2P18A

Crystal structure of the leishmania infantum glyoxalase ii
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
293
structure length
283
Chain Sequence
MRNYCTKTFGSAFSVTVVPTLKDNFSYLINDHTTHTLAAVDVNADYKPILTYIEEHLTYTFSTILSTHKHWDHSGGNAKLKAELEAMNVPVVVVGGANDSIPAVTKPVREGDRVQVGDLSVEVIDAPCHTRGHVLYKVQHPQHPNDGVALFTGDTMFIAGIGAFFEGDEKDMCRAMEKVYHIHKGNDYALDKVTFIFPGHEYTSGFMTFSEKTFPDRASDDLAFIQAQRAKYAAAVKTGDPSVPSSLAEEKRQNLFLRVADPAFVAKMNQGNAHALMMYLYNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glyoxalase II
publication title Catalysis and Structural Properties of Leishmania infantum Glyoxalase II: Trypanothione Specificity and Phylogeny.
pubmed doi rcsb
source organism Leishmania infantum
molecule tags Hydrolase
total genus 105
structure length 283
sequence length 293
ec nomenclature ec 3.1.2.6: Hydroxyacylglutathione hydrolase.
pdb deposition date 2007-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16123 HAGH_C Hydroxyacylglutathione hydrolase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2p18A00
4C1GA 5ACQA 3X30A 3SFPA 2QINA 1X8HA 4EFZA 4C1HA 5LCFA 2GKLA 1M2XA 3IEMA 4EXSA 4TYFA 3P2UA 2GMNA 3KNRA 2YCBA 3IDZA 5LS3A 3FAIA 1XTOA 4C1CA 1KR3A 1BC2A 5EVBA 4GYUA 4D1VA 4HKYA 2FHXA 1L9YA 2BFZA 2BFKA 2NZFA 2Q0JA 4EXYA 2YZ3A 4EYLA 1E5DA 4AWYB 5ACWA 2ZO4A 2YNTA 2DOOA 3PY6A 3PY5A 5EHTA 2BG6A 5K4KA 1VGNA 3X2XA 1JJTA 4Z5ZA 4CHLA 2Y8AA 2I7XA 2Q42A 5B1UA 2OHIA 3RKKA 3AJ3A 4EY2A 3MD7A 2XR1A 2I7VA 5EWAA 2AIOA 3A4YA 5ACUA 3IE0A 3ADRA 4AX0B 3DHAA 4ZEJA 5EVDA 3SD9A 2Q9UA 4DILA 1MQOA 4DIKA 1JT1A 2YNWA 1DXKA 3Q6VA 4J5HA 4AWZA 4ZO3A 2H6AA 2BG2A 3ZWFA 2R2DA 3KNSA 1VMEA 5AYAA 2UYXA 4UWOB 4FEKA 1QH3A 2P4ZA 4Z5YA 5KILA 2GCUA 4NQ4A 4HL2A 2NXAA 2A7MA 3AF6A 5ACVA 2GFJA 5HH6A 4D1UA 2OHHA 5FQCA 4U4LA 3WXCA 4H0DA 3QH8A 1YCGA 2Q0IA 3BC2A 2FU8A 4F6ZA 4Z60A 5LM6A 4AX1B 5ACPA 3X2YA 1ZTCA 3VPEA 2ZZIA 2BGAA 2BG8B 4C1FA 4D1TA 3IE2A 2ZWRA 3T9MA 4ZNBA 4C09A 1P9EA 3ZR9A 5ACSA 1XM8A 2BMIA 3H3EA 5AXOA 5K4NA 3RPCA 2WYLA 4D1WA 4D02A 4RBSA 2YNVB 2P1EA 5LSCA 2VW8A 4RL2A 4J5FA 4RAMA 5EV8A 5ACXA 1A8TA 5LLDA 2ZNBA 2E7YA 4UWSB 3LVZA 4B87A 1X8GA 2FU9A 5HIQA 5HH4A 5LCHA 5B3RA 3I11A 4LE6A 3I15A 4BZ3A 5B15A 4FSBA 2YNUA 2OHJA 2BG8A 2QDTA 2DKFA 2HB9A 2CBNA 5EV6A 4AD9A 4C1DA 5ACRA 2Y8BA 3I14A 3ZQ4A 1DD6A 5HISA 3IOGA 3DH8A 5DPXA 2P18A 1SMLA 4UA4A 2YNVA 3KL7A 4TZ9A 1BMCA 3SPUA 4ZO2A 3TP9A 3SW3A 5A0TA 3DHCA 1VJNA 1WRAA 2AZ4A 4YSLA 1HLKA 1ZNBA 4NQ6A 4YSKA 5LE1A 3T3OA 2P97A 4XWWA 1BVTA 4PVOA 3PG4A 2FM6A 4XWTA 3BV6A 5A0VA 4EYFA 4TZBA 4Z7RA 4TYTA 4XUKA 4F6HA 2WRSA 2WHGA 4NQ2A 3JXPA 4RM5A 3S0ZA 5AHRA 5K0WA 3SBLA 1ZKPA 1K07A 1YCFA 4Z67A 2YNTB 3X2ZA 1A7TA 2M5CA 3DHBA 5FQAA 4TZFA 1DDKA 2QDSA 4KEQA 3FCZA 2BIBA 3G1PA 5A5ZA 1WUPA 4HL1A 4FR7A 3BK1A 5HIOA 4BP0A 2I7TA 4P62A 2BTNA 2XF4A 4JO0A 5LCAA 1KO2A 1WW1A 1X8IA 2Y87A 4UWRB 4EYBA 4V0HA 3AF5A 3L6NA 5AEBA 4YSBA 4Z6XA 5IQKA 1QH5A 1YCHA 2M5DA 3T3NA 2FK6A 4PVTA 3IELA 5EW0A 3RKJA 2GFKA 3I0VA 1KO3A 4C1EA 5K4MA 5AHOA 1Y44A 2BFLA 4UBQA 5ACTA 4O98A 2FU6A 5LMCA 5EH9A 5FQBA 4GCWA 3I13A 4GYQA 5HIPA 4NQ5A 2BC2A 5AXRA 3VQZA 2BR6A 3BK2A 1WUOA 4UAMA 3ZNBA 5A87A 2NYPA 3F9OA 2BG7A 4TZEA 2WYMA 3SRXA 2QEDA 4UWPB 5KIKA 2QJSA 2FHXB 3IEKA 2FU7A 3ESHA 2BFZB 4WD6A 3R2UA 4RL0A 1JJEA 3IE1A 3IOFA 4KEPA 2NZEA 4RAWA 5HH5A 2WYMC 5EVKA
chains in the Genus database with same CATH superfamily
4C1GA 5ACQA 3X30A 3SFPA 2QINA 1X8HA 4EFZA 4C1HA 5LCFA 2GKLA 1M2XA 3IEMA 4EXSA 4TYFA 3P2UA 2GMNA 3KNRA 4AV7A 2YCBA 3IDZA 5LS3A 3FAIA 1XTOA 4C1CA 1KR3A 1BC2A 5EVBA 4GYUA 4D1VA 4HKYA 2FHXA 1L9YA 2BFZA 2BFKA 2NZFA 2Q0JA 4EXYA 4PDXA 2YZ3A 4EYLA 1E5DA 4AWYB 5ACWA 2ZO4A 2YNTA 2DOOA 3PY6A 3PY5A 5EHTA 2BG6A 5K4KA 1VGNA 3X2XA 1JJTA 4Z5ZA 4CHLA 2Y8AA 2I7XA 2Q42A 5B1UA 2OHIA 5A23A 3RKKA 3AJ3A 4EY2A 3MD7A 2XR1A 2I7VA 5EWAA 2AIOA 3A4YA 5ACUA 3IE0A 3ADRA 4AX0B 3DHAA 4ZEJA 5EVDA 3SD9A 2Q9UA 4DILA 1MQOA 4DIKA 4NURA 1JT1A 2YNWA 1DXKA 3Q6VA 4J5HA 4AWZA 4ZO3A 2H6AA 2BG2A 3ZWFA 2R2DA 3KNSA 1VMEA 5AYAA 4AXHA 2UYXA 4UWOB 4FEKA 2CFZA 1QH3A 2P4ZA 4Z5YA 5KILA 2GCUA 4NQ4A 4HL2A 2NXAA 2A7MA 3AF6A 5ACVA 2GFJA 5HH6A 4D1UA 2OHHA 5FQCA 4U4LA 3WXCA 4H0DA 3QH8A 1YCGA 2Q0IA 3BC2A 2FU8A 4F6ZA 4Z60A 5LM6A 4AX1B 5ACPA 3X2YA 1ZTCA 3VPEA 2ZZIA 2BGAA 2BG8B 2CG2A 4C1FA 4D1TA 3IE2A 2ZWRA 3T9MA 4ZNBA 4C09A 1P9EA 3ZR9A 5ACSA 1XM8A 2BMIA 3H3EA 5AXOA 5K4NA 3RPCA 2WYLA 4D1WA 4D02A 4RBSA 2YNVB 2P1EA 5LSCA 2VW8A 4RL2A 4J5FA 4RAMA 5AIJA 5EV8A 5ACXA 1A8TA 2CFUA 5LLDA 2ZNBA 2E7YA 4UWSB 3LVZA 4B87A 1X8GA 2FU9A 5HIQA 5HH4A 5LCHA 5B3RA 3I11A 4LE6A 3I15A 4BZ3A 5B15A 4FSBA 2YNUA 2OHJA 2BG8A 2QDTA 2DKFA 2HB9A 2CBNA 5EV6A 4AD9A 4C1DA 5ACRA 2Y8BA 3I14A 3ZQ4A 1DD6A 5HISA 3IOGA 2YHEA 3DH8A 5DPXA 2P18A 1SMLA 4UA4A 2YNVA 3KL7A 4TZ9A 1BMCA 3SPUA 4ZO2A 3TP9A 3SW3A 5A0TA 3DHCA 1VJNA 1WRAA 2AZ4A 4YSLA 1HLKA 1ZNBA 4NQ6A 4YSKA 5LE1A 3T3OA 2P97A 4XWWA 1BVTA 4PVOA 3PG4A 2FM6A 4XWTA 3BV6A 5A0VA 4EYFA 4TZBA 4Z7RA 4TYTA 4XUKA 4F6HA 2WRSA 2WHGA 4NQ2A 3JXPA 4RM5A 3S0ZA 5AHRA 5K0WA 3SBLA 1ZKPA 1K07A 1YCFA 4Z67A 2YNTB 3X2ZA 1A7TA 2M5CA 3DHBA 5FQAA 4TZFA 1DDKA 2QDSA 4KEQA 3FCZA 2BIBA 3G1PA 5A5ZA 1WUPA 4HL1A 4FR7A 3BK1A 5HIOA 4BP0A 2I7TA 4P62A 2BTNA 2XF4A 4JO0A 5LCAA 1KO2A 1WW1A 1X8IA 2Y87A 4UWRB 4EYBA 4V0HA 3AF5A 3L6NA 5AEBA 4YSBA 4Z6XA 5IQKA 1QH5A 1YCHA 2M5DA 3T3NA 2FK6A 4PVTA 3IELA 5EW0A 3RKJA 2GFKA 3I0VA 1KO3A 4C1EA 5K4MA 5AHOA 1Y44A 2BFLA 4UBQA 5ACTA 4O98A 2FU6A 5LMCA 5EH9A 5FQBA 4GCWA 3I13A 4GYQA 5HIPA 4NQ5A 2BC2A 5AXRA 3VQZA 2BR6A 3BK2A 1WUOA 4UAMA 3ZNBA 5A87A 2NYPA 3F9OA 2BG7A 4TZEA 2WYMA 3SRXA 2QEDA 4UWPB 5KIKA 2QJSA 2FHXB 3IEKA 2FU7A 3ESHA 5AJLA 2BFZB 2CG3A 4WD6A 3R2UA 4RL0A 1JJEA 3IE1A 3IOFA 4KEPA 2NZEA 4RAWA 5HH5A 2WYMC 5EVKA
chains in the Genus database with same CATH topology
4C1GA 5ACQA 3X30A 3SFPA 2QINA 1X8HA 4EFZA 4C1HA 5LCFA 2GKLA 1M2XA 3IEMA 4EXSA 4TYFA 3P2UA 2GMNA 3KNRA 2YCBA 3IDZA 5LS3A 3FAIA 1XTOA 4C1CA 1KR3A 1BC2A 5EVBA 4GYUA 4D1VA 4HKYA 2FHXA 1L9YA 2BFZA 2BFKA 2NZFA 2Q0JA 4EXYA 2YZ3A 4EYLA 1E5DA 4AWYB 5ACWA 2ZO4A 2YNTA 2DOOA 3PY6A 3PY5A 5EHTA 2BG6A 5K4KA 1VGNA 3X2XA 1JJTA 4Z5ZA 4CHLA 2Y8AA 2I7XA 2Q42A 5B1UA 2OHIA 3RKKA 3AJ3A 4EY2A 3MD7A 2XR1A 2I7VA 5EWAA 2AIOA 3A4YA 5ACUA 3IE0A 3ADRA 4AX0B 3DHAA 4ZEJA 5EVDA 3SD9A 2Q9UA 4DILA 1MQOA 4DIKA 1JT1A 2YNWA 1DXKA 3Q6VA 4J5HA 4AWZA 4ZO3A 2H6AA 2BG2A 3ZWFA 2R2DA 3KNSA 1VMEA 5AYAA 2UYXA 4UWOB 4FEKA 1QH3A 2P4ZA 4Z5YA 5KILA 2GCUA 4NQ4A 4HL2A 2NXAA 2A7MA 3AF6A 5ACVA 2GFJA 5HH6A 4D1UA 2OHHA 5FQCA 4U4LA 3WXCA 4H0DA 3QH8A 1YCGA 2Q0IA 3BC2A 2FU8A 4F6ZA 4Z60A 5LM6A 4AX1B 5ACPA 3X2YA 1ZTCA 3VPEA 2ZZIA 2BGAA 2BG8B 4C1FA 4D1TA 3IE2A 2ZWRA 3T9MA 4ZNBA 4C09A 1P9EA 3ZR9A 5ACSA 1XM8A 2BMIA 3H3EA 5AXOA 5K4NA 3RPCA 2WYLA 4D1WA 4D02A 4RBSA 2YNVB 2P1EA 5LSCA 2VW8A 4RL2A 4J5FA 4RAMA 5EV8A 5ACXA 1A8TA 5LLDA 2ZNBA 2E7YA 4UWSB 3LVZA 4B87A 1X8GA 2FU9A 5HIQA 5HH4A 5LCHA 5B3RA 3I11A 4LE6A 3I15A 4BZ3A 5B15A 4FSBA 2YNUA 2OHJA 2BG8A 2QDTA 2DKFA 2HB9A 2CBNA 5EV6A 4AD9A 4C1DA 5ACRA 2Y8BA 3I14A 3ZQ4A 1DD6A 5HISA 3IOGA 3DH8A 5DPXA 2P18A 1SMLA 4UA4A 2YNVA 3KL7A 4TZ9A 1BMCA 3SPUA 4ZO2A 3TP9A 3SW3A 5A0TA 3DHCA 1VJNA 1WRAA 2AZ4A 4YSLA 1HLKA 1ZNBA 4NQ6A 4YSKA 5LE1A 3T3OA 2P97A 4XWWA 1BVTA 4PVOA 3PG4A 2FM6A 4XWTA 3BV6A 5A0VA 4EYFA 4TZBA 4Z7RA 4TYTA 4XUKA 4F6HA 2WRSA 2WHGA 4NQ2A 3JXPA 4RM5A 3S0ZA 5AHRA 5K0WA 3SBLA 1ZKPA 1K07A 1YCFA 4Z67A 2YNTB 3X2ZA 1A7TA 2M5CA 3DHBA 5FQAA 4TZFA 1DDKA 2QDSA 4KEQA 3FCZA 2BIBA 3G1PA 5A5ZA 1WUPA 4HL1A 4FR7A 3BK1A 5HIOA 4BP0A 2I7TA 4P62A 2BTNA 2XF4A 4JO0A 5LCAA 1KO2A 1WW1A 1X8IA 2Y87A 4UWRB 4EYBA 4V0HA 3AF5A 3L6NA 5AEBA 4YSBA 4Z6XA 5IQKA 1QH5A 1YCHA 2M5DA 3T3NA 2FK6A 4PVTA 3IELA 5EW0A 3RKJA 2GFKA 3I0VA 1KO3A 4C1EA 5K4MA 5AHOA 1Y44A 2BFLA 4UBQA 5ACTA 4O98A 2FU6A 5LMCA 5EH9A 5FQBA 4GCWA 3I13A 4GYQA 5HIPA 4NQ5A 2BC2A 5AXRA 3VQZA 2BR6A 3BK2A 1WUOA 4UAMA 3ZNBA 5A87A 2NYPA 3F9OA 2BG7A 4TZEA 2WYMA 3SRXA 2QEDA 4UWPB 5KIKA 2QJSA 2FHXB 3IEKA 2FU7A 3ESHA 2BFZB 4WD6A 3R2UA 4RL0A 1JJEA 3IE1A 3IOFA 4KEPA 2NZEA 4RAWA 5HH5A 2WYMC 5EVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C1G A;  5ACQ A;  3X30 A;  3SFP A;  2QIN A;  1X8H A;  4EFZ A;  4C1H A;  5LCF A;  2GKL A;  1M2X A;  3IEM A;  4EXS A;  4TYF A;  3P2U A;  2GMN A;  3KNR A;  2YCB A;  3IDZ A;  5LS3 A;  3FAI A;  1XTO A;  4C1C A;  1KR3 A;  1BC2 A;  5EVB A;  4GYU A;  4D1V A;  4HKY A;  2FHX A;  1L9Y A;  2BFZ A;  2BFK A;  2NZF A;  2Q0J A;  4EXY A;  2YZ3 A;  4EYL A;  1E5D A;  4AWY B;  5ACW A;  2ZO4 A;  2YNT A;  2DOO A;  3PY6 A;  3PY5 A;  5EHT A;  2BG6 A;  5K4K A;  1VGN A;  3X2X A;  1JJT A;  4Z5Z A;  4CHL A;  2Y8A A;  2I7X A;  2Q42 A;  5B1U A;  2OHI A;  3RKK A;  3AJ3 A;  4EY2 A;  3MD7 A;  2XR1 A;  2I7V A;  5EWA A;  2AIO A;  3A4Y A;  5ACU A;  3IE0 A;  3ADR A;  4AX0 B;  3DHA A;  4ZEJ A;  5EVD A;  3SD9 A;  2Q9U A;  4DIL A;  1MQO A;  4DIK A;  1JT1 A;  2YNW A;  1DXK A;  3Q6V A;  4J5H A;  4AWZ A;  4ZO3 A;  2H6A A;  2BG2 A;  3ZWF A;  2R2D A;  3KNS A;  1VME A;  5AYA A;  2UYX A;  4UWO B;  4FEK A;  1QH3 A;  2P4Z A;  4Z5Y A;  5KIL A;  2GCU A;  4NQ4 A;  4HL2 A;  2NXA A;  2A7M A;  3AF6 A;  5ACV A;  2GFJ A;  5HH6 A;  4D1U A;  2OHH A;  5FQC A;  4U4L A;  3WXC A;  4H0D A;  3QH8 A;  1YCG A;  2Q0I A;  3BC2 A;  2FU8 A;  4F6Z A;  4Z60 A;  5LM6 A;  4AX1 B;  5ACP A;  3X2Y A;  1ZTC A;  3VPE A;  2ZZI A;  2BGA A;  2BG8 B;  4C1F A;  4D1T A;  3IE2 A;  2ZWR A;  3T9M A;  4ZNB A;  4C09 A;  1P9E A;  3ZR9 A;  5ACS A;  1XM8 A;  2BMI A;  3H3E A;  5AXO A;  5K4N A;  3RPC A;  2WYL A;  4D1W A;  4D02 A;  4RBS A;  2YNV B;  2P1E A;  5LSC A;  2VW8 A;  4RL2 A;  4J5F A;  4RAM A;  5EV8 A;  5ACX A;  1A8T A;  5LLD A;  2ZNB A;  2E7Y A;  4UWS B;  3LVZ A;  4B87 A;  1X8G A;  2FU9 A;  5HIQ A;  5HH4 A;  5LCH A;  5B3R A;  3I11 A;  4LE6 A;  3I15 A;  4BZ3 A;  5B15 A;  4FSB A;  2YNU A;  2OHJ A;  2BG8 A;  2QDT A;  2DKF A;  2HB9 A;  2CBN A;  5EV6 A;  4AD9 A;  4C1D A;  5ACR A;  2Y8B A;  3I14 A;  3ZQ4 A;  1DD6 A;  5HIS A;  3IOG A;  3DH8 A;  5DPX A;  2P18 A;  1SML A;  4UA4 A;  2YNV A;  3KL7 A;  4TZ9 A;  1BMC A;  3SPU A;  4ZO2 A;  3TP9 A;  3SW3 A;  5A0T A;  3DHC A;  1VJN A;  1WRA A;  2AZ4 A;  4YSL A;  1HLK A;  1ZNB A;  4NQ6 A;  4YSK A;  5LE1 A;  3T3O A;  2P97 A;  4XWW A;  1BVT A;  4PVO A;  3PG4 A;  2FM6 A;  4XWT A;  3BV6 A;  5A0V A;  4EYF A;  4TZB A;  4Z7R A;  4TYT A;  4XUK A;  4F6H A;  2WRS A;  2WHG A;  4NQ2 A;  3JXP A;  4RM5 A;  3S0Z A;  5AHR A;  5K0W A;  3SBL A;  1ZKP A;  1K07 A;  1YCF A;  4Z67 A;  2YNT B;  3X2Z A;  1A7T A;  2M5C A;  3DHB A;  5FQA A;  4TZF A;  1DDK A;  2QDS A;  4KEQ A;  3FCZ A;  2BIB A;  3G1P A;  5A5Z A;  1WUP A;  4HL1 A;  4FR7 A;  3BK1 A;  5HIO A;  4BP0 A;  2I7T A;  4P62 A;  2BTN A;  2XF4 A;  4JO0 A;  5LCA A;  1KO2 A;  1WW1 A;  1X8I A;  2Y87 A;  4UWR B;  4EYB A;  4V0H A;  3AF5 A;  3L6N A;  5AEB A;  4YSB A;  4Z6X A;  5IQK A;  1QH5 A;  1YCH A;  2M5D A;  3T3N A;  2FK6 A;  4PVT A;  3IEL A;  5EW0 A;  3RKJ A;  2GFK A;  3I0V A;  1KO3 A;  4C1E A;  5K4M A;  5AHO A;  1Y44 A;  2BFL A;  4UBQ A;  5ACT A;  4O98 A;  2FU6 A;  5LMC A;  5EH9 A;  5FQB A;  4GCW A;  3I13 A;  4GYQ A;  5HIP A;  4NQ5 A;  2BC2 A;  5AXR A;  3VQZ A;  2BR6 A;  3BK2 A;  1WUO A;  4UAM A;  3ZNB A;  5A87 A;  2NYP A;  3F9O A;  2BG7 A;  4TZE A;  2WYM A;  3SRX A;  2QED A;  4UWP B;  5KIK A;  2QJS A;  2FHX B;  3IEK A;  2FU7 A;  3ESH A;  2BFZ B;  4WD6 A;  3R2U A;  4RL0 A;  1JJE A;  3IE1 A;  3IOF A;  4KEP A;  2NZE A;  4RAW A;  5HH5 A;  2WYM C;  5EVK A; 
#chains in the Genus database with same CATH topology
 4C1G A;  5ACQ A;  3X30 A;  3SFP A;  2QIN A;  1X8H A;  4EFZ A;  4C1H A;  5LCF A;  2GKL A;  1M2X A;  3IEM A;  4EXS A;  4TYF A;  3P2U A;  2GMN A;  3KNR A;  4AV7 A;  2YCB A;  3IDZ A;  5LS3 A;  3FAI A;  1XTO A;  4C1C A;  1KR3 A;  1BC2 A;  5EVB A;  4GYU A;  4D1V A;  4HKY A;  2FHX A;  1L9Y A;  2BFZ A;  2BFK A;  2NZF A;  2Q0J A;  4EXY A;  4PDX A;  2YZ3 A;  4EYL A;  1E5D A;  4AWY B;  5ACW A;  2ZO4 A;  2YNT A;  2DOO A;  3PY6 A;  3PY5 A;  5EHT A;  2BG6 A;  5K4K A;  1VGN A;  3X2X A;  1JJT A;  4Z5Z A;  4CHL A;  2Y8A A;  2I7X A;  2Q42 A;  5B1U A;  2OHI A;  5A23 A;  3RKK A;  3AJ3 A;  4EY2 A;  3MD7 A;  2XR1 A;  2I7V A;  5EWA A;  2AIO A;  3A4Y A;  5ACU A;  3IE0 A;  3ADR A;  4AX0 B;  3DHA A;  4ZEJ A;  5EVD A;  3SD9 A;  2Q9U A;  4DIL A;  1MQO A;  4DIK A;  4NUR A;  1JT1 A;  2YNW A;  1DXK A;  3Q6V A;  4J5H A;  4AWZ A;  4ZO3 A;  2H6A A;  2BG2 A;  3ZWF A;  2R2D A;  3KNS A;  1VME A;  5AYA A;  4AXH A;  2UYX A;  4UWO B;  4FEK A;  2CFZ A;  1QH3 A;  2P4Z A;  4Z5Y A;  5KIL A;  2GCU A;  4NQ4 A;  4HL2 A;  2NXA A;  2A7M A;  3AF6 A;  5ACV A;  2GFJ A;  5HH6 A;  4D1U A;  2OHH A;  5FQC A;  4U4L A;  3WXC A;  4H0D A;  3QH8 A;  1YCG A;  2Q0I A;  3BC2 A;  2FU8 A;  4F6Z A;  4Z60 A;  5LM6 A;  4AX1 B;  5ACP A;  3X2Y A;  1ZTC A;  3VPE A;  2ZZI A;  2BGA A;  2BG8 B;  2CG2 A;  4C1F A;  4D1T A;  3IE2 A;  2ZWR A;  3T9M A;  4ZNB A;  4C09 A;  1P9E A;  3ZR9 A;  5ACS A;  1XM8 A;  2BMI A;  3H3E A;  5AXO A;  5K4N A;  3RPC A;  2WYL A;  4D1W A;  4D02 A;  4RBS A;  2YNV B;  2P1E A;  5LSC A;  2VW8 A;  4RL2 A;  4J5F A;  4RAM A;  5AIJ A;  5EV8 A;  5ACX A;  1A8T A;  2CFU A;  5LLD A;  2ZNB A;  2E7Y A;  4UWS B;  3LVZ A;  4B87 A;  1X8G A;  2FU9 A;  5HIQ A;  5HH4 A;  5LCH A;  5B3R A;  3I11 A;  4LE6 A;  3I15 A;  4BZ3 A;  5B15 A;  4FSB A;  2YNU A;  2OHJ A;  2BG8 A;  2QDT A;  2DKF A;  2HB9 A;  2CBN A;  5EV6 A;  4AD9 A;  4C1D A;  5ACR A;  2Y8B A;  3I14 A;  3ZQ4 A;  1DD6 A;  5HIS A;  3IOG A;  2YHE A;  3DH8 A;  5DPX A;  2P18 A;  1SML A;  4UA4 A;  2YNV A;  3KL7 A;  4TZ9 A;  1BMC A;  3SPU A;  4ZO2 A;  3TP9 A;  3SW3 A;  5A0T A;  3DHC A;  1VJN A;  1WRA A;  2AZ4 A;  4YSL A;  1HLK A;  1ZNB A;  4NQ6 A;  4YSK A;  5LE1 A;  3T3O A;  2P97 A;  4XWW A;  1BVT A;  4PVO A;  3PG4 A;  2FM6 A;  4XWT A;  3BV6 A;  5A0V A;  4EYF A;  4TZB A;  4Z7R A;  4TYT A;  4XUK A;  4F6H A;  2WRS A;  2WHG A;  4NQ2 A;  3JXP A;  4RM5 A;  3S0Z A;  5AHR A;  5K0W A;  3SBL A;  1ZKP A;  1K07 A;  1YCF A;  4Z67 A;  2YNT B;  3X2Z A;  1A7T A;  2M5C A;  3DHB A;  5FQA A;  4TZF A;  1DDK A;  2QDS A;  4KEQ A;  3FCZ A;  2BIB A;  3G1P A;  5A5Z A;  1WUP A;  4HL1 A;  4FR7 A;  3BK1 A;  5HIO A;  4BP0 A;  2I7T A;  4P62 A;  2BTN A;  2XF4 A;  4JO0 A;  5LCA A;  1KO2 A;  1WW1 A;  1X8I A;  2Y87 A;  4UWR B;  4EYB A;  4V0H A;  3AF5 A;  3L6N A;  5AEB A;  4YSB A;  4Z6X A;  5IQK A;  1QH5 A;  1YCH A;  2M5D A;  3T3N A;  2FK6 A;  4PVT A;  3IEL A;  5EW0 A;  3RKJ A;  2GFK A;  3I0V A;  1KO3 A;  4C1E A;  5K4M A;  5AHO A;  1Y44 A;  2BFL A;  4UBQ A;  5ACT A;  4O98 A;  2FU6 A;  5LMC A;  5EH9 A;  5FQB A;  4GCW A;  3I13 A;  4GYQ A;  5HIP A;  4NQ5 A;  2BC2 A;  5AXR A;  3VQZ A;  2BR6 A;  3BK2 A;  1WUO A;  4UAM A;  3ZNB A;  5A87 A;  2NYP A;  3F9O A;  2BG7 A;  4TZE A;  2WYM A;  3SRX A;  2QED A;  4UWP B;  5KIK A;  2QJS A;  2FHX B;  3IEK A;  2FU7 A;  3ESH A;  5AJL A;  2BFZ B;  2CG3 A;  4WD6 A;  3R2U A;  4RL0 A;  1JJE A;  3IE1 A;  3IOF A;  4KEP A;  2NZE A;  4RAW A;  5HH5 A;  2WYM C;  5EVK A; 
#chains in the Genus database with same CATH homology
 4C1G A;  5ACQ A;  3X30 A;  3SFP A;  2QIN A;  1X8H A;  4EFZ A;  4C1H A;  5LCF A;  2GKL A;  1M2X A;  3IEM A;  4EXS A;  4TYF A;  3P2U A;  2GMN A;  3KNR A;  2YCB A;  3IDZ A;  5LS3 A;  3FAI A;  1XTO A;  4C1C A;  1KR3 A;  1BC2 A;  5EVB A;  4GYU A;  4D1V A;  4HKY A;  2FHX A;  1L9Y A;  2BFZ A;  2BFK A;  2NZF A;  2Q0J A;  4EXY A;  2YZ3 A;  4EYL A;  1E5D A;  4AWY B;  5ACW A;  2ZO4 A;  2YNT A;  2DOO A;  3PY6 A;  3PY5 A;  5EHT A;  2BG6 A;  5K4K A;  1VGN A;  3X2X A;  1JJT A;  4Z5Z A;  4CHL A;  2Y8A A;  2I7X A;  2Q42 A;  5B1U A;  2OHI A;  3RKK A;  3AJ3 A;  4EY2 A;  3MD7 A;  2XR1 A;  2I7V A;  5EWA A;  2AIO A;  3A4Y A;  5ACU A;  3IE0 A;  3ADR A;  4AX0 B;  3DHA A;  4ZEJ A;  5EVD A;  3SD9 A;  2Q9U A;  4DIL A;  1MQO A;  4DIK A;  1JT1 A;  2YNW A;  1DXK A;  3Q6V A;  4J5H A;  4AWZ A;  4ZO3 A;  2H6A A;  2BG2 A;  3ZWF A;  2R2D A;  3KNS A;  1VME A;  5AYA A;  2UYX A;  4UWO B;  4FEK A;  1QH3 A;  2P4Z A;  4Z5Y A;  5KIL A;  2GCU A;  4NQ4 A;  4HL2 A;  2NXA A;  2A7M A;  3AF6 A;  5ACV A;  2GFJ A;  5HH6 A;  4D1U A;  2OHH A;  5FQC A;  4U4L A;  3WXC A;  4H0D A;  3QH8 A;  1YCG A;  2Q0I A;  3BC2 A;  2FU8 A;  4F6Z A;  4Z60 A;  5LM6 A;  4AX1 B;  5ACP A;  3X2Y A;  1ZTC A;  3VPE A;  2ZZI A;  2BGA A;  2BG8 B;  4C1F A;  4D1T A;  3IE2 A;  2ZWR A;  3T9M A;  4ZNB A;  4C09 A;  1P9E A;  3ZR9 A;  5ACS A;  1XM8 A;  2BMI A;  3H3E A;  5AXO A;  5K4N A;  3RPC A;  2WYL A;  4D1W A;  4D02 A;  4RBS A;  2YNV B;  2P1E A;  5LSC A;  2VW8 A;  4RL2 A;  4J5F A;  4RAM A;  5EV8 A;  5ACX A;  1A8T A;  5LLD A;  2ZNB A;  2E7Y A;  4UWS B;  3LVZ A;  4B87 A;  1X8G A;  2FU9 A;  5HIQ A;  5HH4 A;  5LCH A;  5B3R A;  3I11 A;  4LE6 A;  3I15 A;  4BZ3 A;  5B15 A;  4FSB A;  2YNU A;  2OHJ A;  2BG8 A;  2QDT A;  2DKF A;  2HB9 A;  2CBN A;  5EV6 A;  4AD9 A;  4C1D A;  5ACR A;  2Y8B A;  3I14 A;  3ZQ4 A;  1DD6 A;  5HIS A;  3IOG A;  3DH8 A;  5DPX A;  2P18 A;  1SML A;  4UA4 A;  2YNV A;  3KL7 A;  4TZ9 A;  1BMC A;  3SPU A;  4ZO2 A;  3TP9 A;  3SW3 A;  5A0T A;  3DHC A;  1VJN A;  1WRA A;  2AZ4 A;  4YSL A;  1HLK A;  1ZNB A;  4NQ6 A;  4YSK A;  5LE1 A;  3T3O A;  2P97 A;  4XWW A;  1BVT A;  4PVO A;  3PG4 A;  2FM6 A;  4XWT A;  3BV6 A;  5A0V A;  4EYF A;  4TZB A;  4Z7R A;  4TYT A;  4XUK A;  4F6H A;  2WRS A;  2WHG A;  4NQ2 A;  3JXP A;  4RM5 A;  3S0Z A;  5AHR A;  5K0W A;  3SBL A;  1ZKP A;  1K07 A;  1YCF A;  4Z67 A;  2YNT B;  3X2Z A;  1A7T A;  2M5C A;  3DHB A;  5FQA A;  4TZF A;  1DDK A;  2QDS A;  4KEQ A;  3FCZ A;  2BIB A;  3G1P A;  5A5Z A;  1WUP A;  4HL1 A;  4FR7 A;  3BK1 A;  5HIO A;  4BP0 A;  2I7T A;  4P62 A;  2BTN A;  2XF4 A;  4JO0 A;  5LCA A;  1KO2 A;  1WW1 A;  1X8I A;  2Y87 A;  4UWR B;  4EYB A;  4V0H A;  3AF5 A;  3L6N A;  5AEB A;  4YSB A;  4Z6X A;  5IQK A;  1QH5 A;  1YCH A;  2M5D A;  3T3N A;  2FK6 A;  4PVT A;  3IEL A;  5EW0 A;  3RKJ A;  2GFK A;  3I0V A;  1KO3 A;  4C1E A;  5K4M A;  5AHO A;  1Y44 A;  2BFL A;  4UBQ A;  5ACT A;  4O98 A;  2FU6 A;  5LMC A;  5EH9 A;  5FQB A;  4GCW A;  3I13 A;  4GYQ A;  5HIP A;  4NQ5 A;  2BC2 A;  5AXR A;  3VQZ A;  2BR6 A;  3BK2 A;  1WUO A;  4UAM A;  3ZNB A;  5A87 A;  2NYP A;  3F9O A;  2BG7 A;  4TZE A;  2WYM A;  3SRX A;  2QED A;  4UWP B;  5KIK A;  2QJS A;  2FHX B;  3IEK A;  2FU7 A;  3ESH A;  2BFZ B;  4WD6 A;  3R2U A;  4RL0 A;  1JJE A;  3IE1 A;  3IOF A;  4KEP A;  2NZE A;  4RAW A;  5HH5 A;  2WYM C;  5EVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...