOA 4QOEA 2QEDA 2E7YA 2FAXA 1DDKA 5EA2A 2Y8BA 3ZNBA 1F4PA 3BK2A 1X8GA 1TLLA 2I7XA 4XDGA 2I7TA 2Q42A 3NLLA 2FX2A 3T3NA 3ESHA 4PTYA 3GFQA 3ZR9A 1AKTA 4XWTA 5F51A 4JO0A 4ZVMA 4ZVNA 5LBTA 4N9QA 1H69A 1ZNBA 1J9EA 3N39C 1C7EA 1OFVA 1RTTA 2BN4A 2Q9UA 4LAFA 2BC2A 3PY6A 5EH9A 2GCUA 4EXSA 3I0VA 1BMCA 3FW1A 2QMYA 4RAWA 3T9MA 4D1UA 2Z98A 1XI2A 1XYYA 1D04A 3ADRA 4GI5A 5HH5A 1CZUA 1DXQA 4YAFA 3OX1A 2R2DA 4D02A 4CHLA 2MT9A 4GQIA 3P0RA 1H66A 1FX1A 4ZVKA 3GFSA 5FA6A 1A7TA 1XYVA 2X2PA 4PU0A 2FOXA 3NHLA 4C1HA 2GSWA 2QMZA 3KAPA 2ZNBA 1TIKA 4YAUA 4RM5A 2WRSA 5ACWA 5LJIA 1QH5A 4FSBA 3WXCA 3U7IA 1BVYF 4FGKA 5IQKA 4Z6XA 3X2XA 3DH8A 4LTDA 5A87A 1AHNA 3QFCA 4P62A 4YALA 4XDHA 1I1OA 2MWMA 2F1OA 2W5UA 1CZKA 2P97A 4UWRB 4HL1A 3RKKA 2N1MA 2YCBA 5ACQA 5LBUA 3EDOA 4FGJA 5B3LA 3ZHOA 5B1UA 2QINA 2Z9CA 1KBOA 4C0WA 3IEKA 3UXEA 2HNAA 1SMLA 5LCAA 4Z67A 4ZVLA 4CETA 4EYLA 2GFKA 3SW3A 3KLBA 3KNSA 3X2ZA 4Y9RA 2XOEA 2HPVA 2DKFA 4YSLA 4GYQA 3I14A 2ZKIA 3B6JA 4PTZA 4CF6A 5FQCA 5ACVA 1AMOA 4V0HA 3IE2A 5KIKA 4NQ6A 3TZBA 2HB9A 3QH8A 1ZTCA 4PVTA 3OJXA 3RPEA 2I7VA 2KQUA 3F90A 2QR2A 1VJNA 5EAIA 5AXOA 2QX9A 3OJWA 2OHHA 2BR6A 1AKRA 4C76A 1QR2A 3H3EA 3X30A 2M5DA 3I13A 2BPOA 4TZBA 3TE7A 4EXYA 2M5CA 2OYSA 1X8IA 2MOKA 5LLDA 4LE6A 5EVBA 4DIKA 3NHFA 4D1WA 2Z9DA 3O73A 1M2XA 3OWHA 3ZWFA 5B15A 1J9ZA 3GAMA 2M6SA 2FU9A 5ACRA 4C1EA 4RAMA 2P4ZA 4AWZA 3SBLA 2X2OA 4TZFA 3HLYA 1VMEA 4UA4A 1V4BA 5ACTA 5EV6A 5LCFA 5A5ZA 2CBNA 4UWPB 4ESEA 3IOGA 4ZNBA 4QOFA 3R6WA 2WHGA 5AXRA 1BU5A 2Q62A 3VQZA 1FUEA 4F6ZA 4NQ5A 1FLDA 3G5MA 4R81A 2BZSA 5AHRA 2V5UA 2FU6A 2XF4A 4C0XA 2Q0JA 2WYMA 3FAIA 4HS4A 3W77A 4PVOA 2QDSA 4GR9A 2BMVA 3IELA 2FVXA 2BFZB 3BV6A 2QX4A 4C14A 2Q0IA 5HH6A 5K4KA 5K0WA 1A8TA 4ICIA 1Y44A 2Y87A 5AEBA 5EWAA 3A4YA 3L6NA 4U7FA 5EVDA 2D5IA 1T5BA 2QX6A 4AX0B 2FHXB 4F8YA 1XT6A 1MQOA 5EMNA 4BMOB 4N82A 1YDGA 1CZLA 2BG8B 4Z5ZA 2OHJA 2GKLA 1DXKA 2FZVA 2GFJA 2NZEA 1WW1A 2WYLA 3JXPA 1QRDA 1NNI1 4Z60A 4D1TA 5HH4A 1J9GA 2UYXA 3MD7A 5FQBA 4ZO2A 3HR4A 3IOFA 3B6IA 1FLVA 3O2NA 4S24A 1YOBA 4FEKA 1SG0A 5FX2A 3NHWA 5B3KA 4YQEA 1RCFA 3W7AA 3NHJA 5B3RA 2FK6A 4XWWA 3X2YA 5ACPA 1XTOA 3SRXA 4YSBA 3KEGA 3JSXA 4N65A 1OBVA 4OXXA 4ZEJA 1FTGA 2NZFA 2XR1A 2BMIA 3VPEA 1JJTA 2WYMC 1KO2A 2BFLA 3LT5A 4NULA 1B1CA 4TZEA 1AKWA 4U7HA 4YAWA 2QX8A 4NQ4A 1JT1A 4C1DA 5F4BA 4Z5YA 3W78A 4GYUA 2DOOA 4EYFA 4LTMA 2FM6A 1JA1A 2FCRA 3B6KA 3U7RA 3QFRA 2A5LA 3FX2A 2ZWRA 5A0VA 1D03A 4TYTA 3KNRA 4TZ9A 2P18A 5HIQA 1WSBA 2YNVB 4QOGA 5TGZA 5AHOA 4UWSB 5K4NA 2OHIA 3UXHA 3AF5A 1FLNA 3L9WA 4J5FA 3KAQA 4NQ2A 2P1EA 3G1PA 4HEQA 2AZ4A 4C09A 5AYAA 3F9OA 3SD9A 2FU8A 4FGLA 1X77A 5LE1A 3ZQ4A 3AJ3A 4Y7CA 1FVXA 2MTBA 1X8HA 1J8QA 2RG1A 3FJOA 4RBSA 1DD6A 3F6RA 3OVMA 1P9EA 4LTNA 1WRAA 1E5DA 4F6HA 3QE2A 3IDZA 3I15A 3DHAA 4RL0A 1DXOA 4YSKA 3OX2A 2GMNA 3S2YA 5K4MA 3SVLA 1DX9A 4GCWA 2BIBA 3RPCA 2YZ3A 4C1CA 2FLVA 3ESZA 4TYFA 1KBQA 2BG7A 2YNTB 2BTNA 1VGNA 1L9YA 5FUQA 1FLAA 3GFRA 3OWXA 2ZZIA 4BMPB 3Q6VA 1CZNA 4AD9A 3K1YA 4QOIA 3PY5A 5LSCA 2ARKA 2BGAA 5LVAA 2FU7A 1D4AA 3FVWA 1AZLA 4HL2A 2R97A 3I11A 1ZKPA 2FHXA 1AKUA 4J5HA 1ZX1A 2NXAA 3IEMA 3BK1A 5A0TA 4NLLA 4AWYB 2Y8AA 3D7NA 1QH3A 2BG8A 4EY2A 5BUCA 4B87A 2BFKA 3B6MA 3AF6A 3PG4A 4Z7RA 3DHBA 2QDTA 4BP0A 1CZRA 3SPUA 2M6RA 4RL2A 5FQAA 4EYBA 2BG6A 5EVKA 4YAOA 5LS3A 2NYPA 5HISA 2H6AA 1OBOA 4UAMA 4EFZA 5HIPA 4QOJA 3NFRA 2V9CA 3IE1A 4J8PA 3EYWA 4C1FA 3S0ZA 1BC2A 4M0CA 3LCMA 2YNUA 1JJEA 3ESYA
chains in the Genus database with same CATH superfamily
5CM2Z 1N2BA 5K0CA 3P9QA 1OLSA 3O2JA 4U1RA 2IPXA 3R3HA 4FIDA 4CQLA 1JB1A 4RNDB 4QAJA 3AW8A 1T5OA 4EF5A 3VR2A 2E4YA 4KTTE 2B4TO 3ZD6A 3KQQA 1EFKA 1NXOA 1K92A 3L01A 3OEHA 2DWOA 3RF6A 3WGUA 2RGUA 1JDNA 1JN0A 1MOSA 5AUPB 1XMOB 1YJBA 3FPSA 3GRFA 2A84A 3NOQA 3I9NA 4NCBA 4IOLA 3PIDA 4WLUA 2Z9BA 3MJEA 4LVOA 5F64A 4AG3A 2WKSA 1WABA 2X15A 3AUXA 4CMAA 5HZGA 3GD7A 4BPRA 4EGQA 3RKJA 5B57C 4JKIA 4YJ3B 4DRXA 1EESA 1GWNA 3QOYA 4JEIA 3SXUB 3EC2A 1ZUIA 4EUFA 3HNPA 1RXWA 1MG5A 1AG9A 2AQIA 3G2PA 3OBBA 1NRIA 5KNDA 1JSLA 1K2WA 2YYAA 3AR2A 1K86A 3R0XA 2V5VA 1M75A 3WSVA 4GBGA 4BLWA 4EHNA 3GLGE 2XF8A 2CW5A 3OLYA 4DR3B 2QSZA 4BNDA 4GOOD 1BXKA 1U7DA 2Z2YA 3ISJA 2JGIA 4M86A 3W6NA 3C3BA 2IDKA 3GEPA 1QO7A 2EF0A 3DOIA 4TXNA 4EY6A 3G0OA 1N9KA 2XQIA 1NBIA 2QM0A 3M6FA 5ICMA 4EPVA 3K70D 1FNCA 1RI4A 2ZULA 3F9CA 4GVLA 3DA8A 1OC4A 4UXIA 1E0DA 3WAGA 1YBVA 2W2PA 2D7CA 2W11A 2FEKA 4BV2A 4MB0A 4RCYA 3FI0A 2Q1SA 4YMWA 4O98A 1EWTA 4B83A 5EIOA 3RHZA 1ETUA 3TW8A 4CR7A 1PL0A 3AIOA 2BEUB 1NF8A 5DTIA 2XVYA 1P1CA 5B7NA 2IYXA 4E07A 1OX4A 1U1IA 5J1TB 3HCOA 1P91A 3DXYA 1ZN2A 2BTQB 1AKVA 1TGVA 1R0XA 5DXFA 1WNTA 4P7GA 1LBTA 3FYSA 4QULA 2HQRA 4QWMA 3QJGA 4DLYA 1EVLA 2J48A 5FPSA 3HB5X 3UCFA 2PQ2A 2OAGA 2BG2A 4FMCF 2FSVA 2IXAA 3SICE 4BHTA 4KH0A 3U49A 1WZCA 2AMJA 1NUHA 3KZ1E 3MJCA 1HQKA 4PRKA 3MC1A 2Q3CA 3RHTA 4QXPA 4TQ9A 2A1TS 5JXJA 3NJRA 1MU0A 1PS9A 4I6JA 4Z99A 2IDMA 4MROA 4FK8A 2ZAOA 4GH5A 4XD7D 3HI6A 3BGVA 4ZI5A 1OX5A 4U7PB 1Z74A 5ACXA 2YXNA 3FRJA 3A58B 1JAIA 1P4GA 2WYHA 2V65A 5BYBA 4NI5A 2PANA 2HPHA 2AIOA 2J30A 2X77A 2ZRBA 1PJAA 1HLDA 5D85A 3MYYA 4WNAB 4RAOA 3U1TA 3CCFA 4JVSB 2PBRA 4MGZR 2OXTA 3BGSA 3IXMA 3IIKA 1Y1KE 2GN1A 2PR2A 1W93A 1MV5A 4MRNA 2V9PA 1FMTA 3DLAA 1XK6A 2I7TA 4IS3A 2POQX 4XDGA 1S02A 2W00A 4UMFA 4QQKA 1EDBA 4PTYA 1W0KA 1JKJA 3VBCA 4H7KA 5EZ5A 3DUFB 5B30A 3EG9B 4ZVNA 4D0SA 3NVKI 2FPLA 4BO8A 1H69A 1ZNBA 3CW9A 3GNSA 2EKDA 1R27A 1CXZA 1JJVA 1E9FA 2NUTB 4A6EA 4AURA 4WASA 4XQ9A 3ZE2B 3ONDA 4TLAA 1NM5A 5DW0A 4JNCA 3TX2A 3SIPA 3AKYA 2JG3A 2IWRA 4EI2A 2QJTA 2WUEA 4EG3A 1E8MA 2H31A 3CYFA 1G5QA 3UJ3X 4EA6A 2C3UA 2Z3WA 3AFHA 5ETJA 3RLFA 2BUCA 3OZEA 1KYWA 1MEOA 1JSZA 3ZY4A 3BCHA 2WWFA 3RWOA 3ADRA 2WQ7A 4XARA 3U7RA 3LK7A 5C32A 2GCOA 1Z6GA 3M5WA 4LX8A 3SQWA 5DRYA 3VYWA 1THMA 1WUJS 3SE7A 2BL4A 4GLLA 4IH9A 2RFLA 4BKOA 1EQUA 4YQFA 5AI8A 3TSAA 5HKOA 1I3OA 3G82C 2CD9A 1NVEA 1WB4A 2I66A 5EP3A 1N0HA 2HA3A 3IQWA 3U3JA 5HVNA 2Z6UA 2NSLA 3DDUA 6REQB 4FFWA 1BJKA 4BC1A 5ACWA 5DHQA 2QP4A 3F98A 3P9KA 1T4CB 3AV0B 2J0EA 3NC1C 2PDAA 3Q0IA 1R88A 3CUVA 4KQWA 4EI9A 4JYBA 3B1JA 1E32A 4XPIB 1R2QA 3BB3A 2J87A 2X9NA 4IIXA 5A5GA 1YDMA 5DISB 3T5TA 2ZRGA 5C46F 4O2AF 1OH7A 3H5TA 2WF5A 1HDCA 4LTDA 4R1NA 5LDGA 3TJZA 3I6ZA 3VNSA 1Y80A 1TF7A 3O4HA 3HBJA 4MW2A 3TR0A 3NBKA 1NP6A 1UQRA 4GYJA 3O8LA 4RKFA 4M1WA 1NURA 3EZ2A 5DWVA 3SFZA 3PDJA 1DNPA 4RWEA 3U56A 3SC6A 1R6VA 5C5IA 2FEAA 1BXZA 1UM8A 4LYDA 3PNKA 4Q66C 4S2UA 4EW1A 3SS7X 1NDQA 2LR0A 3B1KA 4EX7A 3TNFA 5KJFA 3RRFA 3V5NA 3GLKA 4PZUA 4X8OA 1UT8A 2PH7A 2RHBA 1FW6A 1H6AA 5I4IA 3UBTA 2BEUA 3LBAA 1BE6A 1K7CA 2HPVA 3K0CA 2BTQA 4P53A 3UK0A 1MEJA 3CLKA 3MTJA 3VA7A 3HNOA 4J0CA 4W5HA 1PDWA 4QVGA 4RIIA 4WT7A 4XQGA 1RC0A 3NBXX 3MCTA 3OOEA 1V8PA 3LXXA 3ZVNA 1VL1A 3KJEA 4IXDA 4ZDIA 1OHHA 1CRWG 4GS5A 3OQVA 1Y4ZA 1VB5A 2OWDA 4R7ZA 2F90A 3C43A 4CIBA 3KLMX 1NQXA 5LD2B 4YI3A 1OZFA 2XYRA 1WE2A 3CIOA 3MAJA 4RPHA 1PR2A 2FQXA 3GDWA 4LXIA 3WIVA 1KS9A 3FSRA 2O2ZA 3GARA 3AL0C 1UXOA 1I5OA 3PUKA 3I13A 2BPOA 3ZI4A 5H81A 4PNHA 4IO0A 4S04A 5JASA 1L4HA 3PPWA 1DKNA 5FA8A 2YBDA 4QYWA 4M8IA 3QVTA 1POXA 2TRSB 3SOZA 2RDMA 4WNYA 1KZHA 1SKMA 4WD3A 4HDRB 4M8KA 3T9FA 3IR7A 4F3TA 2A5YB 3FNGA 4Y2RA 3V42A 2Z58A 4JR0A 3N7AA 4WNAA 5K0LA 4EGFA 1VCHA 3BGWA 1IUPA 1VJRA 2IIBA 3EPLA 2XE7A 4PLGA 1NIJA 1Y6ZA 4QJ5A 3ZDEA 2ZETA 4YI5A 1OGJA 5KNCD 1XAGA 3AVOA 2R1UA 2ZPUA 1M2JA 4NNPA 2JASA 4CKCB 5L3QB 5L7YA 4FFSA 3CZAA 2VCEA 5B15A 1TUBB 1PJ3A 2QUAA 3P9NA 3WLRA 2BEKA 2ETVA 4DJ5X 3QUQA 2PT5A 4E70A 1ZU4A 2EWVA 3EG9A 4XJVA 3RF7A 3SBLA 3GN1A 5DSTA 3QNUA 3UMBA 4ZV4A 3RRZA 3FHCB 3E48A 1FFDA 3B7GA 5ACTA 4GMFA 2WPDD 2E5FA 4I50B 3WB9A 1TF5A 3A6ZA 3FUCA 1U7HA 2HRDA 4C01A 1Y1LA 3IDOA 4MYSA 1L6IA 4TV9A 1UKVY 3OFNA 2H65A 4OKSA 2OXCA 3VQZA 5IVKA 1HC7A 1PWYE 5LC1A 4U6NA 1QH8B 3H9UA 4PPGA 4PZCA 2X3YA 1SCIA 2D4HA 1MIHA 2V5UA 3DLBA 1HNXB 2NVUB 3LC0A 4JC0A 2VOEA 1A3CA 3V8VA 4HBGA 3ZUPA 1M2EA 1HLFA 3WWOA 4C14A 2M1ZA 1XG5A 4IIDA 1GNVA 1QNLA 2FR8C 2Y2VA 4HNSA 4B82A 1LPNA 3W2FA 2XCOA 3BD8A 4GX1A 5P8WA 3E8XA 3IULA 4ICIA 2XKBA 4IY1A 4CL0A 1DJLA 1PW5A 3ZWAA 2GFQA 4BNWA 4MVYA 1Z4KA 1Z0DA 3UJBA 1D5CA 3E9EA 1AV7A 4N5DA 1N4DA 2VL7A 2RC5A 1ZJ5A 3SC3A 1LLCA 1OFUX 1NVDA 4L9SA 3IIIA 4XPIA 2AE1A 1E6EA 1ZMTA 2PTHA 3I1JA 3IIMA 4FEYA 1DC7A 2HK6A 2HQSA 2JFOA 4ALLA 4BE4A 1YOVB 1SXHA 3TM4A 4TTQA 2RHCA 2P6UA 4PSDA 1JU4A 4PLWA 5ELXA 3RS7A 4WK2B 2ODWA 3PU6A 1XA0A 3TTTA 2GA8A 1KOJA 3KEOA 5D5PA 3SYMA 4CQMD 4D1TA 2DPMA 3OPYI 2DMRA 3B13B 3SVZA 3ENZA 1SUIA 1MAHA 5CIQA 2HBYA 5C34B 4EJFA 2IDJA 2P11A 1VFPA 2G8LA 3CW2A 1U0HC 2YUTA 4HFJA 3OY2A 5BSRA 5JNSA 5AI5A 4QLBA 3R0QA 3UWKA 3P32A 4BMVA 1M8PA 3PPIA 2VC2B 3DEJA 5JCXA 2QTNA 4ILKA 3H9EO 5AXDA 5AFSA 4FOOA 3RSOA 2VSQA 2A1IA 2A9PA 2IS4A 2HK9A 2VCYA 2YRWA 2FUG6 3ZH9B 2YINC 5GTDA 2JAOA 2G8NA 3M4JA 3PE6A 3NDIA 1JR2A 4TM7A 4DSNA 4E2YA 3HXMA 1FTGA 1I51A 4Q5IA 5JBIA 2AFIE 1DXYA 1KFEB 1YKSA 2ZWVA 2HXGA 3ZTTA 2VDOB 4U6SA 2YVAA 1VHLA 1WMFA 4KYUA 5K8CA 2BFLA 1A9TA 4BFLA 4X6LA 4GLOA 3SG0A 3C14C 3OPQA 2FU5C 4KUGA 2BDEA 3A1VA 3A3OA 2P4EA 4NENB 3A3NA 4N48A 5CLHA 3TMYA 1A9RA 3NIFB 4LRYA 2E0IA 1QIKA 2OA0A 4YXWA 3D64A 4RY8A 1PJLA 4LJAA 2Z09A 4AJHA 4NHEA 2CDNA 5E9JA 3QELB 3SZOA 3NV9A 3K0HA 3NOXA 5A0VA 2AR7A 4NCIA 4M1OA 4RFVA 2YNVB 1FYVA 2Q1XA 2WJGA 3OMLA 5TGZA 4HDRA 4HAWA 4TZTA 3GLTA 5C1IA 2PZJA 1YBMA 3PS9A 4UWSB 4IJVA 3AF5A 1GKIA 5KNBA 1GL9B 2IPNA 1U0NA 3FDIA 3MMZA 1OAOC 4PFJA 5ESRA 4EZEA 3LRTA 1YU9A 3SYRA 2QRVA 5JH7F 4NQ2A 3QWBA 2O2YA 4YCNA 3CN9A 2AFHA 3PNVA 4BP9A 1WQ1R 3HXQA 5AJLA 1OBHA 4MAFA 3A70A 5KWJA 1NZDA 3EEYA 4FGLA 4EG0A 1Q92A 4CKCA 5L3QA 1SRQA 1T1IA 1TUBA 4A2QA 3Q1LA 5DXJA 5FYDA 4OI4A 1HEYA 1WZEA 4PGFA 4EVRA 3T4UA 2RGAA 1DG1G 2P2SA 3F49S 4TSFD 4D1YA 1HR0B 1N5KA 5JEDA 1J5EB 3OC0A 1L4EA 2J3HA 1RXIA 4F6HA 4M1SA 1XZCA 3C1TA 3D7KA 3ENWA 4ESHA 1DXOA 5CD1A 2PV0A 4ID3A 2BR3A 2VPQA 4I50A 3L8GA 1H1LB 1RC1A 2PWPA 1IXRC 1BXGB 2HIAA 4BRUA 4D3ZA 3DZKA 3U37A 3GRZA 4PC3A 4ZQBA 2ORED 2UUOA 2W48A 1S3FA 3DEAA 3D3QA 3DCIA 1EGVB 1KXJA 1T3HA 3FNQA 3QEKA 4P0TA 5F98A 3E0QA 1OWNA 3GDOA 3C2QA 2IS6A 4NE7A 2AJLI 3QSYA 3QLVC 1MB3A 4FDMA 3EIUA 3RU3A 4I8IA 4XM2A 4RSHA 3DNFA 1F6DA 1U8XX 2NVUA 3ENKA 4IYRA 5HJ2A 4HPXB 4MKRA 2O7NA 2W0MA 2PWAA 4AJPA 4D9EA 4FR5A 1WBJB 2P9HA 4EFDA 3CRZA 3DDCA 1OZAA 3AI1A 2FW1A 3EGDB 3NM6B 5KZMB 3LX4A 4RS3A 3P7MA 1YT5A 1ATIA 1NI4A 3ZBQA 1HFEL 3CVYA 4JQOA 3PZRA 1EZZA 1I3NA 1Y8RA 1VHQA 2ECFA 2PHZA 3HCRA 4MHSA 2NWQA 5COBA 3U1BA 3FJYA 3QFTA 1CEEA 1VIVA 4MR8A 3P0HA 4UCXA 3RSLA 4EZBA 3IP6A 4YAIA 3E7FA 3LOPA 4NFHA 3TKYA 4D44A 3PDCA 1N25A 1FTYA 4FDAA 5FI1B 3HJCA 4REQB 1YOVA 3LQ2A 1YQXA 1XXHB 2SKCA 4V0LA 3ZWBA 1NZFA 1E9RA 3DDOA 3K16A 4OGGA 3L5OA 4J0DA 3V8NA 3DHBA 3ZDCA 3F6PA 4NYJR 3BA6A 1RLTA 5FHRA 5FUBA 4MS3B 5CK4A 3EUEA 3HCPA 2DF8A 1D2GA 5FPPA 1GFIA 4QEKA 4RKYA 2F3PA 4TMKA 4V39A 4JI6B 3BG5A 4H77A 1F0PA 3SZMA 1SU7A 4ZEVA 1IG0A 1U94A 4A91A 1AGYA 3SDZA 4BQFA 4AQYB 2EWWA 2NACA 4H16A 4EFZA 1DKRA 2OZLA 2Y66A 3TPZA 1YJCA 4P38A 3P8ZA 2CEAA 2VHWA 4G1FA 3RVKA 3RBZA 4ES6A 3CWQA 3LCUA 5BV0A 4LF7B 1WHSB 2ZRMA 3H5WA 1ADFA 2XA2A 1QQBA 2W8BB 1N1DA 4XQ0A 1MHTA 1IIRA 2HL6A 1Z5NA 2XVMA 3GEDA 3OEED 4LHZA 5IFKA 1L7MA 2V4MA 3FMFA 3H2HA 2WD8A 1IPHA 2DHRA 1H22A 3HHEA 4H1UA 2ILVA 4ZMBA 1BGXT 4QU0A 2GUGA 3HZOA 1XQXA 2PG3A 3JQEA 3EAGA 4DV1B 4A23A 1TCVA 4CM5A 2ECKA 1J97A 1Y1QA 2NQ8A 3TKAA 4V3CA 5ED4A 3QKRA 1A98A 3EIOA 5U4XA 3VTAA 2UXDB 3GLHE 2J3MA 2W0SA 2C2OA 2HDHA 1G98A 1U2GA 4JROA 2PZLA 4NOKA 1ZR4A 3G1TA 2CV1A 2CN1A 2ZIVB 4FP9A 3EVFA 3QELA 3WGQA 4EB6B 4HADA 2FETA 2XECA 2XKJE 4Q1FA 1KK1A 2YNVA 1SVOA 5AO9A 3GXBA 5JQGF 3WOHA 4ZXFA 4UBJA 1O2DA 3UC9A 3DO6A 1N1GA 4UTVA 1J8DA 4E7OA 1A88A 2FRDC 4QTXA 4LOJA 5TPZD 4HDNB 3GA7A 3AT1A 2XSZA 3MB5A 5H5JA 3KZKA 3MAGA 4EJSC 3AHIA 1RAIA 4GLFA 3K20A 3VR3A 1QYXA 3SEFA 2J9FB 2I2BA 4UBIA 1FFCA 4G0NA 4IGKA 1HNWB 3H4MA 4QDXA 1XMVA 4ZCRA 2GMWA 4M0PA 1JPUA 3CNOA 3A4TA 4LJSA 2IPAB 2REXB 1R9JA 5KQGA 4P2BA 2K7ZA 3TR5A 1YS6A 4I55B 5IM4A 1E9VA 2KBFA 4JC4A 3TR6A 1M72A 1YVPA 1H1LA 1KO3A 3SAJA 3BC2A 5TEVA 1WSWA 3H9BA 3C7TA 1PQYA 2X5JO 5LZ4A 1E3TA 4FJ0A 2WHGA 3RUEA 4OO3A 5EJ7A 4E15A 4IUCS 4WKNA 1GN8A 1GZ4A 3OIFA 2FZ5A 2H54A 4HDOB 3PE3A 3R9KA 2HEIA 4MS4B 1A5AB 3GU3A 3ZBUA 3N70A 1WG8A 1ZD1A 3HRIA 4Y0VA 3R0VA 1KJIA 2HF8A 1WUPA 3Q41A 2XQGA 2GRUA 4UUQA 1D7AA 5KYWB 3OT4A 1L4UA 2I7DA 5B64A 3B2EA 4ZARA 4A2CA 1JJFA 3DL7A 3E7WA 1VCOA 2QUBA 3KCQA 3KEFA 4E1BA 2DERA 4LQCA 1EG7A 3ONFA 4KQ6A 4OJQA 1FRQA 2QXUA 3FZNA 4RGVA 3CVWA 3LV8A 2DJIA 1J21A 3RAJA 4BCBA 1DQSA 2VKTA 1K4KA 5CTJA 3WMEA 2GHQA 3UCXA 3A9RA 3AILA 4KSBA 3I4FA 2EG9A 2YNWA 121PA 4U63A 2AG0A 3HCEA 3K9LA 2AW5A 1ACLA 1BRTA 2XD9A 1QFJA 3UZUA 3ENVA 5C5DA 3ILHA 1LI7A 4JX8A 1MVNA 2O3JA 1F4PA 5AKGA 5DYWA 1XXHA 2YJ5A 5FTWA 1SB9A 3D0QA 1L7EA 2OCLA 3KBOA 1T2CA 2Q42A 5EIWA 4OY3A 5FHQA 1KH3A 2DX7A 2EFJA 4LDNA 3I73A 3UMRA 4CF3A 4GU5A 3R5KA 2O3RA 4P86A 1AKTA 2V7QD 1FFHA 1W9MA 3OHMA 3LLVA 1NKTA 4H7JA 1T5SA 4ZVMA 1YFLA 5SY4A 3QH4A 3IAM6 3NKLA 1JQ3A 3OCUA 1KH1A 3KPWA 5BP7A 1Y6FA 3ZZTA 1F8YA 1OFVA 2GAIA 5DNAA 5CFRA 3UH1A 2BTEA 4I8DA 1YF3A 2Q9UA 2V6MA 2PJRA 1V4VA 5JNRA 1CQXA 3IVMA 3I4LA 1L4FA 3I92A 4JBWA 3QKWA 4O02B 2PKRA 3U4HA 2R8RA 4E5VA 5IT4A 1A1VA 1VJ0A 4K1LA 1RQNA 5AK4A 2ZUWA 1I24A 1M66A 3H8JA 2G25A 3PJEA 4FB5A 3THWB 4ZGBA 1VXOA 1WHSA 1E96A 3TKLA 4G1CA 2BP7B 1YZUA 2XDAA 2W8BA 5HMMA 4M9SA 3TBHA 1MF7A 3NNNA 1O7JA 4PNZA 1OXMA 4UU1A 3U4CA 3UANA 4ZK2A 4JLAA 2LDBA 3MLEA 3Q72A 2VYND 4NBSA 5KC9A 3IHLA 1F17A 1MZVA 1Z6PA 3BJZA 3GP8A 2AD5A 3UXMA 3TQOA 1UAAA 2QPAA 3PEYA 4QNRA 1GCAA 2G9NA 3PPVA 4TGLA 2ID8A 1Q6YA 4JSRA 5ES4B 2VLIA 4C7JA 2ZREA 3B85A 3LWNA 3TN7A 3VU1A 2XYGA 1HE2A 4RA9B 4CLEA 1FNMA 4DGQA 4LZOA 1H0RA 5JJ5A 1RRCA 2JFFA 2ZQ5A 1PT6A 2QQ0A 4RABA 4F4IA 1R15A 5LIPA 3WQSB 5IRCD 2VPYA 4MLCA 3PR1A 2ROQA 5HJ7A 2ZJFA 1CF2O 4IJQA 2NUAB 4P4TA 4NAUA 5IUNC 4Z7OB 4NECA 4OJTA 1T6XA 5LKRA 3A2KA 1XYGA 3CB4A 5JXWA 3LPAA 4ZT3A 4BZQA 1QGAA 3F8SA 4B4UA 1SWVA 3IPCA 4QPPA 1YR3A 2BRUA 1QFMA 2IYEA 2P9QA 2XT9A 3V34A 3TMKA 1B74A 5J40A 3OO1A 3ZVKA 2D8MA 2ZXUA 4OJMX 3USCS 3A9SA 1N5DA 4HDNA 2R5FA 1UUFA 4CCSA 3LAWA 2CDCA 1W36C 2IOYA 2OHVA 1CJUC 3CJTA 2WP8J 1W4AA 1MTZA 1XFDA 5TY0A 3TW4A 3TTXA 2OG2A 4FR0A 5B1EA 3TD6A 1UPFA 1U9CA 2ZBUA 2ZUDA 1G4HA 3UXEA 3KUXA 1SMKA 1TM5E 4W5NA 2PR7A 3K9NA 3V6LA 5DHTA 1NM5C 3UT5B 3IHTA 5TQJA 1ID8A 4I55A 5A6VA 4XUDA 2Z6VA 3PHGA 5AJZA 3MWFA 4Q1CA 4D0GA 1FNDA 2GFKA 3KTFA 1TKBA 3JD0A 3BHNA 2CHEA 4JR1A 5ITZA 2I76A 5AVVA 4KMSA 3ZZMA 1U0EA 1XQ1A 1TT5B 4EHDA 4ETWA 4NZPA 4CFYA 2GTPA 2VATA 2NTVA 4NP6A 3LXMA 3A2NA 1EEHA 2K5UA 1D6JA 4DIOA 4ME6A 4MS4A 2FPKA 2XIQA 3S28A 1ADCA 2I7VA 4FLMA 5AVXA 1ETHA 2OCKA 5C8XA 1I3LA 2C2KA 3EIFA 3LWDA 1JALA 3E7PA 4HN2A 4YT5A 4A0FA 4CNBA 1I5EA 3QVKA 2Q4DA 4DQKA 4OX9B 1XDUA 4YASA 1K0FA 2AFRA 3VR0A 2I7CA 3VX4A 2JHAA 1DJNA 2NW6A 1Y3HA 3MT8A 1DVRA 1E0SA 3QU4A 3P9CA 3TIXB 4E4TA 4N18A 3MS4A 1LJLA 3OF3A 4MI1A 5FLYA 3C4QA 2JFUA 2W2OA 5GONB 4N5NA 5C5EA 2O54A 1TYZA 1H9AA 3D6MA 1S6YA 1THZA 5A3JA 3I34X 5FB3A 2H1OA 2VHTA 3CUEF 3NAZA 4OVKA 2VUIB 1VMIA 2G09A 2JCYA 5ALIA 2FDCA 1MO4A 4KODA 3C15C 2BAGA 1UOPA 3UYLA 1L1QA 1AKNA 4P7BA 3DTVD 3CNEA 1QHHA 2EW8A 5TQVA 4F1WA 1V1RB 4H3SA 4RAMA 5I8WA 2QTVA 4BFVA 2PUHA 2UZ3A 3IB6A 3ZIUA 3L6EA 1QVVA 2DUNA 2HY7A 2MSLA 3H1TA 4WECA 3IA7A 4MYDA 4DAOA 2O2XA 1QIJA 5JSKA 3K8QA 4FFVA 2ZUTA 3QVVA 5BSKA 1BVUA 3I37X 4RD3A 2XF2A 2G4VA 5EJEA 5EV6A 1W73A 2C9BA 5K0GA 1U80A 2TMYA 4GKKB 4PM4A 1C0KA 2B9VA 5FAXA 2A4KA 5IMBA 3LM8A 4XIFA 3OM1A 3UV3A 2J9RA 4MVJM 3THWA 3K0CC 1PR5A 5BNFA 4L85A 4CKWB 4L3OA 3CF0A 3ZGVA 1A9YA 1XZNA 3CRW1 3MBOA 4AN0A 3K73O 4ISBA 4CTOA 3KSAC 2DTXA 3WYBA 3BYZA 2WD7B 2H1SA 3PF9A 2FU6A 2R60A 2Q0JA 1G5HA 2G76A 3KOMA 4ITVA 1DIAA 5D7NA 5BSHA 1JL3A 1R0LA 3FN4A 4QARA 1FYEA 4EFMA 2VJYA 3DLCA 2JC3A 5FUMA 5AT1A 2B4QA 4TT3A 5JRZA 2FYTA 4EENA 1BS2A 2CHQA 3KOUA 4QGGA 4RA9A 1LSOA 5YASA 2GEBA 4WACA 3X1JA 3MUEA 3ZTWA 4AMUA 3E35A 1KO1A 1L7BA 4G1VA 4OSPA 4NWIA 4REMA 3LRPA 5AK0A 4XR4A 4JQYA 5FUXA 5FPYA 3I9LA 521PA 4EB8A 4N6NA 5K3FB 2AC7A 4YP0A 2B4KA 2VDNB 1KJ8A 2NUAA 5FTMA 4DYDA 2FW7A 2QNIA 3D3KA 4M37A 4WCFA 5CR9A 1VLVA 1TMGE 4B71A 2BDUA 4YRGA 3HFJA 1A8UA 1K6JA 3H6GA 3UUEA 1LU9A 4BMOB 4N82A 1MQOA 3HWX1 4EDFA 4OHYA 1G8KA 1ML3A 1NBEA 1Y7IA 3GJYA 3MZ0A 4J2TA 3X2SA 3KSBC 3SBOA 1Y1PA 1UKBA 4DOMA 4EVSA 3TF5A 5CW2A 5HKKA 2IBTA 4U8GA 1Y4SA 1X74A 4LDRA 1TA0A 1QYCA 1U99A 3FDZB 3TFQA 4KO8A 4EKDA 2LXNA 5BR7A 3QE3A 1AMUA 5F23A 1IRXA 3M6XA 2GLUA 3Q2KA 3TVTA 2E5LB 5ALSA 3ETCA 3TLEA 4CCAA 1AB6A 3W2EA 2MSEB 5KC8A 4M0UA 5AK3A 2PGDA 3ADBA 4TTJA 3LF1A 4X8LA 1H2ZA 3RIHA 5GZ1A 5ICGA 2QROA 3LC2O 4BTEA 5B3RA 2NZUG 3LT2A 2GEUA 4XWWA 5EMMA 1IULA 1GRQA 5G0SA 4RCZA 2CLEB 5I5EA 1XZAA 5F77A 4Q6BA 4EF4A 2C03A 3VDMA 4DLWA 4DPLA 4CUKA 2B2CA 1KEUA 2DT8A 4N65A 1KDVA 1G4UR 2VSFA 1B0UA 1L7NA 1C2TA 1J24A 2V0GA 3PHLA 4FR2A 1JJBA 2XVZA 3GRCA 3U09A 4X85A 1QF9A 3TTYA 3WV5A 4I1SA 4ZVPA 1QRAA 3X43A 5TLSA 2ZR7A 4NOLA 1ZD5A 3IAXA 1JLRA 2QMOA 2GJ8A 2RHLA 2WJIA 3JQCA 1YIDA 2MHCA 2OCBA 4GNRA 4PXSA 1EIWA 1VE7A 4ARBA 5AI0A 1XDGA 1Q7RA 2OBLA 4M36A 4Q37A 4Y2YA 2V7BA 5A9SA 3SJCA 3GUUA 4FFRA 5DP1A 4RY2A 3GJ3A 1G0OA 4TZ9A 1JHUA 1JWBB 1O8BA 1HEUA 4ZOLF 2Y9PB 1UBRS 5LUBA 1BWRA 3QXSA 3SHOA 3VYTB 4AS2A 3FPGA 4JA2A 5IBCA 5J4LA 4EA9A 4TXMA 1HZZA 1GPNA 5GONA 1FFGA 1FLNA 1URPA 2P3QA 4UAGA 3HVIA 4V0MA 3QPVA 1U0TA 1L7QA 1XVAA 4B48A 1HDGO 1NHWA 4LXQA 5C0OE 4YV7A 1O4WA 3JQ9A 2GYUA 2OFXA 3PFFA 2ZIFA 1NNLA 1P7VA 3E22B 1N7GA 3D0KA 3LFHA 1X2BA 3MHPA 4R1UA 2WVGA 2OUKA 1EUZA 4B85A 1GZ7A 2QENA 1NNUA 4EBFA 1V1RA 4H4CA 1J8MF 1Q15A 2G67A 2PO7A 4FILA 2ZFUA 3P9ZA 1B0AA 1EA5A 1FFSA 1MTOA 4U2FA 3F6RA 5ALFA 4RDHA 3RANA 3VZDA 5JNUA 3FTEA 1E5DA 2ADMA 1XLUA 2ERYA 4LMRA 3IEIA 2R8YA 2V7TA 3AUSA 5AKKA 1R00A 3I3SR 3R7SA 4DVJA 2HBRA 4MQLA 4ZANA 1KYQA 4HO1X 1JECA 3HDJA 3LY7A 1W88B 4GBED 2O7VA 2A1TR 3DVSX 4C1CA 3VKUA 4G24A 4X1IA 1MVOA 1ZJ4A 1IZ8A 1MC4A 4K9NA 3R41A 1YH3A 1HTWA 3DAPA 5AOAA 4IXTA 1Z39A 4I5DA 4IDCA 2JBAB 2Q5EA 1CJCA 3WR5A 2TECE 5AW4A 4EH1A 1FS5A 1VGNA 4IG9A 4YACA 2YZGA 1PFWA 1OZHA 4QU5A 1V3QE 5EOVA 5PGMA 3VH2A 2XGOA 2VRBA 1H8EA 4JLWA 4IBOA 5TF0A 4Q18A 5LD2C 1TM1E 3HO6A 1XMSA 2YJZA 4QG3A 4OGLA 5GY7A 2L0XA 4GX0A 1BQ4A 2JJ8A 2XQVA 1A4IA 1N8TA 4N0QA 4BMZA 1XAIA 3PPYA 4MA0A 5G1NA 1OVMA 5K3FA 5C1DA 1T1EA 4KWCA 3RI3A 4KQGA 3E2MA 1GADO 3VU9B 1SVMA 1KXZA 1JHVA 2CDRA 2YJNA 4UQPA 4N3CA 1PV1A 4BJ1A 2FSIA 1ZMRA 3AC0A 5ENZA 4U9UA 1CUIA 1L8AA 1TQ4A 3T7KA 4ZI3A 3IIJA 2JVIA 4MPRA 3WGMA 5LOVB 3L6UA 3OA2A 3FDZA 1YZGA 3LP5A 1Q21A 4DNPA 3UJPA 3LQFA 1QX4A 3AW9A 4UUOA 5A6SB 4F7DA 3KT0A 4BB9A 3M6UA 2QG4A 2A78A 1G17A 2UKDA 4TT8A 3WB0A 2DB3A 2FSUA 4J0QA 3QBVA 5D00A 3U2QA 4E2WA 1YVEI 4U6QA 3KAKA 4AMGA 3SZ3A 5DM70 1C3EA 4IOMA 2FZEA 1ZHHA 3BDVA 3NUQA 3F4LA 3S1AB 2VAMA 3WS7A 1R6DA 3VSCA 4KIJA 4QREA 2C82A 3JZAA 1U0JA 2DQKA 4I4TA 2I2AA 3BRWD 3VDQA 3AI7A 3CZRA 3M6LA 4CU5A 4JCCA 4IFIA 5FFFA 3HM2A 1TCUA 3OZCA 4Q3NA 3RS5A 5HIJA 5JNLA 2ISQA 3UV6A 1ZGGA 2ZYIA 3SX0A 1UFQA 1VLMA 4C0AC 3E9DA 1HT2E 1D4FA 2NPIA 2V1XA 3JZMA 2HHCA 2HSEA 1HDYA 5E9QA 1OBFO 4FWBA 1TA9A 4FEAA 4JOCA 1EFRA 1CZHA 1E6UA 1UBSB 1UIRA 2HDWA 3U60B 3HKCB 1F1JA 3QV1A 5A5FA 5K6RA 1SUCA 4D4MA 4YO7A 1YCGA 4HDSB 2DPHA 3NTOA 4FT2A 4YMLA 4LW8A 2VA9A 3ROEA 1C1DB 2KB0A 2PXHA 3CLTD 4FHZA 1YHYA 4AKSA 3CQ9A 4J9UE 4NG5A 2G36A 2QEQA 3QYAA 4NQZA 4EJ6A 3OTGA 3BCSA 1YQ9A 2OD7A 3KSUA 4C04A 2IS1A 3JASA 4P5PA 2NV2B 4Z0TA 4PIPA 5EEHA 3UJ6A 3E3NA 3PC6A 4NFYA 5LXTF 5LM6A 3QWIA 1CF4A 3G2MA 4WIAA 2JCXA 2X40A 5KAPA 4ABYA 3TNDA 3AVWA 2LNDA 3OFSA 1SH7A 4Q02A 2PL1A 5B2FA 4ZI7A 3AZQA 3O9VA 4DCNA 2BH9A 3FSEA 3K5HA 5DHUA 3SLGA 4KDEA 3PC4A 3T5BA 3DHEA 4EA8A 2ODAA 3DW1X 3E7XA 2B0CA 3UM9A 3WK4A 1QG2A 4D42A 2O2SA 1UKEA 1F9AA 2VK2A 4B6JA 1FNBA 2PAFA 2IUYA 3G6KA 5F12A 2O57A 5CB8A 3F9RA 1J8FA 5SV2A 1VYTA 4DMHA 3OJEA 5JCJA 2YC4C 3OWOA 3OOHA 4U2BA 4KJXA 2D0DA 2XWQA 4FUQA 5EUCA 1X1AA 5COQA 1W88A 1P0CA 2KMLA 4L4XA 2AOWA 2Z4RA 2PRJA 1YGYA 2GM3A 4LYHA 4ZJZA 1JQLB 4BNJA 1SHUX 1GXSB 1WD7A 2JBAA 1I7LA 3HI4A 3HYNA 3PWKA 3QOFA 5F3RA 3ADPA 2H00A 4Z3DA 5K0JA 1G291 2Y1DA 3HQ4O 4JHXA 3TQFA 2COKA 1SVNA 5A4DA 2ZYUX 2QVZX 2GN9A 2QVGA 1X3LA 2Q0HA 3NXKA 4KBYA 1PJQA 2FK8A 1DTWB 1SEPA 4KVAA 5DLEA 4H0DA 2IU3A 4GXTA 3UT6A 2AW3A 1U2GC 2C5GA 1GU0A 4UTNA 4AX1B 2CBGA 2YYYA 4C0LA 4MV3A 1UC4B 1Z0IA 3GQBB 4PHTA 3D6FA 3DG9A 2BKEA 5ALOA 4KNVA 4AZVA 3VU9A 1KDZA 3DDNA 5KINB 2CYBA 3OOSA 1X1BA 2K4MA 3IQIX 2IVFA 4W5WA 5E6SB 4Y67A 4D8VA 4PC1A 2PUCA 3E3AA 5EINA 3BH0A 3SSAA 2QV7A 2B1RA 2VG8A 5EVJA 4NH4A 5LOVA 4ZYLA 2O07A 3CO5A 1TQHA 1Z4MA 3HXTA 1TM7E 2RCYA 3A0RB 3PENA 1MA3A 2RIRA 4HJXA 1W4BA 2WUWE 16PKA 3SR4A 5A6SA 5CITA 4JO0A 2CXSA 1GPKA 2P7HA 2PKCA 4B73A 1UL1X 4K9KA 2PT6A 4DQUA 3PVSA 4B3FX 2P69A 1CYEA 2CHFA 1XWIA 3QHPA 4LWPA 4U2DA 5HBGA 1IBRA 4OJYA 4Z4CA 3VTZA 3L6DA 2CNBA 3Q3VA 4ND1A 4BVFA 2GCUA 2PLFA 3QMMA 1Y89A 1N2JA 3R40A 5I9TA 3S1AA 2WMNB 3T9BA 3UATA 2WJPA 3QA3E 4GI7A 4DQ0A 5GIOE 3GVHA 5BVHB 1JVBA 4N0MA 1UFVA 2RGYA 4G37A 1CVRA 4W5TA 3JAWA 5CNIA 4RAWA 2D5BA 4KZKA 3SKVA 3CV3A 3GRRA 2RH9B 2WJ4A 4XOUA 1PSWA 1DXQA 2UUPA 3FNRA 1IMJA 1JDUA 3LK6A 3OX1A 5IC5A 3RUIA 3W8EA 5A5DA 1UFRA 3PCTA 1RRMA 3BKWA 4H4EA 4RMGA 3ZE1B 1NN3A 4D9MA 2R8ZA 3RUCA 4B7CA 5H8WA 1O95D 2FZWA 3ZYZA 5EQTA 1DC5A 1H66A 3BSFA 3FKSA 3HMQA 3L0OA 3NATA 4L4ZA 3GPIA 2X2PA 1M8KA 4O5OA 3C41J 2GRAA 3KAPA 1OXVA 3PDWA 3HKCA 4HGYA 5LBIA 1ESMA 3BIFA 5CXXA 1L7AA 5B4UA 2KE5A 3FNHA 4FSBA 1QYRA 3NC0C 4WLFA 4HDSA 1PV2A 1SU6A 1NJ1A 1OAAA 5AM3A 3I5AA 3SYLA 1YR7A 2C4MA 1C1DA 2AUMA 1RFLA 1XZEA 3C8MA 5K99A 3CX6A 4DCCA 2F6RA 2F3UA 3HO1A 1KMQA 1VL8A 3G9TA 4QDKA 3BULA 2CYAA 4L6CA 4NOJA 4LK2A 3FDFA 1XA4A 4X1OA 5EJGA 4M49A 1EUDB 4PS1A 2QL5A 4YALA 4ZYWA 3K6SB 2N1BA 2PQ6A 1XZJA 2EERA 2V8OA 3HXPA 3MT0A 3F6CA 3FB1A 3DYBA 4J7UA 1RKVA 3B1ZA 1GNPA 4Q4DA 2H63A 4QTZA 2EBUA 4DA6A 5AKZA 1KVRA 1LC0A 1BMCA 4RL4A 4OXIA 1YNOA 4U7TB 5DBHX 4YYEA 4KO1S 1IQRA 5FOUA 1USIA 3GFGA 3C74A 1YASA 4DLRA 2C2YA 1T10A 2DG2A 2JEZA 3OKAA 1BMTA 2QDXA 3GH1A 1ECJA 3N05A 1T9GS 1Y3BE 4GQBA 2IEDA 1Z82A 3ASYA 4R2WA 1QYWA 5CBPB 4K86A 2CXQA 1JS1X 2WVAA 4UE2A 4G5YA 2E4ZA 4ZYYA 2RB4A 4PTZA 3AXTA 1VYUA 4I1VA 3SFTA 5EYPB 5CCXA 2CNOA 2IEZA 1V3TA 5J59A 4JB8A 1MOZA 2QE6A 3IHKA 4QTUB 3G9QA 2R6AA 1R6XA 5GQSA 3UG7A 3UJ9A 1TC1A 1W96A 1ZM2A 1UKYA 3GCDA 5G40A 3TL2A 1HRDA 1YXMA 1DHTA 4LV5B 3JQ8B 4BGVA 2R1VB 2HB9A 3I8SA 4ZCQA 1QK5A 1B8OA 2WF8A 4BN5A 1QMPA 2JKVA 1TZKA 2XGGA 2EJTA 4M8NE 4F8JA 4YMTA 3S8EA 1Z2DA 3PJRA 3RK4A 3N86A 5CW1A 4EITA 4TKMA 3H3EA 4KWIA 3SDBA 4XB2A 3EVZA 5LPNA 1YMUA 4WZBE 3DM9B 4WW0A 4GPTA 5A7GA 1X7ZA 1NAIA 2HTFA 1GDHA 1GTJ1 4J7CA 4LHVA 5IDYA 1EGAA 3ZXIA 4YY3B 2Q5LA 3IMGA 1WMBA 3O2QB 4OAQA 4QFDA 5ITWA 3GQBA 1CUUA 3GELA 4L8WB 5EGNA 3BH7A 3MIZA 5EFZA 2NPFA 2BRUC 1Y3CE 2H9IA 2F67A 1KZ9A 1XMJA 2FN9A 4UEKA 4O4LF 4UEJA 4URFA 5IK2A 5JAIA 5E6SA 7YASA 2REBA 4URWR 3SIXA 4GOXA 2QM8A 1X6VA 3VISA 3RUHA 4BJ5A 1QZXA 1XGKA 3FMPB 3ORYA 1R8QA 1GARA 3VNAA 1O58A 3PTLA 3ISTA 4F4HA 2FU9A 1XJ0A 3NS7A 1FRVA 4AM8A 1F2TB 2AFVA 1E2KA 1IZ9A 3C7AA 4P32A 4YMGA 2GN0A 1HT3A 1IHXA 3B9PA 2W4QA 5THXA 4HUQB 1BRMA 2FK7A 1ZOSA 4AJ9A 4KU4A 4UWPB 4FMDF 5JRDS 1QFXA 1XD9A 3PGJA 4FZ3A 4C0QC 3UW1A 1K66A 4ERNA 5JQWA 1WXWA 1F7VA 4R0VA 5KVSA 1S3GA 3AR7A 2XRFA 3B60A 4GC5A 4IV5A 1EEXB 1XWFA 4N3GA 5AW5A 1OFUA 2VT3A 1B41A 1KVUA 4N0PA 2O6HA 1UINA 1Z17A 1KEZA 4TYQA 1JP7A 1NOIA 4UQLA 4PVOA 4RQTA 3ZV5A 1A9XB 3SR3A 3QX7A 3EFBA 2EQAA 2I4OA 4PYOA 4P3XA 5DLYA 1PAUA 4PG7A 5HX7A 5K4KA 1G2PA 5B2ZA 1B93A 1J0AA 2B2NA 2WJ3A 4GSYA 3FOBA 2QU8A 4BO5A 5GAJA 5F7JA 1CUEA 4MUGA 3WYDA 4QXMA 1N1EA 4LXUA 1K5DA 1ULHA 2VJCA 1E6KA 2HA7A 3C3AA 3MNFA 2RHHA 4AX0B 2FHXB 4AMBA 1JG1A 1XP8A 3G5AA 3P9RA 1G3MA 2JZNA 3I83A 3DAOA 4PSCA 2QSJA 3ZJ4A 3DCJA 3LPLA 4GM0A 1R0WA 2DVMA 4HPWA 3LX6A 2ZITA 1EUDA 3CC8A 3QLUA 4WFKA 3ZBPA 2NMVA 3T0GA 3K6SA 5FULA 2RH4A 3LHDA 4W1SA 5JSYA 2CUZA 2BIFA 4JVLA 5AM5A 1KGDA 3QEOA 3AYXB 2I2DA 4KXVA 5J58A 5HH4A 5A23A 4ARSA 2CL0X 2QZ9A 2XMQA 4FS8A 1WV1A 3I6IA 4FYHA 4GZ6A 5H83A 5L7WA 3RADC 4P8RA 4LNAA 1GUAA 3HR4A 1Z75A 3Q7IA 3LH5A 1OIWA 3WKBA 4H7IA 1GEGA 1ONBA 3JYLA 5CFNA 2ET6A 1EJ0A 1LS1A 1ONOA 3TRDA 4P2GA 2VBGA 2G0AA 4KKVA 3VPHA 2R79A 4M9ZA 4UM7A 3DDHA 3WGKA 3CURA 2MMCA 3AVYA 4JLBA 5CBPA 2J07A 1Y9DA 4QDUA 3T5AA 5GVRA 5EYPA 4XPZA 1DTEA 2SHKA 1U2QA 4URUR 4DIDA 3GN2A 3MJDA 1V37A 4Q4AA 3PQ3A 1IDOA 4NE9A 1XWWA 4Y6GB 3U4QB 3U19A 4PLTA 3CA8A 2P4QA 3M3DA 1OCEA 1N7IA 3R6DA 3PD7A 2B3TA 2VEOA 4KHZA 5F35A 3ULKA 2XH8A 3NZEA 2R1VA 2VHJA 3ZG6A 5MFPA 2QAGC 5SZHB 3F3YA 5ENDA 4I14A 1EX9A 1NIPA 3KWLA 5ED0A 2M6KA 2O52A 4YCAA 1VBFA 4EYGA 1CNEA 4QJBA 2DHEA 2WHQA 2DH5A 1CB7A 3GDGA 3EMDA 3HXOA 3V4ZA 1C8LA 3ZZUA 3K7EA 4Z7QB 4TUYB 4WCFC 5F78A 3PXGA 4HPJB 3DO5A 3V2IA 1KIMA 5DNYB 1OI2A 5K4NA 2OHIA 3MJVA 4DIMA 2Z95A 5M2QA 4EUSA 1HORA 1I30A 1D0IA 1E1YA 2BFNA 3C8DA 4F8EA 3S8MA 4M7OA 1E5VA 1G20E 4PHHA 4AUNA 2W9XA 2EFDB 2J5RA 1D4OA 2QQFA 4JUBA 1JR3E 5EUBA 3ZQ4A 3M33A 4GUAA 1W52X 5ALZA 1RXSA 4NK5A 2R11A 3BCUA 2I33A 4DMRA 2ATEA 4PANA 3L4KA 1X8HA 5FPTA 3DE2X 1AE1A 2H8GA 3A1TA 1LDEA 4R41A 4BJHB 4KXLA 2PBFA 4RK6A 4HUTA 1THTA 1P7WA 1OA1A 3QE2A 4WOBA 3CH5A 1KWKA 4HUQA 4CE6A 4DC0A 4TWBA 1OYWA 1KU0A 1Q17A 4NBTA 1JIVA 2IEAA 2WUDA 4ASUD 4YUZA 4WJZA 1P19A 1PWHA 3N0WA 3MRXA 3RTCA 4QYIA 4GPAA 1NN5A 4H3HB 2O0LA 3WSWA 2V7XA 2Z43A 3GIDA 4EGSA 2IHNA 3ROGA 1HURA 4FGSA 4IIJB 1G64A 3SU8A 2O2HA 4AYWA 1OIVA 3ESZA 1QYIA 2MSWA 1YVUA 1B6RA 1O54A 2G9RA 3QMPA 2BI8A 4F9FA 4BLUA 4P4SB 3WK7A 3VC3A 2D2IA 4WA7A 1E9CA 4YPOA 1FUUA 1PFVA 1FC0A 5LQRA 3PUJA 2QUHA 2ODTX 1A9XA 1K7FB 2I29A 3ADCA 1E8DA 4E03A 1MO2A 4IM7A 4V3BA 2RB5A 2Q3BA 2WM8A 3K1YA 2ZDHA 4AROA 4Q7QA 1XQYA 2DWCA 3G8AA 4D46A 4HL2A 2O8FB 4HB2A 5CT5A 2XGMA 3CG0A 3O21A 4KYIB 2OV1A 1K8RA 2FHXA 1Q1QA 3KVVA 2HWXA 4J5HA 4QT0A 1X14A 2BVNA 2ESRA 2QW0X 3IS3A 3IEMA 4GOKA 1HZZC 1TB4A 3ZWYA 2O3UA 5TSDA 2I78A 4B4VA 2IUTA 1DO0A 4GZ5A 2BJHA 2C92A 1OXBB 4HYQA 1NYQA 3ZW7A 1PLLA 3JQ9C 4KUHA 4MUMA 3TAXA 3HZHA 2DQ4A 3MOGA 1NR5A 5AI4A 3A27A 5K6TA 1UK7A 3A4LA 3WL5A 2O5VA 2NYUA 4NQRA 5CYFA 2C7OA 3A6DA 3KE9A 3RTGA 3ESCA 4QA9A 4YYZA 5KDOA 1B2RA 4LE1A 4D4LA 2QF7A 3PQ7A 2XYQA 2DY1A 2AH5A 1W5FA 3NTLA 4FSDA 4QSMA 4MK4A 4RORA 5HISA 1E9SA 2VQDA 4B9AA 4BLOA 5D86A 2WWXA 1RYYA 3IJ5A 5JV5A 1U0SY 3KVNA 1FZTA 1NJ5A 1M8JA 2C4KA 1ACMA 4P5DA 1QGUA 4DCGA 3M4NA 4KO4S 3QLEA 1XCPA 1Z68A 3G8CA 2QMEA 1OH6A 2ZK7A 3LCMA 4NCHA 5EZYB 1B1AA 2VF5X 5DOVA 1Y82A 2DFLA 3T5PA 2CVOA 4D3YA 5BPFA 3L18A 2X42A 2FMXA 4E32A 3LNCA 4F9GA 3U4QA 4MI9A 5DX8A 4ZRDA 5JROA 5CCBA 3HCCA 3KUCA 3ZPXA 3AJ8A 4LOIA 1I7NA 4YMHA 1T2VA 2OCXA 3HB0A 2B1IA 1Z12A 4WD6A 5EW0A 1S2DA 3GBVA 4M9RA 1Y7TA 2GEJA 2QRPA 1ECCA 2FKNA 3ZC3A 5C7OO 5IJZA 2PA3A 2DUJA 4RK5A 3D4LA 1V9CA 3PRYA 1UC8A 1T8RA 3B5JA 4NDNE 1IQPA 4L8FA 4R84A 1R0YA 1STOA 4DY4A 4D1VA 1TYBE 4XYLA 3HVJA 4DDWA 3JQ7B 2DWUA 1Z2OX 1C81A 2IHKA 3HJTA 4MV6A 2WHXA 4HNAB 3EBOA 4PW0A 2ONZA 1XHFA 3MINA 2JVKA 5B7GA 1NNEA 2GK4A 3TQSA 9LDTA 2XE8A 4MRPA 5THKA 4RSMA 3NHRA 4G84A 4X97A 1AQLA 3JQGB 4JL6A 2C59A 1B0PA 1P74A 2AI2A 1GA1A 2F7SA 4YVFA 1YZNA 3BZUA 4X92A 1WB6A 2G1KA 2XE4A 5K3SA 1G8PA 3IPRA 5JD3A 3ZHZA 2P9EA 4GPIB 4WADA 3ZV7A 4KBGA 3SM9A 2RKOA 4PWYA 1N9ZA 1PTJA 1T9DA 3HU5A 4I9NA 1N3YA 4OI2A 2OP1A 1N6RA 2ZGVA 2CC2A 2Q1TA 4HMQA 3TSZA 4OGWA 1DKUA 5HS6A 4Y1RA 3WZ2A 3MCUA 1XCBA 5CJ2A 5K0BA 1Y8AA 4HX2A 4TOIA 2FA9A 4RHEA 2UYYA 3REGA 1JBQA 3C7CB 2HJRA 4JLUA 3FTPA 1ZH6A 4DLVA 4HSEA 3NWEA 4H2DA 1ZJJA 4D8XA 4EJ0A 4MB2A 2VA8A 4ZRNA 3MS7A 4IIJA 3JQBA 4FNGA 1R0BA 4Y9UA 2YTZA 2ZYDA 5TQ0B 3D5QA 3UENA 3W90A 1II9A 2PBZA 3CXRA 3TFWA 1XN4A 1I4OA 5CYPA 1Q1ZA 1C14A 1FMFA 3IOMA 3QUCA 1OPRA 5CA1A 2QUIA 1SKQA 1KKLA 3D8TA 3DBLA 2JCGA 4B3CA 5EZ6B 1JFVA 3H2SA 1GSAA 2C61A 5JE8A 4C20A 2VI5A 1LF5A 2EDAA 1YL7A 2G08A 3ABZA 3QBDA 4WERA 3ND6A 2ORWA 2QPTA 4MRAA 2PZMA 1F8GA 1N33B 4QIHA 1A9QA 4MWDA 2W2KA 4XR9A 5BQFA 1YO6A 2HNBA 3E3OA 5HF6A 3FCOA 3CONA 2FQYA 5L4LA 4BX3A 2FHPA 1H1TA 3A3YA 3I8XA 3MRVA 1ZXLA 4NS1A 4U02A 2KX7A 3QFSA 4UC0A 4Q9HA 2ZP1A 5ULLA 4FZRA 5LQSA 2PRYA 2IJGX 3IQDB 5K0EA 4LSMA 1SNYA 1UBKS 2VJNA 3CLVA 2QLBA 3F47A 2GZSA 4K8OA 4FN5A 4UEWA 4OHZA 5MN4A 2CSXA 1ZM7A 3U31A 1WF3A 5HUQA 5EA2A 5JAOA 2ZUSA 1X7YB 3M6AA 2Y8BA 1KI3A 1A4UA 3R8FA 3LMKA 2EFGA 4QM7A 1RKQA 3NALA 4Q48A 4MGHA 5CNMA 3ZWKA 1QP8A 1EINA 2C7BA 2MYNA 4OAPA 3WHLA 2HLHA 4RZQA 2WUFA 4LPKA 2JGRA 3ZN2A 4B46A 1MW8X 4DTCA 1GKUB 3NVMB 4P93A 3V1MA 1JPJA 1U3TA 1YIAA 3FSGD 4GGOA 2O14A 3N6XA 1FDOA 1OI3A 1JHYA 1OJLA 2ZWIA 3L92A 3ZLUA 2JIPA 3WKEA 1FNSA 5H3LA 2J3IA 4YP9A 3OF5A 5ANRB 5I4BA 2BN4A 5JWHA 3V2UA 4JOQA 5F1PA 5BYKA 1FFEA 3T06B 5FDFA 5BPHA 3ECCA 2X0EA 2NOAA 1YZKA 3ML1A 2VDKB 1MC8A 3K72B 4CKEB 5I7OA 3ID6C 3S44A 3W9UA 1G9XA 2W6ZA 1H94A 1LVGA 1OGIA 3KLOA 1CR0A 3Q2IA 4ZZIA 2J5QA 1MNQA 4EQZA 1CUVA 3GO4A 1SZPA 1XO1A 4UVHA 5EZYA 1KORA 1D04A 2Q3HA 4UOQA 3W4IA 4ATNA 5HH5A 3RFFA 1RQLA 1W4RA 2QTFA 4IL5A 4NEGA 2CKMA 1QRRA 3FHLA 4XQEA 3TLKA 4CM7A 1NBWB 3GR6A 5J4YA 4MQFB 3KHUA 1YR6A 1BWSA 4HV4A 4I66A 3T4PA 3IXQA 4EKIA 5BN4A 5JW6A 5L8VA 2VPWA 3K35A 2E4WA 1IJKA 3NHLA 4KI7A 4S0ZA 4X3OA 5DULA 4YP7A 3T41A 5HQ3B 1ZHOA 2I71A 1RAAA 1ZOLA 1CTQA 1VJDA 2FMUA 3PFIA 4L5JA 5HBRA 2L42A 3IP7A 4G3XA 3RQSA 3WXCA 1U3FA 1SQ6A 4WNCA 1L4MA 1BVYF 1P2DA 3HRHA 2JBWA 3LUDA 3OLQA 5BSWA 3G1UA 2M6LA 1XZIA 1V5FA 4Z6XA 3SPXA 3GRAA 4L0CA 2O0MA 1OU4A 3T54A 2PX5A 4PEVA 4Q7KA 4R3NA 1GPYA 3TZLA 2ZUEA 3DM5A 3OPVA 2P3LA 4KDRA 4MW1A 4JI5B 3H5VA 2UUBB 3MJTA 3O83A 5AVYA 4KPYA 3JQGA 1MJGA 1TZCA 5JG7A 1VKNA 1ENZA 2JI4A 5LZ2A 3GP3A 4GKJB 4OHRA 3AB3A 4D74A 2HV9A 1N6IA 2AVDA 3TK1A 3UA3A 4UUMA 4V24A 4Y2UA 5F3DA 4BE7B 4S05A 2GF2A 2YHBA 4EK9A 4LF4B 3RNLA 2ZAIA 2FEXA 1E89A 4ZXPA 2XTJA 1GGKA 2C78A 1OTXA 4G1BA 2E37A 3NHZA 4Z67A 2Y1EA 3IQHX 2O5RA 3Q3CA 4MIEA 4DLPA 4IQGA 5CD9A 2ID4A 2AG1A 2XVXA 3E81A 2RMKA 4JBXA 4EF6A 1M2GA 1ZM4A 1EWKA 1FQOA 4KHPB 3NNDA 3FGOA 2H7XA 2I0FA 2OVBA 3L1VA 1E2IA 1GZ6A 1EJ6A 3G6WA 4YCDA 3ASZA 2LKCA 5GM1A 4DJJA 1JWLA 1NUUA 1SKUA 3ABIA 5TV2A 3R77A 5IF3A 3BERA 4BRWA 1QMGA 5TQ0A 1GTRA 1UM9A 4QUAA 4CM4A 3ZXUB 4K9RA 5CG1A 1OZGA 4YCBA 3QH8A 3C3CA 5EIBD 3TLCA 1ZTCA 1U1DA 4PTLA 3VX3A 1NVWQ 1XZHA 3JVDA 2D13A 1N0IA 1TOAA 3KEQA 2O3TA 3ICPA 3O7WA 3OJWA 4IILA 1WCIA 2H06A 3UFBA 4Q3CA 1EXDA 1LRKA 2Q8PA 4A8PA 3H18A 3BWXA 4HCJA 4N5IX 1A5ZA 1WY7A 4O4HA 3R5XA 4C2UA 1E3SA 3QA9A 3FM9A 3H2JA 1ISIA 4UDXX 2K7FA 1ZMBA 3M70A 1P2FA 1E79D 2YQ5A 5JSZA 2QMQA 1KZGB 1RXEA 4BRZA 2J45A 3AHCA 1D8AA 2VHCA 1PJ2A 1GUYA 2Z2XA 4XX1A 4ZAZA 1EK6A 1T91A 1SBZA 4MP8A 4OLFA 3IP1A 1U63A 2COEA 5T4BA 3EFOB 1V5IA 4ZYTA 2M2IA 2QZJA 3IKMB 4PZ0A 5CA0F 3DOCA 5K0SA 5BR8B 4QFCA 2H5IA 1D1SA 1NJ2A 2IIVA 3E4CA 1W0KD 1J7KA 3S81A 1J0XO 1GTG1 2FP3A 5EKTA 2VQSA 4IOKA 1I9CA 2FUEA 1J4AA 1EHCA 1Q0RA 2XXJA 4L3WA 1NPTO 3B1YA 4TWAA 3ZVRA 1C9NA 1N5JA 5DT9A 2EOAA 4KE6A 3GGOA 2CDAA 1NL3A 3QVLA 1NMSA 2ACKA 2CJXA 3LHKA 4D8UA 5ISMA 2R66A 4PHCA 4PGHA 4YRKA 3BIWA 4CKEA 1AT1A 2WB2A 4EVIA 1AHIA 4AO7A 3JTEA 4C29A 3O03A 4JKOA 3RSQA 1G9TA 4X84A 3DS8A 2EBWA 1BMDA 4LBYA 4B09A 2P5UA 1JZSA 3A05A 4MGKR 3C48A 3VTFA 5LN1A 1GKLA 3EGXB 3WLQA 1E3MA 3CUUA 3PC3A 5AW3A 1D5WA 2VT6A 3KWJA 3D4NA 4LJKA 5BSEA 4AJ4A 2JD2A 4I36A 3K2BA 4TKUB 2WIGA 1MJ5A 3DL4A 3HBNA 3NBMA 3TW6A 2QX4A 1L7XA 3K9HA 1JV2B 2ZYGA 1COWA 2VZ9A 4PICA 5THQA 3G2HA 2P40A 2VLBA 2Z1MA 3S2GA 1FXWF 1ZH4A 2O1EA 2P41A 2YFHA 5HQ3A 1RXVA 1JDBC 1GPDG 3AB7A 4OAOA 3X1ZA 2CJFA 1Q14A 1ULBA 3D5TA 4AY4A 5FAKA 3WQBA 2D7DA 2FG5A 3HJHA 1T5BA 4P0PB 2XYPA 2SCUB 5T41A 3AGPA 3AFGA 1VC2A 2CFCA 4LZWA 1HG0A 1B15A 1HTTA 2SKEA 3E9YA 3KETA 3TGLA 4OUDA 2JA2A 4O2RA 4Y0NA 4YRFA 3ILXA 1GL7A 1SCKA 1YZLA 1NPDA 3HB1A 4M1TA 2N47A 4YUWA 4HDMB 5HNKA 1X7XA 4GOND 4KMOA 5EKXA 4GLBA 2FZKA 1IQ0A 3H3JA 1X38A 4S1WA 3MD7A 4KXUA 3E1GA 3JR7A 4UJ3A 2GH1A 4MI3A 4JBIA 5DLQC 3UTCA 5LDDC 4D0NA 1L5YA 2ZLBA 3AI2A 4RLFA 5FPHA 1NP3A 1NDHA 2ZSEA 3D7MA 1SXGA 1IHYA 4YQEA 4BGUA 1F2UA 1CY6A 1DAGA 1UJBA 1KQOA 4MRSA 4W1RA 3PRKE 3U4GA 2AGVA 2JHGA 2X5XA 4AWXA 3OOJA 4D6PA 4JWKA 4IDEA 1I4LD 3TSOA 4XJTA 1P4SA 4WFIA 3W5CA 4XOIA 5BV8A 4FQ8A 2HGSA 4I9HA 4JUDX 1VJGA 4YCLA 5IF9A 4DV2B 5BN1A 5LQMA 4K28A 1T3TA 3JWGA 1JJTA 4UPDA 1VZ3A 2P0YA 2J4DA 3LT5A 5CDFA 1PNQA 1AKWA 4MVJP 4GR5A 2OK7A 1ULZA 1PZEA 1IOVA 3PVCA 1DJOA 1HEIA 1JIKA 1TMOA 3H16A 3INTA 2HA2A 5I7AA 4HMPA 4Y1FA 5F4BA 2OHXA 3BF7A 2OTCA 2R6ZA 2R9VA 3FZEA 3MEQA 2QK4A 3M34A 1NU6A 1O94A 4O4JB 5J5VA 1XZFA 2C94A 5REQB 3RD5A 5KMGB 5IBQA 2IRWA 3B6KA 1NW5A 1Y34E 3F78A 4NMWA 4QNNA 4F21A 5CDUA 2ZWRA 3BM5A 4JI3B 1D03A 5FNVF 4CQNA 4MJ3A 3D1JA 3KNRA 3IRVA 2C7GA 2NP7A 3SSOA 3UJ7A 3V1LA 5AHOA 1CR2A 1PYGA 2W2TA 1NULA 2ZYRA 3B51X 4LHWA 3WGNA 4NMHA 4OHKA 4AX4A 2FW6A 3EB9A 2G28A 5AK6A 1IATA 2A88A 5GJWC 5BQ5A 3WLLA 4OQEA 5AD1A 3QLUC 3L40A 4HEQA 4C09A 1QVWA 3N9IA 1MRSA 2V97A 3FFTA 1DAMA 1EVQA 2ODBA 3KOYA 3B1WA 4RE6A 4XVQA 1OR8A 2B8NA 3C1UA 4RACA 4ZAGA 1SVIA 2WM9B 4ZO4A 5B1HA 2UUAB 4I4CA 4BN0A 1ISRA 5IH3A 3TTSA 4ER6A 2Q0SA 4IG4A 4HLDA 2I22A 4MEAA 3UGKA 1P9EA 2HXSA 4LTNA 2WE8A 2YXBA 5DM4A 1JG3A 2D00A 1EFPB 3H7AA 4BUJA 2AMYA 4PCVA 1T9KA 2YV5A 2DYKA 1HT1E 2C2ZA 2O7RA 3M6MD 2B4RO 1YDFA 1TZJA 2P0AA 1SVWA 2GAJA 3DEKA 3IUBA 1VKRA 4YGYA 3NETA 4IVNA 2YHSA 4LZAA 3IMFA 4MV0A 2CHGA 1KI4A 5I9BA 4Q1VA 3IBCA 1A5TA 4AY2A 3MD9A 1ILWA 4LZZA 3N1UA 3VR4A 2QRHA 4TYFA 1IZZA 1G7SA 1D2RA 1YACA 4GVPA 5CBKA 4MPDA 4QBTA 4OHPA 5HF8A 3Q88A 4X45A 5KPDA 1Z6XA 1L9YA 2JI6A 2OFPA 2RI1A 2XBMA 1FLAA 4B0PA 5I51A 2IC5A 4PXYA 4TKUA 4AZ0A 3LZCA 2A5FA 2AEMA 1RQXA 5FOWA 4ZCTA 4CN8A 3ITEA 4MUFA 2JLVA 3Q9LA 2RGCA 4KRFA 4AMYA 3IOGA 2V5AA 1NY6A 2BGAA 1IOLA 3FVWA 2P3SA 4MQBA 4YCMA 5CT6A 4TTTS 4RL6A 3O4RA 4WXMA 5AIAA 2SCUA 2I1QA 2C4TA 1P18A 1JH8A 4NZMA 2LZ0A 2OENG 3M5PA 1U5AA 2PKXA 3B3FA 4WXHA 4DCPA 5EJ9A 1QH3A 1I3KA 4L9WA 7REQB 2QTRA 1WX1A 1N8NA 3PSHA 1G8MA 5BUCA 5LQCA 5IKEA 3R3YA 2A8YA 3MJRA 1GA4A 2W71A 1QHGA 5ECDA 4HDMA 5JCZA 4MV8A 2V1UA 1Y63A 3IT2A 1G8SA 3KUUA 4G9GA 1G66A 1MIOB 1DEHA 1JEQB 2N75A 1YFZA 1GQRA 1MQAA 1SVUA 5U1PA 1UDCA 3H4VA 5AI6A 4UMVA 4BRSA 5B1YA 1FK8A 2VSXA 1S2IA 2MCFA 3JX9A 4B2LA 1TX4B 4DJFC 1AA9A 2F43A 4EG4A 1QANA 3F2IA 1A8IA 1JBEA 2X8AA 4CF5A 2CZGA 3KVOA 2XB9A 4KC0A 4TV8B 2VNIA 1ICIA 4XIJA 4N3BA 1JFRA 2FH5B 3VAAA 2ZBPA 3UYKA 1E1MA 1EKXA 2GBLC 4JOBA 2Q0QA 2QX6A 2J9ZB 5IYZF 2QHXA 1QOQB 5KYVA 4HB0A 1DUIA 1C3JA 1Q7GA 1XVTA 2EIHA 1AM4D 3LE8A 4PG5A 3ZWOA 5KTKA 2UYCA 1G0NA 3UKJA 1KQFA 2BKAA 5HRUA 3JYOA 4D80A 1R0KA 5JCPA 3GWGA 3P2UA 3OPMA 4XLLA 2N9UA 2VTEA 3ZOKA 3V80A 3EXHB 2IP4A 4G36A 5L3ZA 2PNJA 4V1CB 3PT5A 3PWSA 3CY6A 3QUSA 3R4VA 5T8KC 3NHPA 5JTUA 4AIRA 5MFZA 3GLUA 4GL2A 3ENQA 4O4JA 5KMGA 5REQA 1KAMA 3WGVA 4AQ7A 1BKYA 2Q5CA 4G9BA 2GHTA 1N0VC 2JGLA 3S70A 2H1LA 3ONNA 4FX2A 5E2BA 3LTNC 1L4BA 1YQQA 2A3RA 1FTQA 4K88A 1GN9A 4PLCA 4G25A 4MMYB 3HU1A 3W1EA 3T52A 1NVUQ 1QSGA 1ZNWA 2FWBA 1O5TA 1GPLA 3HA5A 5HPYB 5I6DA 5JWRA 2QGNA 1WXDA 4KEPA 2Q07A 1EX1A 3D3JA 1HE4A 4BFZA 4QTYA 2X22A 4GC9A 3LHSA 1UWCA 2JLQA 4PDXA 3PQ8A 1W46A 1T9GR 1YZHA 2DJ5A 4UU7A 3OPNA 3RG2A 3B1FA 4KUEA 3O93A 4DS3A 1EG2A 4R1MA 1L5WA 2HN9A 2HJVA 1MG0A 1YB6A 1JEEA 1CF9A 1YCDA 2W2QA 2B1GA 2G80A 3JU3A 2CL7X 3SC2B 1U5CA 4LC9A 4LQ4A 1EFPA 2JARA 2OILA 4G4SO 2BFPA 5F5LA 3KR0A 5IWCA 1ADBA 3RT1A 2VTDA 1K9VF 1PUXA 2Z0MA 4ZCMA 5IS2A 1Z07A 4FDTA 4D57A 2OMEA 5JSUA 5FBZA 3ZXXA 2R4TA 2BCEA 1FDWA 2WAOA 3PIRA 4ARCA 3PXXA 4GVXA 3IC5A 1PR9A 4KB5A 3RGWS 4BMCA 4FYKA 1RFGE 1KVSA 3UHFA 4DRZA 4G0OA 3UV7A 4FCTA 4ZCPA 2VBIA 4BU1A 5FBQB 1LI4A 3N5CA 2GCNA 3LQ4A 4FKZA 4YROA 4EOGA 3H1AA 4UUBA 2HSJA 2H17A 4CI9A 4QUHA 2VYQA 4KPGA 1T0IA 3OOWA 1OYYA 4LYGA 1JJIA 2ZG6A 1S2GA 3V33A 4U2CA 3RC9A 4DWWA 3VC2A 3WL3A 5I01A 5KPJA 3PZBA 1IEXA 1K6MA 3C6YA 4NMXB 4GFDA 2P9JA 2R96A 2YJTD 3D0OA 4FB4A 5B2EA 2O8DB 4ZU3A 1QFSA 3LY8A 2WKPA 2WVHA 1FMCA 1R0CA 2GK6A 3OHSX 3DT8A 4N49A 5D3ZA 4CV2A 2YH2A 4WEQA 2E7YA 5ERXA 4FSHA 5T4HA 1CQJB 3D9QX 4UNSA 1GYPA 2RK3A 1PJ8A 5AM0A 3DYVA 7REQA 2F4NA 3KJQA 4BAGA 5K8IA 2EKLA 2FX2A 3P2EA 5IKXA 1T2FA 1JWAB 3LI2A 1F7UA 4NABA 1M34B 4XWGA 4ZV7A 1WUKS 1UXJA 3M1IA 4KR7A 2GJSA 1J7JA 4UM9B 1PTJC 1MIOA 2QVBA 4KI0A 5JY1A 2GX6A 1JEQA 1C4WA 2VWGA 2XQFA 3LF2A 2DEUA 3JWHA 4L07A 3E9RA 3X1MA 1ZA2A 3ZGXA 2VDPB 1N8KA 3IP5A 1GYQA 3PY6A 1RXCA 4H3VA 3O8QB 2AG6A 1AVTA 1GPH1 1BMFD 4IHAA 4LDJA 3X0DA 5JJIA 1GG8A 1MQ9A 2D2XA 3GIWA 1BX1A 2OFOA 3P1JA 4HGOA 4TV8A 3W2TA 2BH2A 1AS0A 4A0SA 4EQ6B 2QM3A 3K6JA 2P2LA 1PR4A 2JD1A 5C1BA 2GAOA 3NEPX 1LK7A 2ZQZA 1J56A 3K0SA 1P7PA 2XB4A 3JQBC 5T67A 3AVTA 5CFLA 1OA0A 1M9NA 3PVZA 1UDWA 4CHLA 2JJ1A 1RE0A 2NT3A 2B1QA 2FWIA 2JIZD 3EVAA 3JATB 3D8NA 4U7JA 2DLDA 3IA2A 5L4NA 3SQLA 4HYTA 4CLRB 1PJBA 1U3VA 3RVOA 1QU3A 3L6CA 4RKEA 1XTKA 1QPBA 5IN5A 1TADA 1GUFA 2PS1A 2FKAA 1APBA 2QMZA 4Z7NB 2QRKA 3H1BA 4AKTA 3EXHA 1IG3A 3MOIA 4IKEA 4GP9A 1EA7A 1U90A 1PWXA 1ZGBA 4IXNA 3DKIA 1DELA 4BDSA 3EEFA 3WNDA 1MT3A 4MVCA 5AXAA 3WNBA 1PJ4A 1RPJA 3WX0A 1QIGA 2JCVA 1QO0A 2GZMA 2XBUA 3V9PA 1C8VB 1Z5WA 1Z5PA 3IAUA 5EE1A 1U11A 3QVXA 3CRNA 4UD2A 2PX4A 1L7VC 1R4ZA 2H52A 5ICEA 4TZ6A 5DI3A 1WTAA 2WT9A 2WDZA 2PGIA 4LWOA 1DQRA 4LZJA 4QTTB 1MGOA 1OLUA 3FNEA 3SJ7A 4BWYA 4IEIA 4YRLA 2ISCA 3SE0A 3NPMA 4J03A 4YJ3F 1ZL0A 2YS6A 5EJAA 4FGJA 1NLYA 3ND7A 4NCKA 4R16A 1ZVQA 3UH0A 3ZHOA 4Y30A 1XZDA 4F5ZA 3S99A 1T5HX 4HWOA 3QK7A 4NPHA 4YRAA 3NDRA 2V7UA 2W43A 2XSZD 4UEQA 2P5TB 4ZHQB 2CMFA 4B6PA 1DIHA 5H4GA 4F5DA 1IB6A 2YHIB 1XVIA 5DWQA 3OQOA 1RZUA 2C0PA 3DMTC 2GN8A 2NLOA 4IMRA 3SC2A 3TJMA 4XWOA 1S8FA 1N3IA 1EHYA 3LWZA 3GCWA 5SY6A 3BXHA 3ZU5A 1GGVA 1H93A 3KJZA 3GJSA 3WZLA 1KOFA 2B5VA 2DKFA 2OK8A 3L1KA 1ZQ1A 5FR1A 2POCA 3L06A 3ZE6A 2CWWA 4PPQA 4M9QA 1D2CA 2YC2C 2JLBA 4MARA 4EYKA 1RLMA 1UMBB 2IYRA 5IBRA 5GWXA 4E94A 3W4JA 4YN3A 3ZDYB 1I7DA 1MB0A 3NT2A 4R8VA 1IM5A 4KGZA 4MPTA 4B80A 3TB6A 5HM6A 2DKOA 3L8FA 3V8MA 1JEOA 1JSCA 3FOCA 1ZC4A 3HSKA 3I9V6 3N2GB 4HGPA 4HYYA 3BHMA 4XWAA 1FOEB 1SCNE 2GN6A 4CMCA 2HJSA 5AXOA 1A04A 1PD0A 2IYZA 2J6HA 3DTNA 1WUTA 3VYRB 4CIXA 2GD6A 4Y2PA 3NU1A 1KJYA 1QHNA 4TZBA 3S2IA 2M5CA 3D3WB 4Z4FA 1VOTA 2GPYA 2FSGA 4X44A 4XD2A 4C4RA 4JUFA 1FDSA 1KS2A 5EJ2A 4OQNA 1TFUA 4KR9A 2ZS7A 1Y7LA 4KQJA 4HSGA 4Y6QA 3MOSA 1CQJA 3NEAA 2GKOA 4ZD6A 1DCMA 3VYSB 1IY9A 1V48A 2IIPA 2VDQB 3OAAA 3QYJA 4MDHA 5H9VA 4W4TA 2WB4A 1V1MB 4KZPA 3GAMA 3H2YA 2IHJA 5KTYA 2XRZA 4YDSA 1T0BA 1M34A 1XEXA 2XGSA 3GPCA 4HWTA 1I6KA 3PIIA 2X8WA 4ZOEA 2BFEB 3DBOB 1E1RA 2YXEA 4IUBS 4P4NA 1U0BB 4RVHA 1WDWB 1RWQA 5KVCA 1CHDA 4A0HA 2RAUA 4DR1B 3HGTA 3W3AH 3T7CA 2HQBA 2MINB 4EW2A 5T7BA 2IYQA 4RDXA 5F1YA 1WZIA 2DFVA 2R3SA 3O8QA 3FCXA 2QLNA 3L0CA 3PFNA 4QOFA 2AUTA 5CVCA 5DN6A 5ES3A 2WUVA 3U5TA 1Q95A 3TDMA 3NCHA 3TCXB 1BU5A 2Q62A 3I72A 4EQ6A 2FPGB 5IUJC 4DHEA 2Q28A 2DBZA 3GUVA 3UB3A 4W82A 3VVMA 5KCMA 4GF5A 5K20A 5BSUA 3UB4A 2R8BA 2M9MA 3G7SA 1X7HA 2OCGA 3W3AD 5TT1A 2AMFA 1EWYA 1KRHA 2DWPA 3OLXA 4AJEA 1QVAA 4W7HA 2XUQA 3PLRA 4CLRA 1C9KA 2GHIA 4F9TA 4XB6B 4QPNA 1T24A 2H1VA 3T8YA 4PYMA 4PLVA 1NTOA 4CLOB 3W9YA 3O1HB 1NW6A 2H2DA 2A5DA 3VO1A 3CJQA 2WF9A 4WKCA 1BDIA 1DADA 1Z08A 3EC1A 2F1HA 1BHSA 3O91A 1L5HB 1T1RA 2A7XA 4UFOA 5F5XA 1A82A 1P2VA 2JDIA 3I39X 3LY9A 5EESA 1G8YA 3KC2A 3MBKA 3K1JA 4DDUA 2O8BA 4P3NA 3EZ7A 3GBPA 2OHJA 3I1FA 2C2WA 4EL5A 1ZKDA 3SM3A 4GRDA 1QP0A 3I05A 2ZSJA 4BZWA 5ALVA 4J94A 3OUUA 3V4FA 1A27A 1YRYE 2ONKA 2J0UA 4B6QA 4Z9YA 4C0KA 1U8TA 3PNSA 5C3UA 3M6WA 3HTXA 3Q3HA 1Y8QB 1ZEMA 5IAJA 2GTIA 4WOKA 2Y1WA 3V97A 5FQBA 5IDWA 1XNHA 4LDAA 4TZKA 1Z2NX 3V4VB 5FOQA 2AKEA 2C3YA 1ZIXA 2FZCA 3PGKA 1YOBA 3SZLA 1SG0A 1GPJA 2CXRA 1IZ0A 3T1OA 4BNXA 3C87A 4ZHQA 3D3EA 4FDVA 2QJWA 1ZVKA 2P7IA 1U0OC 3NHWA 3RUAA 5B3KA 1W8IA 4I2NA 1VRVA 3ETNA 4R68A 3EQZA 3GRYA 2ZRKA 3NYWA