1YCGA

X-ray structures of moorella thermoacetica fpra. novel diiron site structure and mechanistic insights into a scavenging nitric oxide reductase
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
398
structure length
398
Chain Sequence
SQPVAITDGIYWVGAVDWNIRYFHGPAFSTHRGTTYNAYLIVDDKTALVDTVYEPFKEELIAKLKQIKDPVKLDYLVVNHTESDHAGAFPAIMELCPDAHVLCTQRAFDSLKAHYSHIDFNYTIVKTGTSVSLGKRSLTFIEAPMLHWPDSMFTYVPEEALLLPNDAFGQHIATSVRFDDQVDAGLIMDEAAKYYANILMPFSNLITKKLDEIQKINLAIKTIAPSHGIIWRKDPGRIIEAYARWAEGQGKAKAVIAYDTMWLSTEKMAHALMDGLVAGGCEVKLFKLSVSDRNDVIKEILDARAVLVGSPTINNDILPVVSPLLDDLVGLRPKNKVGLAFGAYGWGGGAQKILEERLKAAKIELIAEPGPTVQWVPRGEDLQRCYELGRKIAARIAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Nitric oxide reductase
publication title X-ray crystal structures of Moorella thermoacetica FprA. Novel diiron site structure and mechanistic insights into a scavenging nitric oxide reductase.
pubmed doi rcsb
source organism Moorella thermoacetica
total genus 134
structure length 398
sequence length 398
chains with identical sequence B, C, D
ec nomenclature ec 1.-.-.-:
pdb deposition date 2004-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ycgA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1ycgA01
5ACUA 2QJSA 3I11A 4U7FA 2X2PA 2HNAA 3QFRA 3PY5A 3IE0A 3GFRA 4GR9A 5LCHA 2P4ZA 2YNTB 3SRXA 4Z6XA 3I0VA 4NQ6A 1KO2A 1JJTA 3H3EA 4PTZA 2BFKA 4ICIA 3IOFA 3FVWA 3EYWA 3P2UA 4RAWA 3GFQA 1K07A 1YRHA 3L9WA 4KEPA 2QX9A 2H6AA 4TZFA 4BZ3A 1AKWA 2FU7A 3ESZA 4LTNA 1YCFA 4Z67A 5AXOA 4YAFA 5ACVA 5EHTA 4ZO2A 1L9YA 1DDKA 1TIKA 1KO3A 3RPEA 4XDGA 5EH9A 3W7AA 1WSWA 4D1WA 2QDTA 5LJIA 5ACTA 3NHPA 4FGLA 3UXHA 3BC2A 1QH5A 5EVBA 3X2ZA 5B3KA 4TZBA 2R2DA 3SBLA 1QR2A 1T0IA 5ACSA 2BF4A 1YDGA 1WW1A 3NHWA 4U7HA 3DH8A 4TZ9A 3T9MA 1E5DA 2M6RA 3NHRA 1D4AA 1V4BA 3F2VA 2BG6A 2WC1A 4EYBA 1H66A 4N82A 4EXSA 4Z7RA 3S0ZA 1BU5A 1AKTA 5HH5A 2BC2A 3O73A 5FA6A 4AX1B 4EYFA 4ZVKA 3I13A 2QX4A 3F9OA 2N1MA 1J9ZA 4TYFA 4GQIA 2Z9BA 2BZSA 3ZWFA 4FGKA 2FVXA 3ZQ4A 4QOJA 4H0DA 2FLVA 3G1PA 1YOBA 5B3LA 5F51A 4HL2A 4UA4A 1XYYA 4ZO3A 2Q0JA 1HLKA 5FUQA 5K4MA 2FAXA 4YALA 2ZKIA 4QOGA 1T5BA 2MTBA 1X8IA 1BC2A 4C1CA 3AF5A 4O98A 5FX2A 1D04A 4D1VA 5EV8A 1QHEA 2M5DA 1VJNA 4ZNBA 3HR4A 3DHAA 2XF4A 3AF6A 4U7GA 4HS4A 3KAPA 2FOXA 2WYMA 3D7NA 3NHJA 5LBUA 2M6SA 1ZKPA 1C7FA 2V9CA 4EYLA 1XYVA 3K1YA 4BP0A 2QX6A 4D1TA 3O2NA 4AD9A 2Y8BA 5TGZA 3PY6A 5NULA 4Y9RA 3ZHOA 2Q42A 2FU9A 4C1DA 1AKVA 3VPEA 4CF6A 5HIQA 2MOKA 2FZ5A 5ACPA 5ULLA 4PTYA 3Q6VA 1QRDA 1ZWKA 5EAIA 2ZWRA 3U7IA 4HL1A 2CBNA 3AJ3A 4AWYB 1X8HA 1F4PA 1M2XA 4DY4A 5DPXA 1OBOA 3ESYA 1C7EA 2QWXA 4TZEA 5ACXA 2XR1A 5EV6A 2V5UA 2FHXA 1FUEA 2BG2A 2KLBA 3IE1A 4J5HA 1JJEA 1ZX1A 4R81A 5AXRA 3R2UA 4C76A 1FX1A 2QR2A 4LAFA 4EY2A 1MQOA 5LVAA 4C0WA 3NHKA 3HA2A 5EMNA 1XM8A 4F6HA 1KR3A 1JA1A 3TZBA 2Q62A 2I7VA 4FR7A 3WXCA 1AKUA 3W79A 4OXXA 3W78A 2FK6A 3F6RA 1AKQA 3QFCA 4AX0B 2QDSA 3KEGA 2FM6A 2BMVA 2NZFA 2HNBA 4RL0A 2MWMA 5LMCA 3OJWA 1AMOA 4EFZA 3RPCA 4RBSA 3BK1A 2MT9A 3P0RA 3SFPA 2AIOA 3F90A 4FSBA 5AHRA 2NXAA 3NHSA 3QE2A 2OHJA 2M5CA 3NFRA 4Y7CA 2Z9CA 3NHFA 2W5UA 3B6IA 1CZNA 4FX2A 4FGJA 5BUCA 2YNTA 3KNRA 5A0VA 4BMOB 1XT6A 4Y9UA 4F8YA 2QINA 4UAMA 4RL2A 1Y44A 4Z5YA 2OHIA 4UWRB 4NLLA 1AG9A 4YSLA 3OX1A 5HIOA 4QODA 3B6MA 5AYAA 1OFVA 4C0XA 4XUKA 2A5LA 1J9GA 1GG5A 3FCZA 4H2DA 4ZEJA 2QMZA 5K0WA 3A4YA 1CZHA 5LBTA 5AHOA 2OYSA 2FZVA 2HPVA 1JT1A 1A8TA 2UYXA 5HH6A 4UWPB 3L9XA 5ACQA 4P62A 1FLVA 1QH3A 3T3OA 3LT5A 3NHLA 5F4BA 5JROA 5NLLA 1H69A 3I15A 2D5IA 3DHBA 3DHCA 4C14A 2P1EA 1YCGA 4XWWA 2YZ3A 2BFZB 4GCWA 5F12A 1YKGA 2Z98A 5A87A 2FX2A 3IEKA 1J8QA 2I7TA 1J9EA 2VW8A 2YNUA 1FLDA 5LSCA 1RLIA 3FJOA 4XWTA 3RKJA 4KEQA 3I14A 1DX9A 4NULA 1AHNA 3GFSA 4QOHA 2BG8B 4RM5A 3IEMA 4C09A 2GFJA 3JXPA 5LJLA 1XI2A 1SMLA 1BVTA 2FCRA 3FW1A 4UBQA 4YSBA 5AEBA 2Z9DA 3F6SA 1OBVA 1SQSA 2GCUA 4C1GA 4Z60A 3LVZA 4JO0A 1RLJA 3T3NA 1I1OA 2I7XA 1DXQA 3FX2A 1A7TA 4ZVNA 2BTNA 3FAIA 5ACWA 2DKFA 4CHLA 2BFZA 4ESEA 1X8GA 1RTTA 4YAWA 3QH8A 2QEDA 1CZRA 3OWXA 2BMIA 1NNI1 4YQEA 3SPUA 3MD7A 5KIKA 4J8PA 2YNWA 3NLLA 1BVYF 5FQBA 4YAUA 1B1CA 4S24A 1AKRA 2Y87A 2P97A 5A4KA 3ESXA 2WHGA 2BG8A 3IELA 1ZWLA 4PVTA 4B87A 5EVKA 4C1EA 1CZUA 2A7MA 1QBGA 2BN4A 3PG4A 3TP9A 2Y8AA 3B6KA 5FQCA 5EWAA 3X2XA 1FVXA 2FU6A 3ADRA 4ZVLA 4M0CA 5A5ZA 2FU8A 3G5MA 2P18A 1KBOA 1WRAA 3K20A 4QOEA 3OJXA 3L6NA 2X2OA 5B3RA 4UWOB 3ZR9A 2YNVB 3IOGA 1X77A 2GSWA 2QMYA 3OWHA 4FEKA 2BIBA 5K4KA 4V0HA 1WSBA 4HKYA 1AZLA 3SD9A 1DXKA 2Q0IA 4EXYA 3ESHA 2XOEA 3IDZA 4N65A 2ARKA 1RCFA 2E7YA 2F1OA 4NQ2A 2BG7A 4GI5A 3HLYA 2WYLA 2ZZIA 1CZOA 2FDXA 4F6ZA 5LM6A 4NQ5A 4PVOA 3NHYA 2WRSA 5LCFA 2OHHA 1D03A 5LS3A 1TLLA 1FLAA 2BPOA 1P9EA 4AWZA 3R6WA 1JA0A 2V5VA 3N3BC 3ES9A 2YNVA 3KL7A 3KNSA 5EVDA 4CETA 1CZKA 3X2YA 5HISA 4D1UA 4LTDA 1WUOA 3OX3A 2QX8A 4N9QA 2HB9A 2BFLA 3IE2A 3W77A 3LCMA 2AZ4A 2WYMC 2ZO4A 1FTGA 4TYTA 3GAMA 3BK2A 5FQAA 1DXOA 3BV6A 2Q9UA 5LLDA 1BMCA 4DILA 2GFKA 4YSKA 5KILA 5HH4A 1FLNA 4PU0A 4C1FA 1VMEA 4J5FA 2KQUA 3FNIA 3VQZA 1DD6A 5A0TA 5B1UA 3TEMA 5HIPA 3JSXA 2BR6A 4QOFA 4ZVMA 4U4LA 4BMPB 4YAOA 4LA4A 3B6JA 4WD6A 4LTMA 4RAMA 2BGAA 5LCAA 2AMJA 1VGNA 1WUPA 2R97A 3RKKA 1SG0A 3S2YA 3ZNBA 3KAQA 2FHXB 4QOIA 2NYPA 5LE1A 4H6PA 5EW0A 2YCBA 1ZNBA 5IQKA 5K4NA 1YCHA 5ACRA 3N39C 3EDOA 2XODA 4Z5ZA 2GMNA 1KBQA 4DIKA 2DOOA 2R96A 4D02A 6NULA 1ZTCA 2RG1A 3OX2A 3N3AC 4XDHA 4NQ4A 3NHUA 5B15A 4C1HA 2GKLA 4UWSB 3UXEA 4GYQA 3TE7A 5EA2A 4GYUA 1XTOA 3SW3A 2NZEA 3U7RA 2B3DA 3X30A 1CZLA 4LE6A 2ZNBA 3KLBA 4HEQA 3OVMA 3SVLA
chains in the Genus database with same CATH superfamily
3VV3A 1NOKA 3QYFA 4G65A 1BNCA 4CGZA 2X2PA 1NU6A 1K06A 2HH9A 1KP2A 4L2IB 1JZTA 3PTZA 1IY2A 2PYIA 1XXHB 2ZIXB 3EEYA 3USCS 4MWEA 5EJ2A 4CKEA 2P4ZA 2V6JA 4C6RA 3PPIA 1A4XA 4RS3A 1E9AA 1J49A 1W59A 2FH5B 2GBCA 4YRMA 1QGOA 4GYJA 4TTJA 5DNVA 1BS9A 3H11A 3RYHA 1IU9A 1N33B 1QAOA 1GUFA 2CFCA 4TMFA 3L93A 3PLNA 2H4YA 5FR1A 3ZGNA 1XO1A 2JD1A 2Y99A 2CN1A 3P4YA 1EZ1A 4HP8A 4PZZA 4GC5A 3S2IA 4BZ3A 1EYZA 3PGVA 3WMGA 3CWCA 2NP7A 4QFBA 1RWPA 4MVJP 4B0PA 3E2PA 2PMBA 1A4UA 1USUA 2Y1KA 5DNEA 3TEFA 4YAFA 1R9MA 3DH0A 3HDHA 3SX0A 4EPRA 1PGNA 1JNYA 4PR3A 1S1MA 3KQYA 4PQEA 2V03A 4YY3B 1MEJA 3BA1A 1GZ5A 3DHWC 4LDQA 4I5IA 4BC1A 3HSKA 1D6NA 1T9DA 2RH9B 1EQAA 2VPZA 2WUGA 2ZQYA 5B1EA 3ER9A 4MA5A 4BN0A 4Q05A 2JZNA 4NRDA 2NU7A 1ZKDA 2NX2A 2P8SA 3M9WA 4BMZA 3I5XA 4D1WA 1U8AA 3E27A 3P1JA 4P08A 4FGLA 3UXHA 4A0RA 5FLXA 4GD3Q 2GARA 4OA5A 4ZVTA 1LW7A 2GCOB 121PA 1R0YA 3PQ2A 2B2CA 3HFRA 3PNBA 4K9PA 3CZCA 4NOJA 4QUDA 3ILVA 3ITDA 1ZHHA 3MWJA 4A8TA 4JU9A 2H31A 1NF9A 4WOJA 5ALGA 3AHJA 4KXLA 3W4JA 1YD7A 2QG9A 2GTIA 2E7ZA 5ADHA 2QT1A 3R0QA 4Q7MB 1V3QE 3FDJA 3OE7D 1BMFA 1YS2X 2A59A 4BU1A 5C1PA 5JAZA 1UXHA 3MB5A 2N47A 4KC0A 3NOQA 2OZVA 3ZV6A 1BU5A 4US1R 1SRQA 5D86A 3TM5A 4RE6A 3EEFA 1G3QA 4FFOA 1A9QA 3OIWA 2QOEA 1U3UA 5AI6A 5AI5A 3VTKA 3ZW9A 2QX4A 1N77A 2GZSA 3LS2A 2PPLA 3KJNA 4MA4A 1J9ZA 2FMHA 4GZ3A 4ZAXA 5EJ6A 1RQ7A 5DMXA 3AZQA 3ZWFA 3RAPR 1KARA 2GJAA 5AUNB 1G0NA 1NQUA 4QUKA 1TTQB 3IT2A 1C0IA 4TYQA 2GLXA 1E66A 3UBTA 1EXNA 2FFRA 1V1RB 2RGUA 4QPPA 4W1QA 5DBGA 4BKUA 1EM8B 3FMPB 4G23A 3KE8A 3V4SA 4BQOA 1ZN8A 4R1PA 3CLSD 3JZAA 4GMGA 2O14A 4JBXA 1UQUA 1C81A 3GJ7A 3LVRE 4LI0A 4O63O 1QZTA 3GJYA 4BDTA 4AKHA 1D04A 1VI2A 3K1AA 2VBGA 4D1VA 3K0HA 1RI2A 2V6MA 2UZ4A 1C1YA 2IPAB 5EIBD 2UYGA 4YX9A 3ECAA 3TVTA 3QXHA 3KSBC 2FSIA 5B58C 3RBXA 4ZNBA 3E81A 3P9CA 3MOSA 1GL3A 1LI5A 1NVXQ 3IIMA 4GM4A 3GCZA 3SJAA 2J0VA 5CM9C 5JWRA 4EKDA 2O59A 2HJRA 2WYMA 4RPIA 3DNMA 1MRNA 5EQTA 1BCRA 2HYIC 1FQJA 3Q8WA 2HXSA 2Z5LA 3O2NA 5H9WA 2C9YA 2AX3A 2CB9A 2OO7A 1SB8A 4DAEA 4YLGA 2J5KA 3U9SA 1M10A 3IOYA 1W6RA 2HU7A 2VDJA 3ZXXA 4MHTA 3HXLA 1HTWA 3IB3A 2CNNA 2O2HA 3KQWA 2FU9A 3DBRB 4OXIA 3F5QA 1T3HA 1KFEB 5F9FA 3V97A 2L69A 1ZK1A 3O2QB 1M8JA 3CTPA 4K40A 3WJ1A 2Q8NA 5J1TB 2XUFA 4NJMB 1JHVA 1W8DA 1V3TA 4BO2A 4NAHA 4HDSA 4PTYA 4POOA 4TT3D 2LNDA 4H6XA 3TMAA 2YW2A 4EHFA 1W4AA 4AJHA 4A6DA 3S99A 4JEHA 4TKVA 4V1CI 4Z0NA 1I8TA 2PGIA 1Q7TA 4YI3A 1RI3A 3SSOA 4NE7A 2PMKA 1BKYA 3B78A 4PSUA 3ESYA 4UTXA 5E6UA 1MC8A 1IIRA 3T1NA 5GJBA 2CXOA 4R40A 3T95A 3JYOA 1RBQA 3H9BA 4O2RA 3HBLA 5ALRA 1GKYA 1RWXA 4BVKA 1WD7A 5LNK6 1FUEA 4UMFA 1EHIA 3T99A 3WKAA 3GHHA 5IN4A 1FYXA 1JFTA 1K3TA 2V6FA 4KR7A 2UYOA 4BNLA 3BYZA 3E5HA 1OC2A 3BMXA 1FVFA 2Z1MA 3NJ8A 1ZIXA 1Z26A 3DR3A 3OUZA 4CKCB 3H65A 3MVEA 3OCWA 4AYTA 3SC6A 4D3YA 3VJRA 3JQ9A 5FV4A 1U5BB 2IUTA 1V5EA 1U2EA 2DTXA 3PPXA 5BOSB 4O33A 2C29D 5ES3A 3V1LA 4JJ7A 5B7GA 3TZBA 1NE7A 1MO3A 2CBXA 2WVGA 3A3PA 3Q40A 1DV2A 2XNDD 3L4EA 3G1WA 2QROA 5CA0B 2C5FA 2ZG6A 1GL9B 2AG0A 2N75A 1JXOA 3INTA 4BRZA 2IODA 5CYGA 2HM7A 3KSZO 4G9GA 5FUVA 5C4IA 1NP7A 1BEEA 2CMFA 4AN0A 4A15A 3AF4A 1GCAA 4IMRA 2CSUA 1E1MA 1VSTA 4M1KA 3V2IA 5HJEA 3KVRA 1ODJA 3B7GA 3L06A 2FQQA 3ZHTA 5ADWA 1SULA 1XZCA 2XJ4A 1P80A 3FCXA 4IDOA 2E2WA 1PQUA 1SO8A 3GLHE 4R5HA 5FYQA 3K71B 4JQOA 3NFRA 2I4NA 1JBKA 2OXEA 2RHMA 3GJ6A 2X3FA 1OU4A 2PL5A 2IZ6A 2OCXA 2YIVX 4YWJA 4OHYA 2D1QA 4IQ4A 1AKEA 3Q3GE 4FUTA 4BEVA 4CLOA 1VGQA 4TM8A 4WXMA 1R8SA 4Z9XA 5JRDS 2F1HA 3OAAA 3ACCA 1E2HA 3A9CA 5BRJA 3R3ZA 4R8VA 3A6GA 5EMKA 2NUTB 1IWOA 2OFPA 4P3OA 4INJA 4UWRB 1ZXLA 5KOHB 1XTJA 3SF0A 4AI6A 1WKCA 3UJ6A 1CSEE 2XYHA 1T1RA 3EAFA 4Y0VA 2QRHA 2BZGA 4EA9A 4YHHB 3UHFA 4DLAA 1MB3A 2H08A 1IHXA 1I0LA 4YRJA 4LYYA 2N0SA 4CG2A 3I37X 5CT6A 4EDFA 1JSLA 3DW3X 4KMSA 2G0NA 1J9GA 3NX4A 3FCZA 1J25A 3TX6A 1KH3A 1QGDA 2AJCA 3COVA 3M1LA 3Q8XB 3BL5A 5F7OA 1O9GA 3NVMB 4OXNA 1MFPA 3UPTA 2ZUWA 2WKQA 4AURA 4YB8A 3AR2A 4Z9FA 2OYSA 4L0DA 2QRZA 3ZLBA 1K08A 3VOTA 4O4LA 3KX2A 5FCDA 1PEKE 3B1XA 5COBA 1DJOA 1H2HA 2XMZA 3W34A 3D7LA 4UAGA 4HDNA 3U3JA 5JROA 3TCNA 4WXYB 2BF7A 1E7WA 4DIUA 1M6VA 3ROFA 1SBHA 1GPWB 4UAUA 4RFSB 5CNIA 1KY2A 3ZHQA 2ZJOA 1Y4DE 1K0UA 2OPBA 2V58A 3BXHA 3I2FA 3WNZA 1KNXA 1NVVR 1Z33A 1NY5A 2G17A 3TI9A 1GPH1 5KTKA 4M21A 5CBPB 2VW8A 1IZ0A 3KOWA 3UJ7A 2QEQA 4E46A 4ALMA 5C1BA 5C51B 4NARA 4DNQA 2H1RA 1RQLA 3ROMA 2HIAA 1YRYE 4UULA 3GLGB 1T3ZA 4KV9A 1FPQA 1UK8A 2YS6A 4I99A 5CDTA 4D99A 1E62A 4KQHA 4LEIA 1B8VA 5GQSA 4HQRA 1JZQA 2NUPA 5T6MA 5TB5A 4RM5A 5K6RA 2REQB 4DYVA 5AKYA 2ZIZA 4CHGA 2E6KA 3BMOB 3O4HA 2J6HA 3MG9A 1XTKA 3IURA 3RYFA 1PS8A 3VOSA 1XEWY 3RK1A 2PPVA 1ISPA 4RIIA 4WVLA 4CRWB 2AFIA 3GGOA 5HX7A 1YE8A 4FONA 3RHFA 2Z9DA 3HFGA 2UUPA 2C8LA 1WBDA 2Q50A 1OU0A 2Q1WA 2R47A 3HB7A 3PEUA 3KJGA 3Q3EA 1UXJA 2XRMA 1DRJA 3REQA 1YGYA 1H2YA 4WBSA 4LCJA 3GUHA 1UBCA 4XVRA 5IDVA 1Z4OA 4E5NA 5HIAA 4P54A 1Y9ZA 1VHTA 3GZJA 3WYGA 3QM1A 5ACWA 2BFZA 3OIVA 4HG2A 4I7EA 5D7NA 1S3GA 5JH7F 1QNFA 4S1TA 4W82A 1PW5A 1IUKA 1Z4QA 3V9AA 1ODKA 4JNKA 3JWIA 1B1AA 2A0XA 2AK2A 1FL9A 2XITA 4MTCA 2IYEA 4UNQA 4OQ4A 2WWXA 1GZSA 3AKDA 4Q82A 4QGBA 1Z0ZA 1N2JA 2CMGA 3S7ZA 1HY3A 2JJ1A 3MWFA 5DTEA 1ZMRA 4C0SA 3BSSA 1T4CA 2VAWA 1NG9A 2BGRA 4S24A 4TQGA 1JJ7A 4IDQA 3IELA 2AC2A 3MCTA 4RSRA 4WGGA 3HVIA 1ZWLA 5CYFA 5DCWA 2VHCA 4YDQA 2XCRB 4HC4A 2PXCA 4B3TB 3KS9A 1SKQA 1I36A 2YWFA 3L79A 3KL2A 4LXYA 1QYVA 3B2QA 1DO8A 1VPVA 4L3VA 1P2TA 3QPAA 2XYGA 4KXUA 1KO4A 2CLEB 2HAEA 4XVUA 2Y8AA 4C7VA 1AKNA 4D41A 3X1YA 1M1NB 3W8FA 2WJHA 3LOPA 4M0CA 4IFBA 3RV4A 2OAGA 4IEIA 3NC1C 3EWAA 3ETLA 1VBNA 3GRUA 3BB4A 4QUJA 1URPA 4NCAA 4F4IA 1JIKA 1FDTA 4U9UA 2CLOB 5DDIP 5A9TA 5HW0A 3COPA 1KVRA 4ZDWA 3NAMA 2VS1A 3GMDA 2P41A 4N01A 3KXIA 3SGLA 4FMBB 4IRXA 4V0ME 2BDEA 2J0QA 2A35A 1MC5A 2DUNA 4QQKA 2I6FA 5EWJB 4PAGA 2VJBA 3ZH2A 4PG7A 4XXHA 1K68A 4LE2A 2QR5A 4XRGA 5JY1A 1Y4AE 4BRUA 1BGXT 3G0IA 2MSKA 5AK5A 1DXKA 2VF2A 1GA1A 2NXCA 5KS2A 1RD4A 4ZC1A 2HN9A 4Y1RA 4UOZA 4H59A 1FMFA 1WWKA 4N65A 4ME6A 2PANA 4V0SA 3QY9A 4JUIA 3E5RA 5FTNA 4QU5A 5IP5A 2OXIA 4CIWA 4TRMA 3TW4A 2KHZA 2QD4A 2ZE8A 3ROGA 3TIXB 2EFEB 5JI3E 4ZWNA 4UDYX 5L4NA 1DEHA 2FUG6 2VDVE 4RMHA 5DXJA 3T5GA 4F9EA 3DOCA 5EVJA 2NO0A 4FDVA 3KSAC 3TLGA 1OBCA 4ESVA 4XFKA 5CR9A 2P67A 5IKOA 3PXBA 5KDLA 1FTWA 3FIJA 3GY0A 3UHJA 2PKYX 2WTUA 3HRHA 1T9HA 4AJNA 2VDLB 5AW7A 3CH7A 1UJNA 2PT5A 5IC6A 3SQWA 2PBFA 1SVIA 2HDWA 5AQEA 2FWRA 2WZCA 3FPBA 3BAZA 1L5KA 4CMAA 1YULA 2GBLC 3SY8A 1UFOA 1AD2A 3VRHA 1JMKC 5E8JA 3IKTA 1O4WA 2GCEA 2PJUA 1IATA 4CIBA 3ZEAA 1DIOB 5JSZB 4DQKA 2A1IA 2C2XA 4NE9A 1QO7A 1PV4A 2A9PA 4S0XA 4ZJUA 2X6QA 3ICPA 1W4LA 4OB7A 2CNLA 3ELDA 3ONDA 4V24A 4S1VA 4HFRA 4GHWA 1OYYA 4M1OA 5C18A 4S2EA 4ES6A 3DZ8A 3LXXA 2XQJA 4MCHA 1TFRA 2J9FB 4JJZA 4IDHA 3OC0A 4GYYA 4RAOA 4ZVRA 4ZGBA 2OK7A 2XCOA 4YSKA 4PU0A 5K3EA 2QD1A 1QQ7A 1UEIA 1VP3A 2VRWA 5CCBA 1D1TA 3A11A 3A0RB 3C8HA 1JQAA 1YUNA 2W6CX 4UD2A 5F7JA 5H3HA 3R7AA 2IH2A 1W85A 1L5GB 2CVHA 1Q6YA 1DIBA 2GCPA 2JFGA 2Z09A 5EMMA 1XF9A 4D5EA 2J45A 3K9HA 3EVTA 2XMPA 4MEBA 1PD0A 2EX1A 3C15C 4HQNA 4O1HA 3TZLA 2Q2OA 4L6AA 2FV8A 3DTNA 4Q47A 3UANA 4KO4S 5ABPA 2CC2A 3AR4A 4BFVA 4LTMA 1W96A 4UBMA 3PHJA 3CNEA 5CDSA 1G8GA 2R97A 4NEHB 3JZDA 5C35A 1U1GA 4ZYUA 1I5EA 3GNSA 1JDNA 3MTEA 3ZTYA 1IHYA 1QHYA 4EQ6B 4KVAA 2ZCJA 2XF8A 4FFLA 3KPYA 1Z2NX 4N1AA 5ACRA 4MP8A 2M1XA 3L8MA 4HLCA 1K5GA 1BXGB 2W7TA 1NMEA 2XODA 1Y1RA 3JR7A 3DP9A 3EFOB 4YHBA 5DHQA 5AM4A 5T8KC 1KBQA 3RDPA 1KU6A 1QH9A 4O4JB 2VZ9A 5ALTA 1CB7A 4WT7A 6ADHA 2VHTA 4NFHA 4W8OA 4B71A 1Z4KA 3E18A 5F35A 3E23A 3ZEIA 1A95A 1J2JA 4GX1A 4DDUA 2ZITA 5IHPA 2GM5A 1RAEA 5ICMA 5JVDF 4JDPA 1CU1A 2DTDA 4H15A 1HL3A 3EN0A 4TUYF 5EWMA 3U7RA 4B6GA 2JBAB 4WN9A 2Q9CA 3CZ9A 1KJYA 1XDSA 2JA1A 1TZMA 4D42A 1MW8X 3EDRA 1AURA 2RH5A 1PKXA 4WOBA 5C9ZA 4YJ2F 3AOEC 3N2GB 3ZU2A 4MYUA 2ZAYA 5A7GA 2Q0XA 2QJSA 1E1DA 2N9UA 2FPWA 3TCXB 3ZU4A 4F6RB 3A3OA 4ALIA 3RC8A 3BN3A 1RHMA 5IFLA 4OQEA 3QWHA 1OZHA 1RZUA 3ILXA 1PVOA 2B5WA 1CY4A 2YUIA 3CV3A 4XZ3A 2CE7A 3MQ2A 5K6AC 2HHCA 4CKWA 1IZZA 1NE2A 4HAYA 2OV6A 1AUXA 2ODTX 3BMCB 4ZJZA 3D5TA 3NH9A 4MI6A 3NH6A 1LI4A 4XPIA 2DCUA 3I62A 4LJLA 2VSYA 2ZIEA 1JYFA 1OVGA 1VB5A 3KHSA 2E3JA 4OJQA 5T57A 4NOKA 1CR4A 3GFQA 4RAWA 3L9WA 1QRAA 2AVDA 2ZBRA 1YJ5A 1QE0A 4YT5A 3I1JA 5DJ5A 3DLIA 4E1BA 1KQGA 1KMMA 2CLHB 1U3CA 3LQYA 5HF6A 3T7TA 2GB4A 5JZOA 5ILQA 4YAKA 3HYCA 1H6BA 1TIBA 2WJ3A 5H1YA 1JLKA 2HJ9A 3E9ZA 3GCGA 1C2YA 1G3MA 4LJ9A 4LYEA 3GUCA 1KK2A 4D5GA 4F56A 5EJ5A 3ETDA 1TIKA 4QICA 5CDFA 2C8KA 5GINE 2VC2B 4BQQA 3CRQA 1HTTA 5BN4A 3HXPA 3ZV5A 4WUVA 4GPBA 4CIAA 3HCCA 3TI7A 2Y3IA 3W7AA 4AKEA 1M1UA 3HYNA 5AM1A 3S4YA 1GDTA 3ZWPA 2CFSA 1EHYA 3EXHC 1UKEA 3PJEA 4PIPA 3QNUA 4YRNA 4D0SA 1A2QA 2GRJA 2BDUA 1RJEA 3JAWB 1C29B 2C00A 1OBHA 3HWRA 3PXCX 4I8DA 5EIWA 1MJGA 2EJUA 5C8ZA 3A04A 1QRSA 3MOIA 1K6IA 2RSLA 1NW9B 2P6MA 3DJYA 4P3NA 4BVGA 2B21A 1V4BA 2BFWA 3PS9A 4IIEA 3QFFA 4D7AA 1E5XA 3Q72A 1LDBA 1RQGA 1H66A 3NWBA 4I46A 2JH3A 3RYIA 1HE2A 1SUWA 2AN5A 4G97A 4RH3A 1JE0A 5E3IA 4P98A 4N47A 3PQ4A 1YVRA 1FPMA 4I5EA 1YI1A 4UBIA 4BQPA 1ESCA 4ZVKA 2JAPA 5BYBA 3LM8A 2NMVA 1T6ZA 5C81A 2P2SA 3GH3A 4GQIA 4YUYA 2ONYA 4HX5A 1BX0A 3JW8A 3I1YA 2OTCA 1ZN2A 3SIRA 4BL5A 2OMKA 1WDMA 3PFFA 1DJNA 4ZANA 1LZKA 3BBLA 5E7JA 2A78A 4M8LA 2H59A 4BNWA 4ND3A 3GJZA 1CJBA 4MWSA 5K4MA 3O5AA 4UCQA 5ARCA 1UM8A 1KFCB 4UXHA 3RTAA 3RAEC 4O2AB 5AHWA 1XTSA 5A3JA 2GBLA 1YQXA 2FK8A 4EA6A 4IHQA 4OLAA 2OV2A 4RIGA 4MW2A 1G7SA 4DM7A 3FYUB 1RJDA 5KTTA 3G1TA 4YDRA 2CMKA 1TQHA 1K66A 5JD4A 2AFHB 2DWQA 2JZCA 4OY3A 4HWRA 1VOTA 4JUCA 1DTSA 1WXEA 5J4KA 2GEJA 2ZI9A 1G59A 5HG0A 4C4ZA 4RHFA 1KE2A 4PGFA 4RYDA 1FMJA 4U7GA 1JDTA 2HMYB 1TF5A 4HS4A 4A1OA 4B9AA 5IYZB 1I1NA 1SQ0A 4AF7A 1E1QD 3KE9A 5H8WA 2VSOA 2GUWA 3MJSA 3PL5A 4FHZA 4ZAZA 3RB8A 3VYTB 1XVLA 1WETA 1XROA 1WQ3A 4MW5A 1NV9A 1JLLA 1XVAA 1E32A 2QT9A 3PP8A 4HTAA 4LC0A 1TRKA 4LBYA 4CODB 3RH0A 4RTMA 4YGXB 1Q12A 1U2ZA 1OWNA 1VCHA 2GMWA 3DZDA 3GRVA 3HBMA 3NFYA 5H9VA 1GAWA 1ORHA 1L4FA 3EW9A 3MERA 5ESRA 5LA6B 1FFSA 2OCBA 2WJVA 2Q42A 4U7JA 4M0UA 4TXHA 3UJCA 1M76A 4XUDA 1P0PA 3KRTA 5L6LB 4GT1A 1X8LA 4FFPA 1NAHA 1ZVKA 4AJLA 1UDBA 4U4AA 2WQ7A 5ALZA 5ES4B 2CMDA 1ZH8A 2ZSBA 4HQOA 5DTMA 3AU8A 4B84A 3R1IA 3NS7A 2R60A 3TJZA 2NYUA 1HE5A 3Q0TA 2J4DA 2KMLA 3OF3A 4H18A 3ETNA 2O2CA 4XEUA 1WSDA 2X2EA 3BC1A 3OZDA 5BUZA 4N3GA 4ARZB 3HGTA 5AMXA 821PA 1X8HA 4D79A 1DKQA 1E18A 3S44A 4E1AA 3KZKA 5DGXA 3IT3A 3UWPA 2YJ4A 2VHZA 1JF8A 2W2KB 1O03A 3VU9A 5DLEA 4EO7A 1UF9A 1A8IA 1NN0A 5EKUA 1BZYA 1VHJA 2O3TA 3H2IA 4UBLA 5T8KA 4EKNB 3FOFC 3U9TA 4BBJA 2XKKA 2ZJZA 4EELA 2X6RA 1ULUA 2AHRA 1GZHB 3KU1A 3OFSA 5DGIA 3MJVA 7ADHA 1P39A 4DABA 4LECA 5HGXA 4M0KA 2FPXA 4I55A 2ESRA 1J22A 2CF5A 2ISCA 2Q1SA 3THWA 2WF9A 4YXWD 1YZFA 4Q9AA 3WK4A 1ECBA 1OSNA 1NQOA 1ONPA 2H4FA 3WXCA 4QBHA 4PCLA 4LDJA 3C3KA 4JEUA 1VBKA 3KLPX 3KLNA 3AOEA 1V71A 1IBLB 2CG2A 4ZRNA 3SC4A 1JJFA 2HDNB 4EDHA 1Z22A 2PFSA 2V7XA 1WXXA 4A10A 3KEGA 3KQQA 4DFDA 4J0CA 1WG8A 4UD6A 5KVQA 4C4SA 2R48A 4WJZA 3HM9A 5HCIA 3NYIA 1GEEA 2R8XA 3OJWA 4Q9JA 1AMOA 4F11A 4TV9F 4B3CA 3RPCA 4TRJA 4ZAYA 5DT2A 2B34A 4BTLA 1U4SA 4IDPA 2GN1A 5KTSA 1SUEA 1S9HA 2PFGA 2Y71A 5K6AA 3BL8A 4K5QA 3RJ5A 4Q03A 3SBXA 2H6EA 2OHJA 1FXWF 3FFTA 5EIXA 3FTFA 1UOQA 1VL5A 4GLJA 5I9TA 3AI7A 3EVBA 3PHCA 3X2FA 2QD2A 3VNVA 2F3TA 4ZO6A 1L5ZA 1Z68A 2H9IA 3EVNA 3EWSA 3ZV7A 1CP3A 1NURA 4WASA 2CV0A 1Z2OX 4NENA 1EPUA 1DKMA 2HPZA 3JQ8B 4KPGA 4X8MA 1E3DA 2C59A 5CURA 3BJZA 3ZWMA 4NLLA 3WMFA 3NOXA 4G0NA 1QLHA 1TCUA 2X8WA 3V1TC 3BTVA 1W0KD 1XRSB 4A16A 1HT3A 3EZGA 2IU6A 1ADYA 2P9GA 4HUQA 1HC7A 2B99A 3OY7A 3OZBA 2EP5A 4I6EA 2AFIE 3UF0A 3FGZA 3GAFA 3QENA 5BYJA 3V3KA 3I6IA 2Y93A 4KU4A 2G7MC 2ZYVX 3RUEA 2C7VA 4X7MA 3T5MA 4CFYA 3EPJA 3SBOA 4W8GA 1FNMA 1QH0A 1EFAA 4BO9A 1QHSA 3TOSA 4M7OA 2W11A 3DPIA 4TLLB 3BCRA 4GW3A 3EVDA 1C1XB 3NNNA 1E5VA 4WNIA 2Z6UA 2PS0A 3EXHA 3F4BA 5LKAA 1X1RA 1E8DA 4D9BA 4NXNB 2NP6A 1NJ2A 4FZVA 3SX4A 5JPDA 4R16A 2PR2A 1N2XA 3THYA 4ER6A 4URXR 2P1EA 1U5AA 2G5GX 3GC6A 3DKPA 1TQ2A 5G3ZA 3L4JA 3E3NA 4E4YA 3NM4A 3PI7A 3BUSA 3TIIA 1GAJA 4FFRA 1RWKA 3PSHA 4N8EA 2GN9A 1ZI9A 5GY7A 3N1UA 1KQFA 1XTZA 5IWCA 1NYRA 3VC7A 4RJIA 3BHJA 4GOXA 1DWUA 4IGIA 5HCUA 4AWAA 3HS3A 1HYGA 4B3JA 2F1RA 1NGSA 4G0XA 1SU8A 4RTLA 2D8AA 1Z29A 2W0SA 2XYPA 3U4GA 4TS3A 5JSFA 1TADA 1HMYA 1YBFA 3KLMX 4HS9A 1G5QA 1YZNA 2DHEA 2DQZA 4UTPA 2FCRA 4ND6A 4AJ9A 3VJLA 3WICA 4OMDA 5AKZA 4A0FA 1CIVA 3OLZA 5AI4A 1LY1A 2VYCA 4R8RA 5DHFA 1VPWA 2ZIUB 1DT5A 4OB8A 4Z0HO 3KQHA 2I6QA 2RGRA 4FW8A 2DF8A 3L1KA 1DQYA 3FX2A 4QYSA 4F8JA 3ABIA 4CEHB 2XDQA 4N41A 4MWOA 4TMYA 3ZWVA 1CG6A 1LGYA 1W19A 4IM7A 4XB6B 5TEVA 3SOPA 5JPCA 2AOWA 1X8GA 2BGMA 5JH7A 1M7BA 2C7GA 4FP9A 2PUEA 3MWYW 3ZNPA 2Z4RA 5FH9A 2GKOA 3GBPA 2NZ2A 5AHXA 1LJUA 3GO4A 1XKTA 2J3MA 2AXEA 4G86A 1MJHA 3HCNA 1BMTA 2DR3A 2HEIA 4K9DA 4HWSA 4J0JA 1TQ8A 1SOWA 5HMMA 1H23A 2VO1A 2SCUB 3ILHA 4AM8A 4WCDA 1DOAA 2VP9A 1GCOA 5LZ2A 1U7WA 2XZLA 4EUFA 4YV0A 4E0BA 1IWPB 1YE5A 3TRKA 3AJDA 2BN4A 2PE5A 2HJSA 4M1SA 1YJQA 1R4ZA 4E21A 3J80A 3WGOA 2JLBA 4Q1VA 1X7WB 3D7RA 5EWAA 3X2XA 4Y2QA 3I5UA 1XDDA 2IEBA 4QO7A 2VAPA 3PGJA 1FJGB 3M6FA 4WKPA 3EX7C 1CF9A 4G4SP 5AKHA 4Z4FA 1JN0A 2CNWD 2OGZA 1N5IA 3NNDA 3FJYA 2JIOA 4QOEA 4GOLD 2WNIA 4JB8A 4U9IS 2L2QA 3RWMB 3P0EA 4OJYA 7MDHA 4D25A 1GV1A 1Z2AA 4PO8A 4BE9A 2YN2A 3GUUA 4MP3A 3B12A 1F7UA 1JQ3A 5B2ZA 1YR6A 2FMTA 5E9WA 3H7IA 1T2FA 1XRJA 3IP8A 5GJWC 1FBNA 2Y0BA 1OLOA 2Q5LA 3O0DA 3ZXSA 1DSSG 3E9RA 1ABBA 4BNVA 5KWIA 1EK2A 2G9RA 4A92A 3HDGA 1GT6A 1G5HA 1Q0UA 3LMKA 4IOKA 3ZHCA 3QOXA 1AF4A 2EIHA 4EVRA 2QPTA 4EUSA 5BSEA 1W48A 1W5FA 3EIQA 3ESHA 1BQEA 4WLOA 1HDZA 1TCBA 2MSDB 3SE7A 3PR2B 2NPOA 1ZITA 3QEAZ 4IIJA 4UCWA 1FFAA 4PY2A 3N7UA 1IY8A 1VJDA 1NXXA 5BSVA 1KDPA 2HCTA 1WVGA 2IU0A 3W8RA 1ISFA 1NDQA 4YRRA 2XE7A 3LUGA 2OKCA 4BQSA 1WABA 4PYJA 2G5PA 2JH8A 3UGJA 4Y18A 4UM5A 5F23A 4QUGA 3WLNA 4GBMA 4ARIA 2A86A 3GCDA 2GK4A 3NTQA 3TDMA 3QMPA 4FI3F 1Z6QA 4DEVA 1VHDA 2BTQB 5EXSA 3BZBA 4NWIA 2H52A 2H4XA 1O77A 4O4IF 4Y2TA 3T5CA 1KJ9A 1OJLA 3OQIA 2ZCVA 4X1OA 4D9MA 2CMHA 1V7QA 2L0XA 2ZU0C 3WNVA 4E13A 5CD1A 3JARB 1JA0A 1MB4A 1J70A 2E89A 2H29A 3C16C 1EZZA 3N3BC 3ZKAA 3RIEA 2F8TA 2FPRA 2G9UA 2HI0A 5LQJA 1X8KA 5BMVF 3D4IA 2GFHA 2A8YA 2D0DA 4QGSA 4MB2A 1XHLA 5AJHA 1Z5PA 4GDMA 2ZCUA 3OX3A 1WL8A 3EYAA 1P8AA 1T2UA 1Z0UA 2FEPA 4F3KA 1OHHD 2F3UA 1TJ4A 2VVTA 1GUYA 1FTGA 5TMDA 3PJRA 4R71A 2W2PA 4QBGB 2QF7A 4BFYA 1FDWA 2F55A 1U8UA 2CHFA 3G2KA 1W7AA 1M67A 4XWAA 4X45A 3E3AA 3F46A 4KLAA 3DMFA 1RWNA 1QV9A 1W2HA 3S0JA 5KTPA 2H1LA 2W4MA 3A9SA 2XCLA 4L73A 2P3SA 2Q5JA 4PYRA 3KKNA 4U39A 5DGTA 2OQVA 2JHGA 4MV3A 2XTNA 1R0XA 3UM9A 2BR6A 1X15A 3IAHA 1JMYA 4R7GA 3AUSA 4ASUA 2JIDA 3CKLA 4AO7A 1RHQA 4XR4A 2BFEB 1EDEA 1WMFA 2VJKA 2QUIA 1D5WA 3KEOA 5BW4A 3DKRA 4H4EA 4OBEA 1SZCA 4P7KA 4CT4B 1XJQA 2XGOA 3OT1B 3RKKA 3KM0A 4RPCA 1ZINA 3R7WA 5L3SB 2HQ1A 3CUWA 2HD4A 4YCSA 5FBLB 1A8SA 3G6KA 3DD1A 4I50B 1RZRD 4CG0A 2C58A 4OL9A 6ABPA 4RVUA 4JV5B 4QYMA 4NCHA 3ZWOA 1RWOA 1Z4MA 3LRTA 5DP2A 2WAXA 4FGWA 3N39C 4DR1B 1ZSVA 3RS9A 4YNBA 2FW9A 4JB3A 4GP7A 5HK9A 1TUGA 3Q7TA 1YHNA 2OCDA 1KO5A 5DX0A 1C4WA 3AESB 4CT5A 2Y0CA 5K3OA 2QG4A 4P3YA 4XFDA 2ZRQA 2C57A 4KW7A 5BYKA 1F2UB 5CB4F 3MHTA 2P0YA 3RSSA 1X9GA 3RF7A 4X65B 1H42A 3NGXA 3D4BA 1V2GA 4FBGA 3VO1A 2WQ6A 1O58A 3DO8A 1RJFA 1CZLA 1OAOC 3DE5X 3U3XA 4JQSA 1R4NA 3E0XA 4YPFA 1T24A 3V55A 3HWWA 4UHJA 3IT1A 3PQEA 2QRVB 3VPDA 4LSZA 3WMXA 1M5RA 1UZAA 1I4DD 1XQWA 5BPHA 4OQLA 1BH6A 3DXYA 3SE0A 2C42A 3AHFA 2Q3FA 1XEXB 4HRXA 4RFVA 4PBTA 2IYSA 4BZWA 4LV5B 3A36A 3DMRA 5IT9A 5DI9A 5KNCH 3U7GA 4DCUA 2VF4X 1I5OA 1YHZA 4OHPA 1ZK4A 1XZBA 3T0FA 2QE7A 1NRIA 2UVDA 2ZANA 2C9CA 4G26A 4MAFA 1CQPA 1IBKB 1QU2A 1Y1SA 4FEGA 4ZU1X 3KDPA 1W36D 4IW3B 5AW5A 3U44B 2ECFA 1O0SA 3T4UA 5CVDA 2Q3BA 3U4HA 1HUQA 4KDFA 4FQ5A 1SCUA 3KKLA 3QX3A 2H6AA 5IF9A 1NTOA 2PCLA 1LBEA 3H13A 3OUTA 1SKYE 2YWCA 4M0DA 1JTFA 4B3XA 4B82A 1AHIA 2ATVA 3P20A 1MB2A 1Q0TA 2Y6UA 4L4UA 1X7DA 2QVLA 1I80A 5CDUA 1T2AA 1UMCB 4ER3A 2XDWA 4P53A 4DMGA 5BNIA 2RFLA 2OEPA 2PLNA 1QCCA 1RWVA 3NAGA 1NI5A 4X6XA 3SYKA 5ALHA 1J99A 5FLYA 2V3CC 2O7VA 5DGHA 3BGDA 1J7JA 2FNAA 2DU8A 2V0CA 4GVLA 5B6PA 3ESCA 4FZ5A 2QDKA 3K0KA 1E5QA 2HA5A 3JVUA 3GYBA 3I05A 3INNA 1UEJA 4BB6A 2I65A 1EWRA 2X5KO 4TVOA 3G9UA 3REGA 4GI1A 5JECA 4O4HA 1GPYA 2SKEA 2V9ZA 3G68A 5FUXA 4UUNA 2OILA 2IYTA 2P77A 4BXOB 1MVLA 1QHGA 3T0IA 1CE8B 1JYEA 3B5JA 4BLVA 3KFXA 4M54A 4E1VA 4EYBA 2BMFA 4BEJA 1O95C 1AC5A 3IUYA 2ZRMA 4Z3OA 3OIDA 4G0QA 1E2FA 1YBMA 2GD2A 3AVYA 4EJ2A 2NG1A 4X8OA 4MO9A 2VTDA 3RU2A 1PZEA 3G17A 2ZBDA 2CB0A 5IAAA 4XGNA 3SS9X 3ZZMA 2G3YA 3FDZB 1VCIA 2XVYA 2V7WA 1O6FA 4HAOA 4NP6A 4DR2B 4H0DA 1CFJA 2Q5HA 3C45A 3ITEA 1ICEA 4IS2A 5CIWA 1FK8A 5BQPA 3R9KA 2ETVA 4DMRA 5HP4A 2ODNA 4GE3A 1C9MA 4RXMA 1BDIA 3LCVB 5I7RA 2WYHA 1RQ2A 4CF3A 1R66A 2SKDA 2MTBA 3FB1A 3FD8A 1LFDB 5IABA 1AB5A 1D4ZA 4KXXA 3E82A 5AK0A 5FTKA 4RELA 3WP0A 3KHTA 3VA7A 3GR6A 1JDBC 1ZNZA 1U8YA 5C31A 3D1VA 3LT1A 1GXSA 1NDHA 1QVRA 1TNDA 1TT5B 2CL5A 3D31A 3IPCA 4TYMA 3EH2A 5ENDA 4XYBA 4D8TA 2NYVA 2JASA 1NW8A 1ZD2P 3D0RA 1SIWA 3SJBA 1FFEA 2QTTA 4BHTA 3HR4A 1ZGAA 3C8DA 4F3YA 2XF4A 3UAXA 1Y7IA 2J0UB 3GCWA 5IC4A 2PO5A 5HK8A 2HU2A 2AR9A 2ID4A 1KQPA 1C1DA 2W6JA 3UMJA 1FY2A 1O3YA 3OZWA 5TPWA 1XV5A 3LPDA 1TYDE 1CIPA 2AN4A 4JYBA 3LT2A 4HFJA 4PSVA 4M88A 4TRRA 1M8FA 3GRKA 4I19A 1ORDA 5CVVA 4C0LA 2HXYA 1NXOA 1S1CA 2BV3A 4MLPA 3GD5A 5F1YA 2C3MA 4GMXA 1V5WA 1DDIA 4Y9RA 2BM9A 3BAFA 3KXDA 1MF7A 3PNYA 3VYWA 3WOVA 3TRDA 3DR5A 2QJWA 1K8RA 3EK2A 5K4GA 3UKDA 1YQDA 2O8FA 3H2ZA 1S2OA 4GYKA 4CZ2A 3N8KA 2AX4A 4EM6A 1PR0A 3HHEA 5G0WA 1K92A 3AV3A 3DZJA 3RQSA 3HNRA 4FFNA 1JDPA 1QE5A 2ZE5A 4E30A 4W7IA 3DEKA 1P44A 1WQ4A 1CQIB 1WUJS 2OGWA 3IOEA 4Y6OA 3KV3O 3H18A 1NXVA 1M2XA 2X0JA 4N18A 2MIIA 1Q7CA 3G2OA 3L7LA 4GP9A 1IWBB 2JS7A 5DI3B 5CA1B 1JR6A 1RXYA 1VHWA 5B12A 4ZZ3A 2WSSA 4PX3A 3PNQA 3F7OA 4Q4AB 1QCDA 4MVJM 4UHEA 1SK9A 3C85A 3P8ZA 3DT9A 4WN3A 3CWQA 4FFWA 4AZ3B 5B7PA 1LTKA 1FX1A 3IFSA 1GQRA 3JATA 1LBSA 4J0KA 4IIVA 3VC3A 5KO2A 4GBED 1YFZA 5AJLA 4RKYA 4XLTA 4YONB 1AH2A 2JGDA 4N5MA 4AY2A 1KR3A 1RKBA 2HHHB 4L9RA 3CW2A 3QLJA 4N0EA 1X1DA 3KR0A 4BWVA 1OAOA 4CKZA 2I87A 4MQEA 3DA8A 3MMXA 3EGIA 5FI5A 5UKDA 1W75A 3UBMA 2VNHA 4XD2A 1BVRA 3ZE1B 2R00C 4LV8B 3VFDA 4JJ8A 1ESDA 2G5TA 4NCXA 1ADFA 3PIDA 3O38A 3SBEA 3H1GA 1G98A 2WAAA 3GZNB 4F0JA 4IZHA 2ALJA 4QHYA 3NR2A 2QUBA 1NUTA 2OBFA 4CMJA 3LW7A 1YR2A 4GM0A 3HUFA 1K7YA 5F33A 5GOZA 4L9WA 2A6PA 3IXQA 5BW8A 4C0AC 3HWSA 4ZVSA 1XZNA 5F5NA 4GWGA 4RBSA 4G24A 4WCFC 3A2KA 1SUPA 5KSZA 3JX9A 2GZ1A 2Q7XA 5EY5B 3DD5A 2WIJA 4J0FA 4AIRA 2Z9CA 3PEVA 3I5YA 4Z4IA 1C0LA 3RLFA 3VR2D 1JFVA 1S3SA 2B5VA 1QF7A 2C8JA 4PZYA 2CXRA 3DOFA 2X7XA 2YNTA 1GG8A 2YJ3A 4JYPA 4DRZA 2LCFA 3IIEA 4B44A 2YHIB 1W4ZA 2ZRJA 1JG3A 3OOWA 2QINA 3I2HA 5K4AA 2WD7A 3DL0A 5IT0A 3BJEA 4CEJA 1Y5MA 4H0CA 4GRAA 1F8YA 4QGAA 3DFFA 3OX1A 1RTKA 4Q4LA 3F73A 2B1QA 5HIOA 1PGJA 2O2YA 2JLQA 2HT6A 1KKUA 5JO9A 3IVCA 1JHPA 5CLJA 1PEDA 4LZAA 2IXEA 3F6YA 3U39A 4J6EA 4C0XA 1N2ZA 1O96B 4L85A 2GR9A 4OOEA 3A6ZA 4OIFA 1E2KA 1JG2A 2NO1A 2DBVO 3FF1A 1EFRA 3B3FA 3LPAA 4J0DA 4JSYA 2C4VA 1X9HA 4CR6A 5C46F 3T1QA 3QE9Y 1LX6A 2MSNA 4C3UA 2ZVJA 5IG2A 1YDEA 5LBTA 3K9QO 4CN8A 2DBRA 4GPAA 1Y1PA 2HX1A 4CMIB 1SN7A 2WF7A 1WCIB 1MJFA 1UPXA 2FEMA 1QG0A 1XMJA 5I7AA 4UWPB 1PJBA 2EFGA 2J3QA 2VG8A 3ANMA 3JD0A 3ORFA 4RH1A 3AYZB 3NUZA 1N5JA 2XCIA 2D0IA 2IEZA 3KOXA 4DV3B 2Z1DA 3FWNA 1FU7A 1NMXA 2GJ8A 1W88A 4II2A 4NDAA 3P32A 5FI3A 3UB2A 3W90A 4B45A 5BSRA 2VDKB 2OGUA 5ILOA 4C7JA 4DMFA 4WXHA 2Q41A 1K8XB 1P4AA 1RM3A 1SHTX 1LDMA 2YIMA 5HMLA 2PXXA 4FWTA 2XXAB 5AUPB 3T3PB 1VJ1A 3RT1A 1JFFB 2YQ5A 3C70A 4I4LA 4E5KA 3G5TA 3AR7A 4AN4A 1H9BA 1XWIA 2NW6A 5HIJA 5HTOA 5HEKA 4DGQA 4DEYA 4EL5A 1OXTA 5G4LA 3CLUD 1AXGA 1OX4B 3HXMA 3C6QA 2PVPA 4LISA 2GXQA 2NZVG 3DOEA 4Y2YA 1ZOIA 1V3VA 1J0EA 5AOCA 3KJFA 5JFTA 1RBYA 1TYEB 3I9NA 3G13A 2HMVA 4D9FA 5SZKB 3SZUA 5MN5A 1JT9A 1NKVA 4B6FA 4OSPA 5AEBA 3R3HA 1X94A 4RY9A 4ON9A 4A2CA 3AIIA 5EHIA 1JHYA 1UC9A 2FX3A 4L5AA 3AEQA 4V39A 1YRAA 1ZD4A 5GMOA 3HH8A 2C96A 6PFKA 1WJGA 4E4TA 5CLFA 1EHCA 5HKLA 4CV1A 1V6CA 4D4MA 1O6GA 2QN2A 4I4TF 3ORRA 1F8UA 1OTXA 1SXJC 3DPSA 3SR0A 4COKA 4ZGGA 4AUKA 3EQZA 4DSTA 1QO0D 1VL6A 3U62A 4A73A 4ESEA 3U0VA 4O2LA 5I01A 3ZDDA 3RVBA 2J09A 2P11A 4P0TA 4YRPA 4ZT2A 2NVUB 4F21A 2H07A 1NXWA 4XX1A 1BS1A 5GONB 1Q77A 4YQEA 1SURA 1YC5A 3FGOA 4NHOA 4Y6RA 2BEJA 1EP2B 3K32A 1KYTA 2ONKA 4HB3A 4NYMR 5CYPA 3TMYA 2YVAA 5C52B 1QS0B 3D6VA 2PA3A 3NLLA 4XPZA 3SHTA 2X76A 3OTGA 4LQ4A 4YCBA 3CF4A 4L8WB 1YGPA 4B6JA 4JAVC 5ICSA 4OI0A 2EJVA 2B9EA 5ALVA 5KMGA 4O29A 5IKMA 2EZUA 2PLRA 3IVRA 4FJ1A 1QGZA 1TM5E 4J07A 2F1JA 5BV2P 2IQIA 1TVKB 2O2XA 1ZUWA 1DAMA 2VDUE 3ACDA 3V7UA 4X1YB 1QRRA 1E63A 1L6RA 5LQRA 3UC9A 2EKZA 2RGNC 4ZCTA 2BI8A 1QVVA 1WU7A 3LX5A 4UBOA 3AM4A 2VF7A 3TTWA 3PTAA 1T4BA 2V8OA 1LQTA 2J5XA 4FKZA 2X42A 3L6RA 4UVIA 3K20A 1CJTC 1O97C 3OA2A 1M2HA 3OCXA 3EA5A 4DC1A 2DR2A 3L6NA 1E9FA 5B3RA 3A4LA 4DTCA 2CY0A 2YVUA 5H3CA 3PU6A 1AMUA 5IASA 1TM3E 5IRCD 4L6IA 2A30A 2CJWA 4UVGA 1GA6A 4FFVA 2DFTA 3MIZA 3VPFA 1JA9A 1H8HD 1Z34A 3G9TA 4KGZA 4TSRA 4ZOLF 3WNDA 2HFJA 3OWHA 5SY6A 4YRBA 4JKIA 2WKSA 1MFZA 1Z6ZA 3JQPA 5LLTA 4RBNA 3LKDA 1A5AB 1W87A 3JYLA 4KAXA 5KYWB 3H83A 3W3ZB 3PF8A 1UP6A 1M8PA 2BCJQ 3HJTA 5A5EA 5JLAA 2ZI5A 3IDZA 1B6TA 3ISVA 2OHVA 2R1TB 2VIIA 2I8LA 3KT3A 4JOBA 1G9XA 3MYRA 4PZUA 4C06A 4ZHSA 1TLFA 2BD0A 4LPSA 4BO7A 2YRFA 2VYNA 3F9CA 5F5XA 3W4IA 1TW2A 2IYPA 2ATCA 2R00A 4RORA 5D1NA 1TEZA 1GKLA 5IUJC 2RJOA 1R2QA 1IM5A 4TQ9A 1XL0A 3LHIA 1Y82A 3ZJ4A 3WTCA 3GARA 1W9HA 5A0FA 3SCZA 1SB9A 5DBOA 4B4OA 2N3ZA 3U17A 1NW6A 2QYOA 3OTQA 5JMPA 5CFOA 1KO8A 2VPQA 3AHGA 3GJTA 4E2ZA 2J9GA 3KTOA 5IBPA 4W5RA 1NNEA 2CXHA 1T8YA 5TY0A 1QYDA 4WCFA 3WSTA 2WRSA 2QYSA 1KAHA 4COOA 5KJ1A 4MDHA 4URUR 2R0QC 3SHOA 3TXAA 5TQ0A 2XUZA 3A3KA 1Q0SA 2AJBA 3ESQA 4JB2A 3TIGA 4OQZA 2ZUUA 1M1ZA 2ZUFA 1V16A 4YJ3B 4FSHA 1WV0A 2VYFA 3ELBA 3R3VA 3HUTA 3SG0A 4DRYA 5LD2B 3ABQB 1G6Q1 3A6FA 4G63A 4LNUA 1U7UA 2Z2JA 5T41A 5B30A 2P4SA 4CM8B 2CEAA 3WWCA 2CLSA 1JB9A 4DF3A 2YCLA 5F2NA 5CXQA 4NPCA 1S2GA 1HLDA 1ULAA 4J2HA 3GHYA 4X00A 2Q9UA 1PLLA 2O8DB 3DGFC 5J5VA 4ZRMA 5HH4A 3E9CA 1GR1A 4LQLA 1YUBA 4L15A 4KQMA 3H8JA 1JL3A 4LWPA 3RAGA 4KN9S 3TOZA 4CMKA 3D6MA 2I03A 4IUYA 1R9NA 2WUDA 3A9RA 3LKZA 2G6TA 1RYYA 1YS9A 3B89A 3A4IA 3NYWA 4U6SA 4ENPA 1H2WA 3TEMA 3JALB 1LU9A 3IUNA 4NL4H 1O6CA 1L5FA 1X7ZA 2GF9A 2VQDA 5FTLA 1NJGA 1QYRA 3FNBA 4RZXA 1KJNA 3JQFC 1BXKA 2BFBA 3K70B 2ZSHA 4HK4A 5KHAA 4DUPA 2O0MA 3CR3C 2VP5A 5A5GA 5ALIA 3LAWA 5CITA 3R3JA 4QPDA 4XYEA 5DV9A 4EHBA 3EZ9A 1ELOA 1GYQA 3TCKA 5HPYB 1RRCA 3ODPA 4LXTA 2I4IA 2ZJ0A 1ZVMA 4IIYA 5GWXA 4L3WA 1N8TA 2JIQA 4MVYA 5FD8A 2P2NA 4P84A 3DBLB 3ZOZA 4TV9A 1MO5A 4FI3C 1VLJA 1HOTA 4OHOA 1CDOA 2UZ3A 3O75A 3JAKA 4IJMA 4JKYA 3DM5A 3NYRA 3W5UA 1V8BA 2YY6A 4EVSA 3LKBA 2WY2D 1N3YA 2CJXA 3N3AC 3O8OB 4NQ4A 3HN6A 4X85A 4LX0A 1FXWA 2YJ6A 5I4BA 2GKLA 2GCNA 3GJSA 4QXOA 4J7UA 4OI2A 5EKSA 5HF9A 4BP3A 2W9XA 3EG9A 3P2OA 1QP7A 3A1NA 4YAIA 2IYLD 1Y8RB 4EZIA 1H1LB 1KHHA 1M1YA 3IMCA 4KIUA 5G3YA 3EUFA 2ODAA 3DUFA 3LRXA 4QPJC 1LZLA 3O03A 1EEHA 3RR2A 3MJHA 1VGRA 4JYCA 3M2PA 4QQFA 5AVOA 4DMKA 1ZEJA 2R6GA 3QX7A 2ZS9A 1RCUA 3EF1A 4RUKA 4DLNA 4BEWA 1K98A 9MHTA 3WQBA 3H5RA 3IE0A 4QJIA 5EHGA 5A1TA 2XBUA 1VRCA 3RJMA 1E1CA 5CVJA 1MABA 2BEUB 3KNZA 4ZOCA 4D8WA 4MCAA 5THKA 1SKBA 5AW3A 4EGJA 1FDRA 1M34B 3Q0EA 3OQHA 5I7OA 2OK8A 2R79A 2WU8A 3AY7A 3KD3A 3RUDA 1PFUA 5FV7A 5BW6B 5DSZA 2UYCA 1NWHA 1LPNA 3BTUA 4C4PA 3FOZA 3P2EA 3F97A 3OOJA 3AMVA 3B9RA 3CURA 3QY0A 4R0NA 3QNWA 1EIWA 4EHHA 4IRMA 1SWWA 4CTJA 2E4YA 2VH5R 1E8NA 3GAAA 5G4KB 4CCYA 3THXA 3AVXA 5JALA 3O8NA 2V55B 1Y98A 4UTOA 3B9QA 4N40A 1KZ9A 1NQWA 4J3JA 5MFZA 1YMUA 4X6UA 3VTZA 3I9OA 2EGGA 3MT7A 3PQFA 1NBIA 2M9MA 3P9ZA 2FU5C 4MWDA 4PINA 1B8PA 3KT8A 2H1CA 1P6XA 1VJRA 4MVJG 4RA6B 3E4DA 3K6KA 3SMQA 7REQA 4US2R 5L53A 3P5BA 3PNLA 2BGUA 3VO9A 1ZDMA 2RGNA 1Q14A 3S1LA 4BV2A 4F3NA 4IIDA 2DPGA 1P62B 1QAQA 1OFHA 3NM5A 4IL5A 4ZVVA 5HIMA 3VYUB 3WRXC 4BFTA 4UNPA 4PAMA 2QDTA 5LJIA 3IDQA 4UHBA 1PUJA 3GXOA 4CI0B 3VKUA 1CQWA 4X1IA 1C80A 4RIEA 2BMDA 4DIMA 2AR7A 4KO2S 5IM5A 2E55A 5J40A 3MFYA 3SLRA 3FTCA 1Z38A 2QNBA 3VI3B 1XG5A 4R9NA 1C3EA 2C04A 3F7NA 4B47A 3T9MA 4DBZA 2L18A 4XWKA 2D2IA 3D0QA 1D4AA 3I9V1 2X14A 3M3HA 4KN5A 2VKQA 1Z4NA 2YTZA 4KZPA 2IUUA 2JFQA 3FSEA 1Q3TA 4K6MA 3ZY4A 1J2RA 2JGJA 2IEGA 4TN1A 5G53C 1Q6ZA 4OBWA 4YIKA 2BGNA 4CV2A 5C80A 1PYGA 2ZBFA 3ND9A 1L2TA 1PL7A 1HF3A 2PKXA 2PT7A 3O73A 4CTKA 8ADHA 4A26A 1E7QA 2NU9B 3FWYA 3MJTA 5FBKA 1Z12A 4J0EA 2LCIA 1HRDA 1M2OB 1TA0A 4YRGA 3EF3A 3WADA 1IHUA 2ODBA 2Z9BA 4M1ZA 4W5OA 1UKBA 4LK2A 1HYBA 4KJZA 2XDAA 2LXNA 1LB1B 2H5EA 3FFWA 3F78A 2Z57A 4FW9A 4KO8A 1QH8B 2W00A 4HDKA 3TXYA 4U3JA 2FW8A 1FFWA 1I14A 4TN5A 1HMPA 521PA 1GR0A 1MNAA 4DQUA 3RWOA 1DWQA 5FOVA 1YV9A 1XU9A 4LOAA 2G1KA 5FUQA 4QOGA 2IBSA 2O8CB 3EOBI 4IUBS 1GPDG 3BRSA 3NT5A 5GPBA 1VRWA 3RKRA 4YT2A 4YRCA 2B3TA 5TV2A 3V3TA 3FG9A 4QQNA 3MF4A 2RHHA 5HF8A 1XZEA 2ILTA 3BTOA 1E5LA 3ET5A 3LO8A 3ENKA 1J20A 5H81A 5EHXA 1JR4A 4IILA 1P2GA 4WZAE 3H0KA 3DL7A 4R84A 3C5EA 3U1VA 3HVUA 1P45A 3GU3A 3NKLA 3OZVA 1ML3A 2R68A 2FOXA 4WY2A 4M83A 3FCCA 4PIMA 2TMYA 1Z0JA 4E12A 4LYJA 3AIKA 4HNVA 4KR6A 1KEZA 2JFOA 3TLKA 3QKRA 4E2FA 2ZJ8A 1YB6A 3NBUA 4LQCA 4MICA 4TZTA 5DYGA 2KPOA 1QFJA 2NZXA 3L0ZA 5D5QA 4MS3A 5K0FA 2R7MA 4UUQA 5HUJA 1YVUA 4AN1A 3FMOB 4EEKA 5HBGA 1ZYUA 3MUEA 4ETIA 3PY6A 2YFQA 4YP6A 4MQFA 2W6ID 1O5IA 3A32A 1YE3A 5KTOA 5E7IA 2F9LA 2WYWA 3V1YA 4YQYA 1UC4B 2FXVA 3QK7A 1P7WA 4WK4B 1EBFA 2XXJA 4FQ7A 1XRPA 2I66A 1P4SA 1MAAA 2JEOA 3JQFA 1TJYA 3IOMA 5E9JA 1O1YA 3QF4A 1KC1A 3BDIA 4MVXA 2CUKA 2VDQB 2WM9B 5DBFA 3Q6VA 2JPDA 5AWFC 1E3TA 3GX1A 4F45A 1E2DA 1YJ8A 1W8IA 1ESNA 5GM1A 2RAPA 3FWKA 3QU5A 4WZZA 5EZ5A 4HL1A 4OK5A 4Y6SA 3RYCA 1XFDA 4OHKA 3VDMA 4AULA 1XOIA 1Z6AA 1N2CA 2QWXA 1FP2A 3M6MD 1T0PA 2ZVQX 7YASA 4DJEC 1GUBA 3W1VA 3U16A 3R5JA 1W30A 1WB4A 2CXNA 1J0CA 1IBRA 1EMDA 1KY3A 2WILA 4XVHA 2DYKA 2NO4A 5LM3A 3AB8A 4C0KA 2ZAMA 1JJEA 1GCUA 1LDGA 4O4IA 3ZWBA 1A97A 1CUGA 3BCHA 3MNFA 3E05A 3M9LA 3P0FA 4NYJR 4TLEA 4D0LB 1YDWA 3PT9A 5AW1A 3M6LA 4FXPA 4I6JA 3UK7A 4KN6A 3TW8A 2X23A 1NPDA 5JSQA 4FR7A 3UA3A 3KYDA 1A27A 3L8HA 1AGPA 3I92A 3WA6A 2WV9A 2OENG 1T36B 3C5WP 2QAIA 4UVHA 1ZJWA 3ND8A 1D7OA 3AI2A 1SU4A 2H17A 1TW3A 5TT0A 3UY4A 4FZRA 4DHWA 2FYTA 1H2XA 2LV8A 5AM0A 4FSBA 5CCEA 1A7AA 1VIYA 2ZR0A 1CUJA 1E92A 3OICA 3INGA 2W5UA 4IFIA 2AKEA 4YT8A 1UMKA 3SX2A 3WGIA 1NVAA 1X0VA 3V1NA 1XZFA 1ZGZA 2WJGA 1Q0RA 2Z2IA 2XB2A 4AWZA 1L7OA 1W0JA 5KTYA 2KW5A 2R5WA 2ZXEA 1EUDA 1RCTE 3F1LA 1FDVA 5EZ6B 3LPMA 2H1SA 2WWFA 2X3YA 5AYAA 1Z0SA 2VYVA 4MW1A 3SXUA 4CR8A 3GLIB 2W98A 4NFSA 3TS1A 4FSXA 5K4HA 1N34B 3LXUX 3KCQA 4FIDA 3OH8A 2CXPA 4JP2A 2UYQA 1EVZA 3NBXX 3WRXA 4KITB 4MGZR 3DV9A 1XJCA 1Y81A 2JAUA 1UJ2A 4RM2A 1N9ZA 3PXGA 5KOIA 4LJRA 3RC1A 2ZR7A 2HPVA 3DO6A 3FMIA 3MJRA 4E5UA 1F17A 1GUDA 3WNQA 4CM5A 5CB4A 5I7SA 2Q3EA 3LVFO 4JC8A 2GERA 4QYIB 3NHLA 1LSOA 3IP9A 1TB4A 3OZCA 4LVUA 1DXYA 3IOCA 4OJNA 3GMIA 4OUKX 4D9EA 4E32A 3I15A 5CX1A 1TD1A 2AXNA 3AM3A 3O8QA 4WA7A 1KVUA 3DBVO 1RADA 5FO0A 3USZA 1ACMA 1QSGA 1P3Y1 2AC7A 1E96A 2Z98A 1E4YA 1UFVA 3IIIA 1NQXA 3AC0A 4IG4A 5KYTA 3MWDA 1U28C 4BO5A 4XWTA 1A9PA 2ZRIA 1WPQA 4GR4A 4N8SA 1N2HA 4FFBA 1VSBA 5AI9A 4BMSA 1R4MB 1I32A 3CSUA 1AHNA 4FT2A 3ECSA 3E9NA 2O6HA 2R2GA 3H1FA 3UWKA 2G04A 4AP5A 8OHMA 5IEJA 4OGFA 1AQYA 2A57A 4JH0A 3WLMA 1YU9A 1GPMA 4Z1MA 5FPPA 2DFLA 2RMKA 1Z8HA 3IA2A 4JP8A 3C7KA 1D8TA 1Q22A 4KBFA 1XU7A 2ZTVA 3KKZA 2QT0A 1EFPA 1M2VA 3Q2IA 5SYMA 4AO8A 1KORA 1T13A 3OPYB 4C5AA 2O8BB 3AIOA 5DGCA 4DV4B 1J1ZA 1R0ZA 3QIAA 1N6HA 2I6SA 421PA 2CYBA 3CZRA 3AHCA 1QIKA 1X8JA 3LNTA 4MV1A 4TQUS 5JCOA 4YASA 3H6KA 4M98A 4M6WA 2R8RA 3O3OB 1J2YA 1D0IA 4GRIA 4O1MA 2UZAA 5CW1A 1ZD8A 4M2LA 2R9VA 2HF7A 4BCBA 1VECA 2ZRDA 2MSLA 1PT8A 1RAGA 3IQWA 3A1WA 4MYTA 1TMGE 3EVAA 3Q0IA 3AR3A 5A04A 1N25A 2OA0A 5LM6A 1II9A 1TEXA 3GWZA 3IQGX 5AVKA 1N9GB 1P2VA 2QTGA 5E1BA 5KOJB 1ZU4A 5DU2A 4YP0A 3X2SA 5EFZA 4TV8A 4ALLA 1KZ4A 1RI1A 2P9CA 3OWXA 1NNI1 3AR5A 1GFWA 3N2NA 1IJBA 3D8NA 3EPRA 4EUNA 1OV6A 1IPFA 3NOOA 1JJBA 2AS0A 2XW6A 1QMPA 3ANXA 4ZPJA 4HGNA 3GZ4A 3K9FC 2GNOA 5BUSA 3L8EA 4U1RA 2WG2A 5DE3A 4HYYA 5BT8A 1UKCA 1AKRA 1N6KA 2C5SA 1I3KA 1VI6A 3N75A 2P9EA 3ESXA 4MUFA 4QQRA 5CXXA 4ZD6A 4E5YA 4WDRA 2BEVA 1C30A 4H1TA 4CG1A 5AVZA 2CXXA 4NS1A 4OJTA 2I8CA 4EL0A 3CMMA 4AKSA 1QX4A 4P3PA 4HVLA 2CDRA 4R2WA 5GJCA 4DE5A 5FQCA 4YP7A 4P32A 1LPBB 3T7DA 4FNAA 3HNPA 4EG8A 3GRRA 1E89A 3E3LA 2YXEA 5KC9A 4RZHA 1PWHA 3B1FA 3P2KA 4L5CA 3TSOA 2DERA 2PX6A 4V02A 1XTVA 1PQWA 3WBKA 3F5DA 2F62A 2VDPB 3O6VA 5KDDA 3AYXB 1FSGA 4JD5A 3K92A 2EFYA 3GUYA 5KNBH 1GTSA 4HTFB 3ZZ1A 1P19A 2WHQA 1KYWA 1PV1A 5DLYA 1X77A 2FETA 3T7AA 3QOFA 5ITSA 4LOKA 1WY7A 3TX2A 4PLCA 3T9EA 4RCYA 4I5FA 3EISA 1RSZA 5TMEA 3BRCA 4JN6B 1YDMA 3MAGA 4LHZA 2I80A 3EH1A 3IQDB 2QPOA 3N0WA 4HDRA 3QU9A 4LE6A 1R0KA 2RHDA 3V48A 5SY9A 1I7PA 4AX4A 1E58A 4D98A 1OXVA 4OYYA 2J4CA 2VP0A 1DI0A 1WNFA 4EG3A 1U7HA 2BDTA 3X1DA 2GUGA 2VA8A 4U2GA 1MDBA 1YB4A 2OHFA 4CDNA 1P3DA 4FFMA 3DMPA 4XD7A 4D6PA 4DW8A 1YXMA 3LUPA 4KE8A 1XCMA 2WFLB 3TGWA 1E4EA 2OVFA 2ID9A 2DLCX 1S2IA 4FLEA 1HURA 5K2MA 3TJRA 4D8VA 1R50A 3IAAA 3V80A 4NQ5A 3NHYA 3SHFA 3SVTA 5K3CA 1J42A 4AZ0B 4I9UA 5B64A 2RHGB 2OCKA 3ADCA 1TLLA 2VJNA 4LHWA 3Q3HA 4JFAA 4ZZIA 3R5FA 2ROQA 3BB1A 4N5DA 5I8WA 4G0YA 3N9IA 1W6UA 3FYCA 1XRMA 4ALJA 4WBXC 3GA7A 2CD7A 3L5OA 4NCJA 1MIOB 2GFIA 4F5ZA 2WE7A 2I8AA 3E22B 5EIOA 5L4SA 3HBFA 4HXGA 2JHPA 3CW9A 1GZ4A 2I29A 1A98A 4LTDA 5D5PA 2EEPA 2H2FA 2NV2B 1FNCA 1V3UA 2YFKA 3HFSA 2E18A 3QKUA 3WVNA 3RO7A 1NBMD 1I94B 4JX8A 4M9QA 3CH5A 5FO1A 3PFIA 4JKOA 3R3YA 1Y8CA 3R40A 3WFIA 2PS9A 4UUBA 4RIFA 5BNTA 5IARA 5EYPA 3BV6A 4BO8A 1MAHA 2JCBA 3DV0A 4HF7A 4P83A 4RLFA 4IIGA 2HIHA 3AEKA 3HEMA 3L0PA 4KR0A 4MB0A 4B17A 4C1FA 2IS6A 1G1AA 3FNIA 3WX0A 3ENZA 3NWOA 3AH8A 1JDJA 4UQOA 5CAEB 3UGTA 3ZCPA 3GEMA 1KPIA 1CUUA 3PG5A 3BGIA 4N54A 5THXA 2QJFA 3Q7QA 2DSNA 3QUBA 5GONF 5K0LA 2EP7A 3OIUA 1YRWA 1I2ZA 2XNHA 4QNRA 1SXJE 4E3WA 5CFNA 3KB1A 1KZ6A 3A6KA 2VJAA 3OF2A 3B6JA 3GGGA 4YXFA 1Z63A 2FLWA 4ZYXA 2VPYA 2QVBA 1UT5A 3V4OA 4B4VA 3TMKA 3HM2A 5IPFA 1G64A 1IJKA 1K5PA 1DAKA 3RRYA 1P7VA 1SXIA 2BBSA 4LY0A 3VVLA 4IH9A 3FLBA 3O47A 3KFVA 3U4QA 1E3QA 1U28A 4UBNA 1CNEA 1ZH6A 2WIDA 3O21A 2Q1YA 2F9MA 4REOA 3RYHB 2JLVA 2H7VA 4XGIA 2X8LA 1XALA 2DFNA 4RWZA 2NU8B 2CVFA 3Q6IA 2QRGA 3G2PA 3H87A 4B4WA 3RS7A 4BO3A 3WZMA 5SV2A 2IYZA 4RX1A 1MQ8B 4CFZA 3HCPA 3PHHA 2E4WA 4MV0A 5LIRA 1NTRA 3HMQA 3IESA 3NHUA 5K0GA 1CEQA 4AG5A 1DAFA 1Y3AA 2R6FA 4L5BA 5GJVC 5A4MS 4HGYA 5JYBA 4A8JC 3AO0B 3EXEB 4NNJA 2BYTA 1GL7A 2B3DA 1T2NA 1L5OA 4MQUA 2ODWA 4BBZA 4TKLA 2YINC 3UK2A 1TMKA 3NTRA 3RFFA 3DDSA 3OVMA 4ER7A 1VMIA 4FB5A 3SEFA 1HEYA 4V1CA 2ERCA 4YRFA 2ASVA 1DVRA 1TK3A 1T3TA 4DIOA 1J8VA 1R6XA 2NTJA 2XNKA 3QBVA 4FJ2A 5HQ3B 1TUBA 5HF5A 4DHEA 4OSOA 1RLUA 3QLEA 1ONOA 3QFRA 3TO5A 2DFVA 2Z83A 1NMQA 3DXFA 4UFPA 5ALDA 4KXMA 3NB0A 1W2GA 4Z6XA 2CLMB 1YONA 3T3GA 1WV1A 5LU9A 4FJ0A 4E5SA 1JJTA 3EXFA 2F43B 2HRQA 5HKOA 3NG1A 1E9RA 4GPTA 4CVNA 1U3DA 2ZYIA 2JIPA 2CHQA 3QUAA 4KBGA 4Q18A 3F3SA 4F4CA 3R77A 3B7WA 2ZBPA 3N0VA 3EGCA 2NV0A 1SZDA 1WMEA 4JBGA 4JLDA 4Q4HB 4BX0A 1DO0A 3VKFA 1JZSA 4LRTB 1H85A 2P9BA 3UN1A 4GMFA 5DW0A 1SU6A 1E0SA 3IAFA 2Q5EA 1UEXC 2YXLA 4YJ3F 3W0LB 2PVCA 1T2EA 3CBGA 4L75A 4XWYA 4CIXA 4BYGA 2O54A 3FDIA 4MW7A 1K3UB 4LSGA 1E6KA 4EF4A 1E8MA 4ND5A 4RA9B 3WWEA 3DLTA 3L07A 1J09A 4C04A 3FPSA 4CKXA 2OG1A 5JDIC 1M8KA 1I7SB 1L7BA 2JJ2D 2PJZA 1OTYA 4A3SA 2H2DA 3I6ZA 1PUIA 5K6TA 4FNOA 3DFKA 2JFXA 3WLEA 4HVAA 3JTEA 2HA3A 1RIFA 5KTRA 1U5CA 2XRFA 5JYDA 1L5WA 3E8XA 3H86A 5FPHA 4BLPA 1SD2A 3BS4A 1ZMTA 3OKAA 4MKGA 4Z5XA 3H5TA 2Q4EA 3C8ZA 3NXKA 3HZZA 3PT5A 5U4QA 3DH8A 1GILA 3DFUA 1SVSA 2DZDA 4GECA 5I9IA 2M5DA 4KQKA 3G7NA 2W43A 3WNCA 4EF6A 1VLVA 3O8LA 1OI4A 2WW8A 3MWKA 4Y30A 1OH6A 1HOXA 3HYTA 1NULA 3M4ZA 3PI6A 1H9AA 2IIBA 5FUBA 1DCFA 1KI9A 4PAOA 3S55A 5HIKA 5YASA 2WOJA 3HJGA 4UU1A 2XMGA 4I4TA 5J5AA 3AVOA 1VDMA 5A4DA 1JE1A 4AX1B 1MC1A 4NMXB 4C89A 5KVAA 4Y0AA 4MMZB 3F9OA 1Y9AA 1SOUA 3EQ6A 4OUDB 4UJ5A 4PN7A 4OLBA 2VNIA 3VU1A 1GRCA 1HX7A 5B1DA 1OT5A 3GIDA 3A0UA 1H2FA 1JDVA 2GN6A 4Y2UA 1CERA 4WRRA 4FMDF 3QE4A 4BEBA 1L8OA 3S6JA 3WKEA 2FG5A 4ZKDA 1J90A 3ASUA 5KB3A 1EXMA 4LYHA 3CVWA 1DTWA 2IYOA 4HDSB 2Q3MA 4GUDA 2POCA 1X39A 1GD1O 4HQ6A 2P1RA 4S35A 2ZW9A 2PKWA 3OEWA 3STHA 4YRAA 2RC5A 4DA0A 4Q9LA 1N2CE 5KYUA 2B4RO 3IVMA 4W6ZA 2GRUA 1NJ1A 1LV7A 1PJRA 2E0IA 3AF5A 4TKVB 4AMBA 4F46A 4ZMRA 5KUTA 1QG6A 1XTRA 1DAEA 1YZTA 2VOJA 4KG7A 1VE7A 2Q5IA 1CW2B 2ZATA 4G84A 5E2IA 3T7IA 1I2CA 2BM8A 2H9AA 4K6GA 4RM3A 2JVIA 2OKGA 2JAQA 2FCAA 3GDWA 4RNDB 5THQA 3LBHA 2BP7B 2ADFA 4DLUA 2FFJA 2G6BA 3SEAA 3H9GA 5H7XA 1UWCA 3KAPA 3OM0A 1IONA 2CFTA 3KFLA 4FDMA 5IAGA 5JPIA 1I3OA 2VRBA 3B51X 3DYVA 4HH0A 4RLHA 3I3SR 4F9TA 1GNVA 3RFTA 3PDIB 1XD9A 5CW2A 4B6RA 1XYVA 4BKMA 3W5DA 1WTCA 2VZ0A 1R88A 2WAOA 4WXRA 2ZSEA 4MJ7A 4XQ0A 5ALEA 3ZIUA 2E9SA 4AS2A 4ED9A 2WSYB 4E08A 1MJGM 1R0CA 5TGZA 2ZR9A 4ZOLA 1E61A 4JQCA 1EGHA 2F90A 4XIGS 4GZLA 2IC5A 1M1XB 3GEIA 4KVFA 1T0UA 1H6DA 2GQ0A 2VTKA 2MOKA 1TJ5A 3IO3A 3S28A 4OHUA 4KHZA 3E1SA 1CUZA 5H16A 2PUCA 4PAQA 1IAVA 3IHKA 4IMJB 4P86A 4ZOEA 5ICFA 2O7QA 1PV2A 4L0MA 2A1UA 2GAAA 4FD3A 1GN9A 2AQHA 1DIHA 1YT5A 1KKLA 3LP6A 2O7RA 3GB9A 1P72A 3CMCO 4BV3A 3K96A 4HQLA 1GY8A 1B0PA 3TLXA 1VE1A 4BIIA 3C7TA 3W2HA 3HJUA 5BQ5A 1QHXA 5MGBA 1OBOA 2XMSA 2PU7A 3B6EA 1P5JA 1EU1A 5FWXA 3WGQA 4CLRB 1SVKA 3HN7A 3T15A 1S4MA 1Z73A 2O3SA 1XPUA 2OMEA 1E9CA 4GE0A 3S2ZA 1WBBA 2GT1A 5CFMA 2M5CA 2VNSA 1ZAKA 4IXWA 1XZ8A 3FSRA 2LDBA 2N42A 2QMQA 3LQQA 3A1DA 4MVJF 2BHTA 4AWBA 3O3CA 4Q7JB 1D5CA 1SG6A 4QJ5A 4XIJA 3RVRA 4IGEA 4DZTA 5AXRA 1CY0A 1GVNB 1BOFA 4IWYA 4LAFA 4Q02A 4D8UA 2WD8A 2X0IA 1A5TA 5BVGB 1H8ED 5MN4A 2A9FA 2J7PD 2PSEA 4AYXA 3CO5A 4A8JA 3AP3A 3PEYA 3TSYA 1DX6A 3G2HA 5C8YB 3DO5A 3WLOA 2WDZA 3Q3IA 3U1BA 3KEFA 3RFXA 2V9PA 4RETA 3C48A 5CTJA 4FOSA 4K9RA 3W5JA 5F78A 2FK7A 2GBGA 1SBZA 4DYDA 2AMVA 3F6RA 3TPFA 1JH9A 1AKQA 3PEWA 5SZJA 5EJFA 2P8JA 4AX0B 3OJEA 3I12A 4DLBA 4PSKA 2H1OA 3VMFA 3GDFA 1C4KA 2ZRNA 4NSNA 1U02A 4O4LB 4TRNA 2HIGA 1I30A 3KAKA 3THOA 2KX7A 2X8JA 2C9DA 2ZDGA 4CM4A 1V2HE 2PX4A 4ZVOA 2PG3A 1IRIA 4H3HB 3MRVA 1HDEA 2RD2A 3GMSA 2FPGA 1AUOA 2WEKA 2J3IA 4A5SA 4KUHA 2YIDA 2BVNA 3ML1A 4BFCA 2E4VA 3CLSC 3I1FA 3LC0A 3W3AH 3WE7A 1QBKC 2REXB 1DC6A 3K5PA 1CZNA 3TQCA 1OXMA 3KNRA 5A0VA 4D3DA 3K0FA 3IVXA 4IO1A 4DMCA 2EKBA 4KB5A 1OAAA 2DUUA 3AOGA 3I9JA 4WKNA 5EIBC 4X1KA 3VH1A 4IHKA 3TKAA 4BKQA 4F72A 2PXAA 4RMNA 3HABA 3D3KA 1Y3DE 1P4JA 4MR9B 4ZI7F 2Z6AA 4BNDB 1Q11A 5KWEA 1VIMA 3G7SA 4GOJA 4QODA 2ECPA 2I2FA 1R6AA 2NUPB 2P30A 3ZC3A 5IK2A 4MNTA 5T3UA 4GDFA 1R9GA 1FJ2A 1T2CA 3V8QA 2KB0A 1J8YF 1YU6A 3MB8A 4JGGA 1DQRA 1ZI6A 1XCBA 4F4JA 3PLAE 1SRRA 4ZC8A 1BVHA 4H2DA 1ZI8A 4N3CA 5D87A 3E9EA 1DEKA 1UPFA 1L6IA 5JSUA 1MEOA 1U90A 4P3KA 3KT6A 3OHSX 3VSBA 5CB6A 2UYXA 2I9PA 2BMAA 3BKXA 4TXLA 1BHJA 1CHNA 4JT8A 3REQB 2RG7A 3LVBA 1Z37A 3R5KA 3TTUA 4TKMA 1YACA 1RI5A 1RLOA 3EZ7A 3Q1KA 3R4CA 1TZJA 2WJJA 3HJRA 2D5IA 2JLUA 4MA0A 4DCTA 2Y1OA 2GYWA 4NBRA 2ATIA 3D7KA 1NYQA 4OFZA 2JHAA 4KSYA 4XWWA 2BFZB 1AY0A 4RKRA 2VP2A 2ZYHA 5FFMA 1UBNA 5LYJA 2VH2A 4MUAA 3SQDA 3TQTA 5KTNA 2A2ZA 1P2DA 1JT2A 3N7TA 3ROTA 5T64A 4DC0A 4MRPA 2XQKA 1FLDA 1G2PA 1V26A 2RARA 4BJ1A 4EJSB 1AK2A 1FP4A 5CT4A 5A9RA 5JC8A 1XNGA 3M6VA 3G2IA 3VC2A 4EYOA 2P4HX 4ERXA 4L4ZA 4KQFA 1T4CB 1MIHA 3KR9A 3VPGA 2XT9A 3CPSA 2B7CA 4QTUB 3T41A 1H1TA 4QOHA 3CR7A 5JJ5A 4PLZA 1OFGA 4B8WA 2G82A 1SA0B 4RZQA 5I5GA 3Q2OA 3D7SA 1MX3A 3K31A 2IZ0A 3PWKA 5JAMA 4HZIA 3GH1A 5HDQA 3M3DA 1E3WA 2OB1A 3A14A 5JYEA 3FZQA 3IDAA 3QRWA 3KK0A 1K7CA 3UT6A 2FUKA 4NONA 1CWUA 4ODIA 1XKLA 5JASA 4JO0A 3TZCA 3PUZA 3T3NA 4RHEA 5GGYA 1U8EA 3QVMA 3U7QA 4AUEA 5JNVA 1DXQA 2HLDD 2WSMA 4NATA 4P4GA 1A7TA 1U3GA 4ETWA 3RSLA 2GAOA 1SBNE 2C94A 1QFXA 1XCLA 3PDJA 1JDSA 2Q4BA 5AKXA 1LJ8A 1FP1D 1AT1A 3BL6A 5CYOA 3DLAA 1Q57A 1C9DB 5J4LA 2HDHA 2IW1A 4FDUA 2VQFB