2P18A

Crystal structure of the leishmania infantum glyoxalase ii
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
293
structure length
283
Chain Sequence
MRNYCTKTFGSAFSVTVVPTLKDNFSYLINDHTTHTLAAVDVNADYKPILTYIEEHLTYTFSTILSTHKHWDHSGGNAKLKAELEAMNVPVVVVGGANDSIPAVTKPVREGDRVQVGDLSVEVIDAPCHTRGHVLYKVQHPQHPNDGVALFTGDTMFIAGIGAFFEGDEKDMCRAMEKVYHIHKGNDYALDKVTFIFPGHEYTSGFMTFSEKTFPDRASDDLAFIQAQRAKYAAAVKTGDPSVPSSLAEEKRQNLFLRVADPAFVAKMNQGNAHALMMYLYNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Glyoxalase II
publication title Catalysis and Structural Properties of Leishmania infantum Glyoxalase II: Trypanothione Specificity and Phylogeny.
pubmed doi rcsb
source organism Leishmania infantum
total genus 105
structure length 283
sequence length 293
ec nomenclature ec 3.1.2.6: Hydroxyacylglutathione hydrolase.
pdb deposition date 2007-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16123 HAGH_C Hydroxyacylglutathione hydrolase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2p18A00
4NQ4A 2CBNA 3JXPA 3ADRA 3BC2A 2FM6A 5EVKA 3DHAA 4ZO2A 3R2UA 1WUPA 2OHHA 4D1TA 2YNTA 3KNRA 4D02A 4LE6A 3IE2A 4RM5A 5ACPA 2FU7A 1JJTA 3IEKA 4EXYA 3KL7A 3PG4A 4EXSA 1Y44A 3DHCA 4GCWA 1WRAA 3F9OA 2OHIA 1BC2A 4XWTA 5HISA 2YNWA 1BMCA 3ESHA 2ZO4A 2DOOA 4EY2A 5EVDA 4UWSB 2XF4A 2BR6A 2QJSA 4UWPB 4H0DA 4BZ3A 4GYUA 5LSCA 1P9EA 4AWZA 1A8TA 4JO0A 1VJNA 3BV6A 4KEPA 2WRSA 3PY5A 5LLDA 4DILA 5LM6A 2YCBA 2AZ4A 3ZNBA 2BTNA 5FQCA 4YSLA 4PVOA 5FQBA 2P18A 2QDTA 5HH6A 3T3NA 4EYBA 2M5CA 4C1EA 1ZNBA 2Y87A 4CHLA 4EFZA 4UBQA 1XM8A 1MQOA 3IELA 4U4LA 2FU6A 3ZR9A 4TZFA 4V0HA 4TZ9A 4D1UA 1WW1A 5ACQA 2I7TA 3IOFA 5K0WA 4C1GA 2XR1A 3P2UA 1YCGA 1A7TA 2QEDA 5EH9A 4Z7RA 4ZEJA 4HL1A 4TYFA 5LCHA 1M2XA 1DXKA 3SRXA 2BFZA 4F6ZA 5A0TA 1X8HA 1WUOA 3T9MA 3X2ZA 4AX0B 4HKYA 3IOGA 2R2DA 1XTOA 3IE1A 3RKJA 4AD9A 3IDZA 4NQ5A 5EW0A 2GCUA 4DIKA 2I7VA 3I15A 5ACWA 2HB9A 1DD6A 4WD6A 3X30A 4RAWA 2WYLA 1HLKA 2I7XA 1VGNA 5IQKA 1VMEA 3ZWFA 4C1FA 4P62A 2ZNBA 3AJ3A 4C09A 2P97A 3DH8A 3SD9A 2BC2A 3L6NA 2BG2A 1YCFA 1KO3A 2GFJA 5B15A 1E5DA 3VQZA 5EHTA 1JJEA 3AF6A 5AHOA 3Q6VA 1X8GA 4O98A 5LE1A 3X2XA 2BIBA 3WXCA 2FK6A 3LVZA 5AHRA 3SPUA 3QH8A 4EYFA 3FCZA 2BMIA 4UA4A 5ACSA 1JT1A 5AEBA 4C1DA 5DPXA 1DDKA 3SFPA 3RPCA 3I0VA 5LS3A 5EWAA 5HH4A 3A4YA 2FHXB 4FEKA 2P4ZA 5ACUA 2YNVB 1SMLA 2ZZIA 2Y8AA 2YNTB 1YCHA 2BFKA 4PVTA 3I14A 1KO2A 2P1EA 4AX1B 3FAIA 3DHBA 2BG8B 2BFLA 1X8IA 4KEQA 4UAMA 5ACRA 1BVTA 2Q9UA 5EV8A 2DKFA 5FQAA 4TZEA 4NQ2A 2WYMA 3AF5A 5HH5A 2Y8BA 3SBLA 5KILA 4XWWA 4RBSA 2OHJA 2ZWRA 4RL2A 3PY6A 1L9YA 3TP9A 5HIQA 4B87A 3IE0A 2WYMC 4Z5ZA 2VW8A 5AXRA 4Z60A 4FR7A 1KR3A 2BGAA 2FHXA 2NZFA 2YNVA 4AWYB 5A87A 3MD7A 2E7YA 5B3RA 4C1CA 3I13A 3BK1A 3SW3A 4C1HA 4ZNBA 4TYTA 5AYAA 3RKKA 3ZQ4A 5LMCA 4BP0A 2WHGA 1QH3A 2BG8A 4F6HA 4TZBA 2GKLA 5AXOA 3T3OA 4Z5YA 2UYXA 2YZ3A 4FSBA 5A0VA 5LCFA 1QH5A 4EYLA 5K4NA 2M5DA 4YSBA 2GFKA 5B1UA 3S0ZA 2GMNA 3G1PA 5K4MA 5K4KA 1ZTCA 3H3EA 4D1WA 4RL0A 2Q0IA 2H6AA 4J5FA 5ACVA 3BK2A 2Q0JA 2QINA 3X2YA 2BG6A 2NXAA 5A5ZA 4Z6XA 4HL2A 5LCAA 1K07A 1ZKPA 4J5HA 5ACTA 5KIKA 3IEMA 4GYQA 4NQ6A 2BFZB 2FU9A 4RAMA 2BG7A 3KNSA 5HIPA 5EVBA 2NZEA 5EV6A 2NYPA 4XUKA 3I11A 2AIOA 5ACXA 2QDSA 2YNUA 5HIOA 4Z67A 4ZO3A 2FU8A 4UWOB 2A7MA 4D1VA 2Q42A 4UWRB 4YSKA 3VPEA
chains in the Genus database with same CATH superfamily
4NQ4A 2CBNA 3JXPA 3ADRA 3BC2A 2FM6A 5EVKA 3DHAA 4ZO2A 3R2UA 1WUPA 2OHHA 4D1TA 2YNTA 3KNRA 4D02A 4LE6A 3IE2A 4RM5A 5ACPA 2FU7A 1JJTA 3IEKA 4EXYA 5AIJA 3KL7A 3PG4A 4EXSA 5A23A 1Y44A 3DHCA 4GCWA 1WRAA 3F9OA 2CG2A 2CG3A 2OHIA 1BC2A 4XWTA 5HISA 2YNWA 1BMCA 3ESHA 2ZO4A 2DOOA 4EY2A 5EVDA 4UWSB 2XF4A 2BR6A 2QJSA 4UWPB 4H0DA 4BZ3A 4GYUA 5LSCA 1P9EA 4AWZA 1A8TA 4JO0A 1VJNA 3BV6A 4KEPA 2WRSA 3PY5A 5LLDA 4DILA 5LM6A 2YCBA 5AJLA 2AZ4A 3ZNBA 2BTNA 5FQCA 4YSLA 4PVOA 5FQBA 2P18A 2QDTA 5HH6A 3T3NA 4EYBA 2M5CA 4C1EA 1ZNBA 2Y87A 4CHLA 4EFZA 4AV7A 4UBQA 1XM8A 1MQOA 3IELA 4U4LA 2FU6A 3ZR9A 4TZFA 4V0HA 4TZ9A 4D1UA 1WW1A 5ACQA 2I7TA 3IOFA 5K0WA 4C1GA 2XR1A 2CFUA 3P2UA 1YCGA 1A7TA 2QEDA 5EH9A 4Z7RA 4ZEJA 4HL1A 4TYFA 5LCHA 1M2XA 1DXKA 3SRXA 2BFZA 4F6ZA 5A0TA 1X8HA 1WUOA 3T9MA 3X2ZA 4AX0B 4HKYA 3IOGA 2R2DA 1XTOA 3IE1A 3RKJA 4AD9A 3IDZA 4NQ5A 5EW0A 2GCUA 2YHEA 4DIKA 2I7VA 3I15A 5ACWA 2HB9A 1DD6A 4WD6A 3X30A 4RAWA 2WYLA 1HLKA 2I7XA 1VGNA 5IQKA 1VMEA 3ZWFA 4C1FA 4P62A 4AXHA 2ZNBA 2CFZA 3AJ3A 4C09A 2P97A 3DH8A 3SD9A 2BC2A 3L6NA 2BG2A 1YCFA 1KO3A 2GFJA 5B15A 1E5DA 3VQZA 5EHTA 1JJEA 3AF6A 5AHOA 3Q6VA 1X8GA 4O98A 5LE1A 3X2XA 2BIBA 3WXCA 2FK6A 3LVZA 5AHRA 3SPUA 3QH8A 4EYFA 3FCZA 2BMIA 4UA4A 5ACSA 1JT1A 5AEBA 4C1DA 5DPXA 1DDKA 3SFPA 3RPCA 3I0VA 5LS3A 5EWAA 5HH4A 3A4YA 2FHXB 4FEKA 2P4ZA 5ACUA 2YNVB 1SMLA 2ZZIA 2Y8AA 2YNTB 1YCHA 2BFKA 4PVTA 3I14A 1KO2A 2P1EA 4AX1B 3FAIA 3DHBA 2BG8B 2BFLA 1X8IA 4KEQA 4UAMA 5ACRA 1BVTA 2Q9UA 5EV8A 2DKFA 4PDXA 4TZEA 5FQAA 4NQ2A 2WYMA 3AF5A 5HH5A 2Y8BA 3SBLA 5KILA 4XWWA 4RBSA 2OHJA 2ZWRA 4RL2A 3PY6A 1L9YA 3TP9A 5HIQA 4B87A 3IE0A 2WYMC 4Z5ZA 2VW8A 5AXRA 4Z60A 4FR7A 1KR3A 2BGAA 2FHXA 2NZFA 2YNVA 4AWYB 5A87A 3MD7A 2E7YA 5B3RA 4C1CA 3I13A 4NURA 3BK1A 3SW3A 4C1HA 4ZNBA 4TYTA 5AYAA 3RKKA 3ZQ4A 5LMCA 4BP0A 2WHGA 1QH3A 2BG8A 4F6HA 4TZBA 2GKLA 5AXOA 3T3OA 4Z5YA 2UYXA 2YZ3A 4FSBA 5A0VA 5LCFA 1QH5A 4EYLA 5K4NA 2M5DA 4YSBA 2GFKA 5B1UA 3S0ZA 2GMNA 3G1PA 5K4MA 5K4KA 1ZTCA 3H3EA 4D1WA 4RL0A 2Q0IA 2H6AA 4J5FA 5ACVA 3BK2A 2Q0JA 2QINA 3X2YA 2BG6A 2NXAA 5A5ZA 4Z6XA 4HL2A 5LCAA 1K07A 1ZKPA 4J5HA 5ACTA 5KIKA 3IEMA 4GYQA 4NQ6A 2BFZB 2FU9A 4RAMA 2BG7A 3KNSA 5HIPA 5EVBA 2NZEA 5EV6A 2NYPA 4XUKA 3I11A 2AIOA 5ACXA 2QDSA 2YNUA 5HIOA 4Z67A 4ZO3A 2FU8A 4UWOB 2A7MA 4D1VA 2Q42A 4UWRB 4YSKA 3VPEA
chains in the Genus database with same CATH topology
4NQ4A 2CBNA 3JXPA 3ADRA 3BC2A 2FM6A 5EVKA 3DHAA 4ZO2A 3R2UA 1WUPA 2OHHA 4D1TA 2YNTA 3KNRA 4D02A 4LE6A 3IE2A 4RM5A 5ACPA 2FU7A 1JJTA 3IEKA 4EXYA 3KL7A 3PG4A 4EXSA 1Y44A 3DHCA 4GCWA 1WRAA 3F9OA 2OHIA 1BC2A 4XWTA 5HISA 2YNWA 1BMCA 3ESHA 2ZO4A 2DOOA 4EY2A 5EVDA 4UWSB 2XF4A 2BR6A 2QJSA 4UWPB 4H0DA 4BZ3A 4GYUA 5LSCA 1P9EA 4AWZA 1A8TA 4JO0A 1VJNA 3BV6A 4KEPA 2WRSA 3PY5A 5LLDA 4DILA 5LM6A 2YCBA 2AZ4A 3ZNBA 2BTNA 5FQCA 4YSLA 4PVOA 5FQBA 2P18A 2QDTA 5HH6A 3T3NA 4EYBA 2M5CA 4C1EA 1ZNBA 2Y87A 4CHLA 4EFZA 4UBQA 1XM8A 1MQOA 3IELA 4U4LA 2FU6A 3ZR9A 4TZFA 4V0HA 4TZ9A 4D1UA 1WW1A 5ACQA 2I7TA 3IOFA 5K0WA 4C1GA 2XR1A 3P2UA 1YCGA 1A7TA 2QEDA 5EH9A 4Z7RA 4ZEJA 4HL1A 4TYFA 5LCHA 1M2XA 1DXKA 3SRXA 2BFZA 4F6ZA 5A0TA 1X8HA 1WUOA 3T9MA 3X2ZA 4AX0B 4HKYA 3IOGA 2R2DA 1XTOA 3IE1A 3RKJA 4AD9A 3IDZA 4NQ5A 5EW0A 2GCUA 4DIKA 2I7VA 3I15A 5ACWA 2HB9A 1DD6A 4WD6A 3X30A 4RAWA 2WYLA 1HLKA 2I7XA 1VGNA 5IQKA 1VMEA 3ZWFA 4C1FA 4P62A 2ZNBA 3AJ3A 4C09A 2P97A 3DH8A 3SD9A 2BC2A 3L6NA 2BG2A 1YCFA 1KO3A 2GFJA 5B15A 1E5DA 3VQZA 5EHTA 1JJEA 3AF6A 5AHOA 3Q6VA 1X8GA 4O98A 5LE1A 3X2XA 2BIBA 3WXCA 2FK6A 3LVZA 5AHRA 3SPUA 3QH8A 4EYFA 3FCZA 2BMIA 4UA4A 5ACSA 1JT1A 5AEBA 4C1DA 5DPXA 1DDKA 3SFPA 3RPCA 3I0VA 5LS3A 5EWAA 5HH4A 3A4YA 2FHXB 4FEKA 2P4ZA 5ACUA 2YNVB 1SMLA 2ZZIA 2Y8AA 2YNTB 1YCHA 2BFKA 4PVTA 3I14A 1KO2A 2P1EA 4AX1B 3FAIA 3DHBA 2BG8B 2BFLA 1X8IA 4KEQA 4UAMA 5ACRA 1BVTA 2Q9UA 5EV8A 2DKFA 5FQAA 4TZEA 4NQ2A 2WYMA 3AF5A 5HH5A 2Y8BA 3SBLA 5KILA 4XWWA 4RBSA 2OHJA 2ZWRA 4RL2A 3PY6A 1L9YA 3TP9A 5HIQA 4B87A 3IE0A 2WYMC 4Z5ZA 2VW8A 5AXRA 4Z60A 4FR7A 1KR3A 2BGAA 2FHXA 2NZFA 2YNVA 4AWYB 5A87A 3MD7A 2E7YA 5B3RA 4C1CA 3I13A 3BK1A 3SW3A 4C1HA 4ZNBA 4TYTA 5AYAA 3RKKA 3ZQ4A 5LMCA 4BP0A 2WHGA 1QH3A 2BG8A 4F6HA 4TZBA 2GKLA 5AXOA 3T3OA 4Z5YA 2UYXA 2YZ3A 4FSBA 5A0VA 5LCFA 1QH5A 4EYLA 5K4NA 2M5DA 4YSBA 2GFKA 5B1UA 3S0ZA 2GMNA 3G1PA 5K4MA 5K4KA 1ZTCA 3H3EA 4D1WA 4RL0A 2Q0IA 2H6AA 4J5FA 5ACVA 3BK2A 2Q0JA 2QINA 3X2YA 2BG6A 2NXAA 5A5ZA 4Z6XA 4HL2A 5LCAA 1K07A 1ZKPA 4J5HA 5ACTA 5KIKA 3IEMA 4GYQA 4NQ6A 2BFZB 2FU9A 4RAMA 2BG7A 3KNSA 5HIPA 5EVBA 2NZEA 5EV6A 2NYPA 4XUKA 3I11A 2AIOA 5ACXA 2QDSA 2YNUA 5HIOA 4Z67A 4ZO3A 2FU8A 4UWOB 2A7MA 4D1VA 2Q42A 4UWRB 4YSKA 3VPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NQ4 A;  2CBN A;  3JXP A;  3ADR A;  3BC2 A;  2FM6 A;  5EVK A;  3DHA A;  4ZO2 A;  3R2U A;  1WUP A;  2OHH A;  4D1T A;  2YNT A;  3KNR A;  4D02 A;  4LE6 A;  3IE2 A;  4RM5 A;  5ACP A;  2FU7 A;  1JJT A;  3IEK A;  4EXY A;  3KL7 A;  3PG4 A;  4EXS A;  1Y44 A;  3DHC A;  4GCW A;  1WRA A;  3F9O A;  2OHI A;  1BC2 A;  4XWT A;  5HIS A;  2YNW A;  1BMC A;  3ESH A;  2ZO4 A;  2DOO A;  4EY2 A;  5EVD A;  4UWS B;  2XF4 A;  2BR6 A;  2QJS A;  4UWP B;  4H0D A;  4BZ3 A;  4GYU A;  5LSC A;  1P9E A;  4AWZ A;  1A8T A;  4JO0 A;  1VJN A;  3BV6 A;  4KEP A;  2WRS A;  3PY5 A;  5LLD A;  4DIL A;  5LM6 A;  2YCB A;  2AZ4 A;  3ZNB A;  2BTN A;  5FQC A;  4YSL A;  4PVO A;  5FQB A;  2P18 A;  2QDT A;  5HH6 A;  3T3N A;  4EYB A;  2M5C A;  4C1E A;  1ZNB A;  2Y87 A;  4CHL A;  4EFZ A;  4UBQ A;  1XM8 A;  1MQO A;  3IEL A;  4U4L A;  2FU6 A;  3ZR9 A;  4TZF A;  4V0H A;  4TZ9 A;  4D1U A;  1WW1 A;  5ACQ A;  2I7T A;  3IOF A;  5K0W A;  4C1G A;  2XR1 A;  3P2U A;  1YCG A;  1A7T A;  2QED A;  5EH9 A;  4Z7R A;  4ZEJ A;  4HL1 A;  4TYF A;  5LCH A;  1M2X A;  1DXK A;  3SRX A;  2BFZ A;  4F6Z A;  5A0T A;  1X8H A;  1WUO A;  3T9M A;  3X2Z A;  4AX0 B;  4HKY A;  3IOG A;  2R2D A;  1XTO A;  3IE1 A;  3RKJ A;  4AD9 A;  3IDZ A;  4NQ5 A;  5EW0 A;  2GCU A;  4DIK A;  2I7V A;  3I15 A;  5ACW A;  2HB9 A;  1DD6 A;  4WD6 A;  3X30 A;  4RAW A;  2WYL A;  1HLK A;  2I7X A;  1VGN A;  5IQK A;  1VME A;  3ZWF A;  4C1F A;  4P62 A;  2ZNB A;  3AJ3 A;  4C09 A;  2P97 A;  3DH8 A;  3SD9 A;  2BC2 A;  3L6N A;  2BG2 A;  1YCF A;  1KO3 A;  2GFJ A;  5B15 A;  1E5D A;  3VQZ A;  5EHT A;  1JJE A;  3AF6 A;  5AHO A;  3Q6V A;  1X8G A;  4O98 A;  5LE1 A;  3X2X A;  2BIB A;  3WXC A;  2FK6 A;  3LVZ A;  5AHR A;  3SPU A;  3QH8 A;  4EYF A;  3FCZ A;  2BMI A;  4UA4 A;  5ACS A;  1JT1 A;  5AEB A;  4C1D A;  5DPX A;  1DDK A;  3SFP A;  3RPC A;  3I0V A;  5LS3 A;  5EWA A;  5HH4 A;  3A4Y A;  2FHX B;  4FEK A;  2P4Z A;  5ACU A;  2YNV B;  1SML A;  2ZZI A;  2Y8A A;  2YNT B;  1YCH A;  2BFK A;  4PVT A;  3I14 A;  1KO2 A;  2P1E A;  4AX1 B;  3FAI A;  3DHB A;  2BG8 B;  2BFL A;  1X8I A;  4KEQ A;  4UAM A;  5ACR A;  1BVT A;  2Q9U A;  5EV8 A;  2DKF A;  5FQA A;  4TZE A;  4NQ2 A;  2WYM A;  3AF5 A;  5HH5 A;  2Y8B A;  3SBL A;  5KIL A;  4XWW A;  4RBS A;  2OHJ A;  2ZWR A;  4RL2 A;  3PY6 A;  1L9Y A;  3TP9 A;  5HIQ A;  4B87 A;  3IE0 A;  2WYM C;  4Z5Z A;  2VW8 A;  5AXR A;  4Z60 A;  4FR7 A;  1KR3 A;  2BGA A;  2FHX A;  2NZF A;  2YNV A;  4AWY B;  5A87 A;  3MD7 A;  2E7Y A;  5B3R A;  4C1C A;  3I13 A;  3BK1 A;  3SW3 A;  4C1H A;  4ZNB A;  4TYT A;  5AYA A;  3RKK A;  3ZQ4 A;  5LMC A;  4BP0 A;  2WHG A;  1QH3 A;  2BG8 A;  4F6H A;  4TZB A;  2GKL A;  5AXO A;  3T3O A;  4Z5Y A;  2UYX A;  2YZ3 A;  4FSB A;  5A0V A;  5LCF A;  1QH5 A;  4EYL A;  5K4N A;  2M5D A;  4YSB A;  2GFK A;  5B1U A;  3S0Z A;  2GMN A;  3G1P A;  5K4M A;  5K4K A;  1ZTC A;  3H3E A;  4D1W A;  4RL0 A;  2Q0I A;  2H6A A;  4J5F A;  5ACV A;  3BK2 A;  2Q0J A;  2QIN A;  3X2Y A;  2BG6 A;  2NXA A;  5A5Z A;  4Z6X A;  4HL2 A;  5LCA A;  1K07 A;  1ZKP A;  4J5H A;  5ACT A;  5KIK A;  3IEM A;  4GYQ A;  4NQ6 A;  2BFZ B;  2FU9 A;  4RAM A;  2BG7 A;  3KNS A;  5HIP A;  5EVB A;  2NZE A;  5EV6 A;  2NYP A;  4XUK A;  3I11 A;  2AIO A;  5ACX A;  2QDS A;  2YNU A;  5HIO A;  4Z67 A;  4ZO3 A;  2FU8 A;  4UWO B;  2A7M A;  4D1V A;  2Q42 A;  4UWR B;  4YSK A;  3VPE A; 
#chains in the Genus database with same CATH topology
 4NQ4 A;  2CBN A;  3JXP A;  3ADR A;  3BC2 A;  2FM6 A;  5EVK A;  3DHA A;  4ZO2 A;  3R2U A;  1WUP A;  2OHH A;  4D1T A;  2YNT A;  3KNR A;  4D02 A;  4LE6 A;  3IE2 A;  4RM5 A;  5ACP A;  2FU7 A;  1JJT A;  3IEK A;  4EXY A;  5AIJ A;  3KL7 A;  3PG4 A;  4EXS A;  5A23 A;  1Y44 A;  3DHC A;  4GCW A;  1WRA A;  3F9O A;  2CG2 A;  2CG3 A;  2OHI A;  1BC2 A;  4XWT A;  5HIS A;  2YNW A;  1BMC A;  3ESH A;  2ZO4 A;  2DOO A;  4EY2 A;  5EVD A;  4UWS B;  2XF4 A;  2BR6 A;  2QJS A;  4UWP B;  4H0D A;  4BZ3 A;  4GYU A;  5LSC A;  1P9E A;  4AWZ A;  1A8T A;  4JO0 A;  1VJN A;  3BV6 A;  4KEP A;  2WRS A;  3PY5 A;  5LLD A;  4DIL A;  5LM6 A;  2YCB A;  5AJL A;  2AZ4 A;  3ZNB A;  2BTN A;  5FQC A;  4YSL A;  4PVO A;  5FQB A;  2P18 A;  2QDT A;  5HH6 A;  3T3N A;  4EYB A;  2M5C A;  4C1E A;  1ZNB A;  2Y87 A;  4CHL A;  4EFZ A;  4AV7 A;  4UBQ A;  1XM8 A;  1MQO A;  3IEL A;  4U4L A;  2FU6 A;  3ZR9 A;  4TZF A;  4V0H A;  4TZ9 A;  4D1U A;  1WW1 A;  5ACQ A;  2I7T A;  3IOF A;  5K0W A;  4C1G A;  2XR1 A;  2CFU A;  3P2U A;  1YCG A;  1A7T A;  2QED A;  5EH9 A;  4Z7R A;  4ZEJ A;  4HL1 A;  4TYF A;  5LCH A;  1M2X A;  1DXK A;  3SRX A;  2BFZ A;  4F6Z A;  5A0T A;  1X8H A;  1WUO A;  3T9M A;  3X2Z A;  4AX0 B;  4HKY A;  3IOG A;  2R2D A;  1XTO A;  3IE1 A;  3RKJ A;  4AD9 A;  3IDZ A;  4NQ5 A;  5EW0 A;  2GCU A;  2YHE A;  4DIK A;  2I7V A;  3I15 A;  5ACW A;  2HB9 A;  1DD6 A;  4WD6 A;  3X30 A;  4RAW A;  2WYL A;  1HLK A;  2I7X A;  1VGN A;  5IQK A;  1VME A;  3ZWF A;  4C1F A;  4P62 A;  4AXH A;  2ZNB A;  2CFZ A;  3AJ3 A;  4C09 A;  2P97 A;  3DH8 A;  3SD9 A;  2BC2 A;  3L6N A;  2BG2 A;  1YCF A;  1KO3 A;  2GFJ A;  5B15 A;  1E5D A;  3VQZ A;  5EHT A;  1JJE A;  3AF6 A;  5AHO A;  3Q6V A;  1X8G A;  4O98 A;  5LE1 A;  3X2X A;  2BIB A;  3WXC A;  2FK6 A;  3LVZ A;  5AHR A;  3SPU A;  3QH8 A;  4EYF A;  3FCZ A;  2BMI A;  4UA4 A;  5ACS A;  1JT1 A;  5AEB A;  4C1D A;  5DPX A;  1DDK A;  3SFP A;  3RPC A;  3I0V A;  5LS3 A;  5EWA A;  5HH4 A;  3A4Y A;  2FHX B;  4FEK A;  2P4Z A;  5ACU A;  2YNV B;  1SML A;  2ZZI A;  2Y8A A;  2YNT B;  1YCH A;  2BFK A;  4PVT A;  3I14 A;  1KO2 A;  2P1E A;  4AX1 B;  3FAI A;  3DHB A;  2BG8 B;  2BFL A;  1X8I A;  4KEQ A;  4UAM A;  5ACR A;  1BVT A;  2Q9U A;  5EV8 A;  2DKF A;  4PDX A;  4TZE A;  5FQA A;  4NQ2 A;  2WYM A;  3AF5 A;  5HH5 A;  2Y8B A;  3SBL A;  5KIL A;  4XWW A;  4RBS A;  2OHJ A;  2ZWR A;  4RL2 A;  3PY6 A;  1L9Y A;  3TP9 A;  5HIQ A;  4B87 A;  3IE0 A;  2WYM C;  4Z5Z A;  2VW8 A;  5AXR A;  4Z60 A;  4FR7 A;  1KR3 A;  2BGA A;  2FHX A;  2NZF A;  2YNV A;  4AWY B;  5A87 A;  3MD7 A;  2E7Y A;  5B3R A;  4C1C A;  3I13 A;  4NUR A;  3BK1 A;  3SW3 A;  4C1H A;  4ZNB A;  4TYT A;  5AYA A;  3RKK A;  3ZQ4 A;  5LMC A;  4BP0 A;  2WHG A;  1QH3 A;  2BG8 A;  4F6H A;  4TZB A;  2GKL A;  5AXO A;  3T3O A;  4Z5Y A;  2UYX A;  2YZ3 A;  4FSB A;  5A0V A;  5LCF A;  1QH5 A;  4EYL A;  5K4N A;  2M5D A;  4YSB A;  2GFK A;  5B1U A;  3S0Z A;  2GMN A;  3G1P A;  5K4M A;  5K4K A;  1ZTC A;  3H3E A;  4D1W A;  4RL0 A;  2Q0I A;  2H6A A;  4J5F A;  5ACV A;  3BK2 A;  2Q0J A;  2QIN A;  3X2Y A;  2BG6 A;  2NXA A;  5A5Z A;  4Z6X A;  4HL2 A;  5LCA A;  1K07 A;  1ZKP A;  4J5H A;  5ACT A;  5KIK A;  3IEM A;  4GYQ A;  4NQ6 A;  2BFZ B;  2FU9 A;  4RAM A;  2BG7 A;  3KNS A;  5HIP A;  5EVB A;  2NZE A;  5EV6 A;  2NYP A;  4XUK A;  3I11 A;  2AIO A;  5ACX A;  2QDS A;  2YNU A;  5HIO A;  4Z67 A;  4ZO3 A;  2FU8 A;  4UWO B;  2A7M A;  4D1V A;  2Q42 A;  4UWR B;  4YSK A;  3VPE A; 
#chains in the Genus database with same CATH homology
 4NQ4 A;  2CBN A;  3JXP A;  3ADR A;  3BC2 A;  2FM6 A;  5EVK A;  3DHA A;  4ZO2 A;  3R2U A;  1WUP A;  2OHH A;  4D1T A;  2YNT A;  3KNR A;  4D02 A;  4LE6 A;  3IE2 A;  4RM5 A;  5ACP A;  2FU7 A;  1JJT A;  3IEK A;  4EXY A;  3KL7 A;  3PG4 A;  4EXS A;  1Y44 A;  3DHC A;  4GCW A;  1WRA A;  3F9O A;  2OHI A;  1BC2 A;  4XWT A;  5HIS A;  2YNW A;  1BMC A;  3ESH A;  2ZO4 A;  2DOO A;  4EY2 A;  5EVD A;  4UWS B;  2XF4 A;  2BR6 A;  2QJS A;  4UWP B;  4H0D A;  4BZ3 A;  4GYU A;  5LSC A;  1P9E A;  4AWZ A;  1A8T A;  4JO0 A;  1VJN A;  3BV6 A;  4KEP A;  2WRS A;  3PY5 A;  5LLD A;  4DIL A;  5LM6 A;  2YCB A;  2AZ4 A;  3ZNB A;  2BTN A;  5FQC A;  4YSL A;  4PVO A;  5FQB A;  2P18 A;  2QDT A;  5HH6 A;  3T3N A;  4EYB A;  2M5C A;  4C1E A;  1ZNB A;  2Y87 A;  4CHL A;  4EFZ A;  4UBQ A;  1XM8 A;  1MQO A;  3IEL A;  4U4L A;  2FU6 A;  3ZR9 A;  4TZF A;  4V0H A;  4TZ9 A;  4D1U A;  1WW1 A;  5ACQ A;  2I7T A;  3IOF A;  5K0W A;  4C1G A;  2XR1 A;  3P2U A;  1YCG A;  1A7T A;  2QED A;  5EH9 A;  4Z7R A;  4ZEJ A;  4HL1 A;  4TYF A;  5LCH A;  1M2X A;  1DXK A;  3SRX A;  2BFZ A;  4F6Z A;  5A0T A;  1X8H A;  1WUO A;  3T9M A;  3X2Z A;  4AX0 B;  4HKY A;  3IOG A;  2R2D A;  1XTO A;  3IE1 A;  3RKJ A;  4AD9 A;  3IDZ A;  4NQ5 A;  5EW0 A;  2GCU A;  4DIK A;  2I7V A;  3I15 A;  5ACW A;  2HB9 A;  1DD6 A;  4WD6 A;  3X30 A;  4RAW A;  2WYL A;  1HLK A;  2I7X A;  1VGN A;  5IQK A;  1VME A;  3ZWF A;  4C1F A;  4P62 A;  2ZNB A;  3AJ3 A;  4C09 A;  2P97 A;  3DH8 A;  3SD9 A;  2BC2 A;  3L6N A;  2BG2 A;  1YCF A;  1KO3 A;  2GFJ A;  5B15 A;  1E5D A;  3VQZ A;  5EHT A;  1JJE A;  3AF6 A;  5AHO A;  3Q6V A;  1X8G A;  4O98 A;  5LE1 A;  3X2X A;  2BIB A;  3WXC A;  2FK6 A;  3LVZ A;  5AHR A;  3SPU A;  3QH8 A;  4EYF A;  3FCZ A;  2BMI A;  4UA4 A;  5ACS A;  1JT1 A;  5AEB A;  4C1D A;  5DPX A;  1DDK A;  3SFP A;  3RPC A;  3I0V A;  5LS3 A;  5EWA A;  5HH4 A;  3A4Y A;  2FHX B;  4FEK A;  2P4Z A;  5ACU A;  2YNV B;  1SML A;  2ZZI A;  2Y8A A;  2YNT B;  1YCH A;  2BFK A;  4PVT A;  3I14 A;  1KO2 A;  2P1E A;  4AX1 B;  3FAI A;  3DHB A;  2BG8 B;  2BFL A;  1X8I A;  4KEQ A;  4UAM A;  5ACR A;  1BVT A;  2Q9U A;  5EV8 A;  2DKF A;  5FQA A;  4TZE A;  4NQ2 A;  2WYM A;  3AF5 A;  5HH5 A;  2Y8B A;  3SBL A;  5KIL A;  4XWW A;  4RBS A;  2OHJ A;  2ZWR A;  4RL2 A;  3PY6 A;  1L9Y A;  3TP9 A;  5HIQ A;  4B87 A;  3IE0 A;  2WYM C;  4Z5Z A;  2VW8 A;  5AXR A;  4Z60 A;  4FR7 A;  1KR3 A;  2BGA A;  2FHX A;  2NZF A;  2YNV A;  4AWY B;  5A87 A;  3MD7 A;  2E7Y A;  5B3R A;  4C1C A;  3I13 A;  3BK1 A;  3SW3 A;  4C1H A;  4ZNB A;  4TYT A;  5AYA A;  3RKK A;  3ZQ4 A;  5LMC A;  4BP0 A;  2WHG A;  1QH3 A;  2BG8 A;  4F6H A;  4TZB A;  2GKL A;  5AXO A;  3T3O A;  4Z5Y A;  2UYX A;  2YZ3 A;  4FSB A;  5A0V A;  5LCF A;  1QH5 A;  4EYL A;  5K4N A;  2M5D A;  4YSB A;  2GFK A;  5B1U A;  3S0Z A;  2GMN A;  3G1P A;  5K4M A;  5K4K A;  1ZTC A;  3H3E A;  4D1W A;  4RL0 A;  2Q0I A;  2H6A A;  4J5F A;  5ACV A;  3BK2 A;  2Q0J A;  2QIN A;  3X2Y A;  2BG6 A;  2NXA A;  5A5Z A;  4Z6X A;  4HL2 A;  5LCA A;  1K07 A;  1ZKP A;  4J5H A;  5ACT A;  5KIK A;  3IEM A;  4GYQ A;  4NQ6 A;  2BFZ B;  2FU9 A;  4RAM A;  2BG7 A;  3KNS A;  5HIP A;  5EVB A;  2NZE A;  5EV6 A;  2NYP A;  4XUK A;  3I11 A;  2AIO A;  5ACX A;  2QDS A;  2YNU A;  5HIO A;  4Z67 A;  4ZO3 A;  2FU8 A;  4UWO B;  2A7M A;  4D1V A;  2Q42 A;  4UWR B;  4YSK A;  3VPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...