4J5HA

Crystal structure of b. thuringiensis aiia mutant f107w with n-decanoyl-l-homoserine bound at the active site
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
250
structure length
250
Chain Sequence
MTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHWDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIETEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A phenylalanine clamp controls substrate specificity in the quorum-quenching metallo-gamma-lactonase from Bacillus thuringiensis.
pubmed doi rcsb
source organism Bacillus thuringiensis
molecule tags Hydrolase/hydrolase substrate
molecule keywords N-acyl homoserine lactonase
total genus 82
structure length 250
sequence length 250
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2013-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4j5hA01
5FQCA 3T3OA 5EVKA 2YNVB 2BMIA 2GMNA 2NZEA 4U4LA 3DH8A 2QDTA 2WYLA 3SPUA 5ACRA 2WHGA 5ACSA 5AXRA 2ZWRA 5ACXA 1X8IA 2P97A 1DXKA 5LM6A 2Q0JA 2DOOA 1VMEA 4LE6A 2ZZIA 3KNSA 2Y8AA 2Q9UA 3DHBA 3IOFA 3L6NA 2BR6A 2Y8BA 1SMLA 5DPXA 4TYFA 5HIPA 3TP9A 4D1TA 1MQOA 4ZO2A 4GCWA 4YSKA 4Z67A 5A0TA 1X8GA 4GYUA 5LCAA 4KEQA 4PVTA 4UA4A 4DILA 4Z60A 2I7TA 4RM5A 5ACVA 1ZKPA 3R2UA 2BGAA 4AX1B 5HIOA 3RKKA 2FU6A 2YNTA 3AJ3A 4TZFA 4NQ6A 3ZQ4A 2FHXB 2XR1A 4RAMA 2BG8A 3ESHA 3LVZA 2E7YA 5ACWA 4D1UA 4D1VA 2QEDA 3IE1A 3VQZA 4XWWA 1WRAA 5EV8A 5ACUA 4HKYA 2WYMC 2FM6A 1HLKA 5AEBA 4BP0A 2YNTB 4RAWA 3Q6VA 3SBLA 3I14A 3RKJA 2A7MA 1VJNA 4F6HA 1YCFA 2BTNA 5AYAA 3IDZA 4TYTA 4AD9A 2AIOA 5FQBA 4Z5ZA 5LE1A 3DHAA 5HH5A 4C09A 4B87A 5ACTA 3I15A 3KL7A 2Y87A 3H3EA 2R2DA 2BFLA 4GYQA 3PY5A 2OHIA 2Q0IA 1WW1A 2H6AA 5LLDA 3SD9A 3T9MA 5EW0A 2BC2A 4TZ9A 1KR3A 5A0VA 5FQAA 5A87A 2OHHA 3T3NA 4NQ5A 1Y44A 5K0WA 5HISA 2BFZB 1BVTA 2I7VA 5LCHA 5EVBA 4XWTA 3S0ZA 4H0DA 4AX0B 4C1FA 3SFPA 2GCUA 1QH5A 5AHRA 3A4YA 3ZR9A 4C1CA 3X30A 2WRSA 4TZBA 4UAMA 1YCGA 5B1UA 4Z6XA 3WXCA 4EY2A 3PG4A 1VGNA 2AZ4A 5HIQA 4EYFA 3P2UA 5KILA 5K4NA 2XF4A 3QH8A 3PY6A 4FR7A 2CBNA 5LMCA 1KO2A 2ZO4A 2FU8A 4F6ZA 3SW3A 1WUPA 1YCHA 2BFZA 2P4ZA 2M5CA 4C1HA 4AWZA 4BZ3A 4EYBA 4UWPB 4C1GA 2QINA 5LCFA 5ACPA 5EH9A 3IEMA 4RL0A 2BFKA 5HH6A 3F9OA 3JXPA 5ACQA 4HL1A 3FCZA 5B15A 1ZTCA 3ZNBA 2Q42A 3IE2A 2BG2A 2BG8B 2M5DA 4YSLA 4EFZA 2YCBA 2P1EA 5EHTA 5IQKA 1JJEA 4RL2A 1A8TA 5AXOA 3DHCA 4EYLA 4HL2A 4ZEJA 4FSBA 3ZWFA 2NYPA 2YZ3A 2BG6A 5EV6A 1L9YA 2YNUA 5AHOA 2BIBA 2FK6A 2NXAA 1JJTA 4UBQA 2ZNBA 3G1PA 4ZNBA 1XM8A 3X2ZA 3BV6A 5LS3A 4NQ2A 4KEPA 4NQ4A 1DD6A 2OHJA 2BG7A 4P62A 4D1WA 5KIKA 2DKFA 1BMCA 1QH3A 1X8HA 2GFKA 2P18A 2GKLA 4FEKA 3I13A 2NZFA 3ADRA 2WYMA 2HB9A 4RBSA 1KO3A 3I11A 3AF5A 1WUOA 1K07A 4AWYB 4CHLA 1E5DA 1ZNBA 4EXSA 1P9EA 2YNVA 4UWSB 4PVOA 5EVDA 5EWAA 3IELA 4YSBA 5K4KA 4DIKA 3SRXA 4O98A 5LSCA 3I0VA 3KNRA 1XTOA 5HH4A 4XUKA 3BK1A 1M2XA 3RPCA 1BC2A 2GFJA 2FU9A 3FAIA 3IE0A 4J5HA 2FHXA 4C1DA 2I7XA 2FU7A 5K4MA 1DDKA 2YNWA 2QJSA 1JT1A 5A5ZA 4C1EA 2UYXA 5B3RA 4WD6A 4Z5YA 3X2XA 4JO0A 4UWOB 4Z7RA 4ZO3A 4EXYA 4V0HA 2QDSA 3IOGA 2VW8A 4UWRB 3VPEA 4J5FA 3MD7A 3AF6A 3IEKA 4D02A 3BK2A 4TZEA 3X2YA 3BC2A 1A7TA
chains in the Genus database with same CATH superfamily
5FQCA 3T3OA 5EVKA 2YNVB 2BMIA 2GMNA 2NZEA 4U4LA 3DH8A 2QDTA 2WYLA 3SPUA 5ACRA 2WHGA 5ACSA 5AXRA 2ZWRA 4AXHA 5ACXA 1X8IA 2P97A 1DXKA 5LM6A 2Q0JA 2DOOA 1VMEA 4LE6A 2ZZIA 3KNSA 2Y8AA 2CFZA 2Q9UA 3DHBA 3IOFA 3L6NA 2BR6A 2Y8BA 1SMLA 5DPXA 4TYFA 5HIPA 3TP9A 4D1TA 1MQOA 4ZO2A 4GCWA 4YSKA 4Z67A 5A0TA 1X8GA 4GYUA 5LCAA 4KEQA 4PVTA 2CG3A 4UA4A 4DILA 4Z60A 2I7TA 4RM5A 5ACVA 1ZKPA 3R2UA 2BGAA 4AX1B 5HIOA 3RKKA 2FU6A 2CFUA 2YNTA 3AJ3A 4TZFA 4NQ6A 3ZQ4A 2FHXB 2XR1A 4RAMA 2BG8A 3ESHA 3LVZA 2E7YA 5ACWA 4D1UA 4D1VA 2QEDA 3IE1A 3VQZA 4XWWA 1WRAA 5EV8A 5ACUA 4HKYA 2WYMC 2FM6A 1HLKA 5AEBA 4BP0A 2YNTB 4RAWA 3Q6VA 3SBLA 3I14A 3RKJA 2A7MA 1VJNA 4F6HA 1YCFA 2BTNA 2YHEA 5AYAA 3IDZA 4TYTA 4AD9A 2AIOA 5FQBA 4Z5ZA 5LE1A 3DHAA 5HH5A 4C09A 4B87A 5ACTA 3I15A 3KL7A 2Y87A 3H3EA 2R2DA 2BFLA 4GYQA 3PY5A 2OHIA 2Q0IA 1WW1A 2H6AA 5LLDA 3SD9A 3T9MA 4PDXA 5EW0A 2BC2A 4TZ9A 1KR3A 5A0VA 5FQAA 5A87A 2OHHA 3T3NA 4NQ5A 1Y44A 5K0WA 5HISA 2BFZB 1BVTA 2I7VA 5LCHA 5EVBA 4XWTA 3S0ZA 4H0DA 4AX0B 4C1FA 3SFPA 2GCUA 1QH5A 5AHRA 3A4YA 3ZR9A 4C1CA 3X30A 2WRSA 4TZBA 4UAMA 1YCGA 5B1UA 4Z6XA 3WXCA 4EY2A 3PG4A 5AIJA 1VGNA 2AZ4A 5HIQA 4EYFA 3P2UA 5KILA 5K4NA 2XF4A 3QH8A 3PY6A 4FR7A 2CBNA 5LMCA 1KO2A 2ZO4A 2FU8A 4F6ZA 3SW3A 1WUPA 1YCHA 2BFZA 2P4ZA 2M5CA 4C1HA 4AWZA 4BZ3A 4EYBA 4UWPB 4C1GA 2QINA 5LCFA 5ACPA 5EH9A 3IEMA 4RL0A 2BFKA 5HH6A 4AV7A 3F9OA 3JXPA 5ACQA 4HL1A 3FCZA 5B15A 1ZTCA 3ZNBA 2Q42A 3IE2A 2BG2A 2BG8B 2M5DA 4YSLA 4EFZA 2YCBA 2P1EA 5EHTA 5IQKA 1JJEA 4RL2A 1A8TA 5AXOA 3DHCA 4EYLA 4HL2A 4ZEJA 4FSBA 3ZWFA 2NYPA 2YZ3A 2BG6A 5EV6A 1L9YA 2YNUA 5AHOA 2BIBA 2FK6A 2NXAA 1JJTA 4UBQA 2ZNBA 3G1PA 4ZNBA 1XM8A 3X2ZA 3BV6A 5LS3A 5AJLA 4NQ2A 4KEPA 4NQ4A 1DD6A 2OHJA 2BG7A 4P62A 4D1WA 5KIKA 2DKFA 1BMCA 1QH3A 1X8HA 2GFKA 2P18A 2GKLA 4FEKA 3I13A 2NZFA 3ADRA 2WYMA 5A23A 2HB9A 4RBSA 1KO3A 3I11A 3AF5A 1WUOA 1K07A 4AWYB 4CHLA 1E5DA 1ZNBA 4EXSA 1P9EA 2YNVA 2CG2A 4UWSB 4PVOA 5EVDA 5EWAA 3IELA 4YSBA 5K4KA 4DIKA 3SRXA 4O98A 5LSCA 3I0VA 3KNRA 1XTOA 5HH4A 4XUKA 3BK1A 1M2XA 3RPCA 1BC2A 2GFJA 2FU9A 3FAIA 3IE0A 4NURA 4J5HA 2FHXA 4C1DA 2I7XA 2FU7A 5K4MA 1DDKA 2YNWA 2QJSA 1JT1A 5A5ZA 4C1EA 2UYXA 5B3RA 4WD6A 4Z5YA 3X2XA 4JO0A 4UWOB 4Z7RA 4ZO3A 4EXYA 4V0HA 2QDSA 3IOGA 2VW8A 4UWRB 3VPEA 4J5FA 3MD7A 3AF6A 3IEKA 4D02A 3BK2A 4TZEA 3X2YA 3BC2A 1A7TA
chains in the Genus database with same CATH topology
5FQCA 3T3OA 5EVKA 2YNVB 2BMIA 2GMNA 2NZEA 4U4LA 3DH8A 2QDTA 2WYLA 3SPUA 5ACRA 2WHGA 5ACSA 5AXRA 2ZWRA 5ACXA 1X8IA 2P97A 1DXKA 5LM6A 2Q0JA 2DOOA 1VMEA 4LE6A 2ZZIA 3KNSA 2Y8AA 2Q9UA 3DHBA 3IOFA 3L6NA 2BR6A 2Y8BA 1SMLA 5DPXA 4TYFA 5HIPA 3TP9A 4D1TA 1MQOA 4ZO2A 4GCWA 4YSKA 4Z67A 5A0TA 1X8GA 4GYUA 5LCAA 4KEQA 4PVTA 4UA4A 4DILA 4Z60A 2I7TA 4RM5A 5ACVA 1ZKPA 3R2UA 2BGAA 4AX1B 5HIOA 3RKKA 2FU6A 2YNTA 3AJ3A 4TZFA 4NQ6A 3ZQ4A 2FHXB 2XR1A 4RAMA 2BG8A 3ESHA 3LVZA 2E7YA 5ACWA 4D1UA 4D1VA 2QEDA 3IE1A 3VQZA 4XWWA 1WRAA 5EV8A 5ACUA 4HKYA 2WYMC 2FM6A 1HLKA 5AEBA 4BP0A 2YNTB 4RAWA 3Q6VA 3SBLA 3I14A 3RKJA 2A7MA 1VJNA 4F6HA 1YCFA 2BTNA 5AYAA 3IDZA 4TYTA 4AD9A 2AIOA 5FQBA 4Z5ZA 5LE1A 3DHAA 5HH5A 4C09A 4B87A 5ACTA 3I15A 3KL7A 2Y87A 3H3EA 2R2DA 2BFLA 4GYQA 3PY5A 2OHIA 2Q0IA 1WW1A 2H6AA 5LLDA 3SD9A 3T9MA 5EW0A 2BC2A 4TZ9A 1KR3A 5A0VA 5FQAA 5A87A 2OHHA 3T3NA 4NQ5A 1Y44A 5K0WA 5HISA 2BFZB 1BVTA 2I7VA 5LCHA 5EVBA 4XWTA 3S0ZA 4H0DA 4AX0B 4C1FA 3SFPA 2GCUA 1QH5A 5AHRA 3A4YA 3ZR9A 4C1CA 3X30A 2WRSA 4TZBA 4UAMA 1YCGA 5B1UA 4Z6XA 3WXCA 4EY2A 3PG4A 1VGNA 2AZ4A 5HIQA 4EYFA 3P2UA 5KILA 5K4NA 2XF4A 3QH8A 3PY6A 4FR7A 2CBNA 5LMCA 1KO2A 2ZO4A 2FU8A 4F6ZA 3SW3A 1WUPA 1YCHA 2BFZA 2P4ZA 2M5CA 4C1HA 4AWZA 4BZ3A 4EYBA 4UWPB 4C1GA 2QINA 5LCFA 5ACPA 5EH9A 3IEMA 4RL0A 2BFKA 5HH6A 3F9OA 3JXPA 5ACQA 4HL1A 3FCZA 5B15A 1ZTCA 3ZNBA 2Q42A 3IE2A 2BG2A 2BG8B 2M5DA 4YSLA 4EFZA 2YCBA 2P1EA 5EHTA 5IQKA 1JJEA 4RL2A 1A8TA 5AXOA 3DHCA 4EYLA 4HL2A 4ZEJA 4FSBA 3ZWFA 2NYPA 2YZ3A 2BG6A 5EV6A 1L9YA 2YNUA 5AHOA 2BIBA 2FK6A 2NXAA 1JJTA 4UBQA 2ZNBA 3G1PA 4ZNBA 1XM8A 3X2ZA 3BV6A 5LS3A 4NQ2A 4KEPA 4NQ4A 1DD6A 2OHJA 2BG7A 4P62A 4D1WA 5KIKA 2DKFA 1BMCA 1QH3A 1X8HA 2GFKA 2P18A 2GKLA 4FEKA 3I13A 2NZFA 3ADRA 2WYMA 2HB9A 4RBSA 1KO3A 3I11A 3AF5A 1WUOA 1K07A 4AWYB 4CHLA 1E5DA 1ZNBA 4EXSA 1P9EA 2YNVA 4UWSB 4PVOA 5EVDA 5EWAA 3IELA 4YSBA 5K4KA 4DIKA 3SRXA 4O98A 5LSCA 3I0VA 3KNRA 1XTOA 5HH4A 4XUKA 3BK1A 1M2XA 3RPCA 1BC2A 2GFJA 2FU9A 3FAIA 3IE0A 4J5HA 2FHXA 4C1DA 2I7XA 2FU7A 5K4MA 1DDKA 2YNWA 2QJSA 1JT1A 5A5ZA 4C1EA 2UYXA 5B3RA 4WD6A 4Z5YA 3X2XA 4JO0A 4UWOB 4Z7RA 4ZO3A 4EXYA 4V0HA 2QDSA 3IOGA 2VW8A 4UWRB 3VPEA 4J5FA 3MD7A 3AF6A 3IEKA 4D02A 3BK2A 4TZEA 3X2YA 3BC2A 1A7TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FQC A;  3T3O A;  5EVK A;  2YNV B;  2BMI A;  2GMN A;  2NZE A;  4U4L A;  3DH8 A;  2QDT A;  2WYL A;  3SPU A;  5ACR A;  2WHG A;  5ACS A;  5AXR A;  2ZWR A;  5ACX A;  1X8I A;  2P97 A;  1DXK A;  5LM6 A;  2Q0J A;  2DOO A;  1VME A;  4LE6 A;  2ZZI A;  3KNS A;  2Y8A A;  2Q9U A;  3DHB A;  3IOF A;  3L6N A;  2BR6 A;  2Y8B A;  1SML A;  5DPX A;  4TYF A;  5HIP A;  3TP9 A;  4D1T A;  1MQO A;  4ZO2 A;  4GCW A;  4YSK A;  4Z67 A;  5A0T A;  1X8G A;  4GYU A;  5LCA A;  4KEQ A;  4PVT A;  4UA4 A;  4DIL A;  4Z60 A;  2I7T A;  4RM5 A;  5ACV A;  1ZKP A;  3R2U A;  2BGA A;  4AX1 B;  5HIO A;  3RKK A;  2FU6 A;  2YNT A;  3AJ3 A;  4TZF A;  4NQ6 A;  3ZQ4 A;  2FHX B;  2XR1 A;  4RAM A;  2BG8 A;  3ESH A;  3LVZ A;  2E7Y A;  5ACW A;  4D1U A;  4D1V A;  2QED A;  3IE1 A;  3VQZ A;  4XWW A;  1WRA A;  5EV8 A;  5ACU A;  4HKY A;  2WYM C;  2FM6 A;  1HLK A;  5AEB A;  4BP0 A;  2YNT B;  4RAW A;  3Q6V A;  3SBL A;  3I14 A;  3RKJ A;  2A7M A;  1VJN A;  4F6H A;  1YCF A;  2BTN A;  5AYA A;  3IDZ A;  4TYT A;  4AD9 A;  2AIO A;  5FQB A;  4Z5Z A;  5LE1 A;  3DHA A;  5HH5 A;  4C09 A;  4B87 A;  5ACT A;  3I15 A;  3KL7 A;  2Y87 A;  3H3E A;  2R2D A;  2BFL A;  4GYQ A;  3PY5 A;  2OHI A;  2Q0I A;  1WW1 A;  2H6A A;  5LLD A;  3SD9 A;  3T9M A;  5EW0 A;  2BC2 A;  4TZ9 A;  1KR3 A;  5A0V A;  5FQA A;  5A87 A;  2OHH A;  3T3N A;  4NQ5 A;  1Y44 A;  5K0W A;  5HIS A;  2BFZ B;  1BVT A;  2I7V A;  5LCH A;  5EVB A;  4XWT A;  3S0Z A;  4H0D A;  4AX0 B;  4C1F A;  3SFP A;  2GCU A;  1QH5 A;  5AHR A;  3A4Y A;  3ZR9 A;  4C1C A;  3X30 A;  2WRS A;  4TZB A;  4UAM A;  1YCG A;  5B1U A;  4Z6X A;  3WXC A;  4EY2 A;  3PG4 A;  1VGN A;  2AZ4 A;  5HIQ A;  4EYF A;  3P2U A;  5KIL A;  5K4N A;  2XF4 A;  3QH8 A;  3PY6 A;  4FR7 A;  2CBN A;  5LMC A;  1KO2 A;  2ZO4 A;  2FU8 A;  4F6Z A;  3SW3 A;  1WUP A;  1YCH A;  2BFZ A;  2P4Z A;  2M5C A;  4C1H A;  4AWZ A;  4BZ3 A;  4EYB A;  4UWP B;  4C1G A;  2QIN A;  5LCF A;  5ACP A;  5EH9 A;  3IEM A;  4RL0 A;  2BFK A;  5HH6 A;  3F9O A;  3JXP A;  5ACQ A;  4HL1 A;  3FCZ A;  5B15 A;  1ZTC A;  3ZNB A;  2Q42 A;  3IE2 A;  2BG2 A;  2BG8 B;  2M5D A;  4YSL A;  4EFZ A;  2YCB A;  2P1E A;  5EHT A;  5IQK A;  1JJE A;  4RL2 A;  1A8T A;  5AXO A;  3DHC A;  4EYL A;  4HL2 A;  4ZEJ A;  4FSB A;  3ZWF A;  2NYP A;  2YZ3 A;  2BG6 A;  5EV6 A;  1L9Y A;  2YNU A;  5AHO A;  2BIB A;  2FK6 A;  2NXA A;  1JJT A;  4UBQ A;  2ZNB A;  3G1P A;  4ZNB A;  1XM8 A;  3X2Z A;  3BV6 A;  5LS3 A;  4NQ2 A;  4KEP A;  4NQ4 A;  1DD6 A;  2OHJ A;  2BG7 A;  4P62 A;  4D1W A;  5KIK A;  2DKF A;  1BMC A;  1QH3 A;  1X8H A;  2GFK A;  2P18 A;  2GKL A;  4FEK A;  3I13 A;  2NZF A;  3ADR A;  2WYM A;  2HB9 A;  4RBS A;  1KO3 A;  3I11 A;  3AF5 A;  1WUO A;  1K07 A;  4AWY B;  4CHL A;  1E5D A;  1ZNB A;  4EXS A;  1P9E A;  2YNV A;  4UWS B;  4PVO A;  5EVD A;  5EWA A;  3IEL A;  4YSB A;  5K4K A;  4DIK A;  3SRX A;  4O98 A;  5LSC A;  3I0V A;  3KNR A;  1XTO A;  5HH4 A;  4XUK A;  3BK1 A;  1M2X A;  3RPC A;  1BC2 A;  2GFJ A;  2FU9 A;  3FAI A;  3IE0 A;  4J5H A;  2FHX A;  4C1D A;  2I7X A;  2FU7 A;  5K4M A;  1DDK A;  2YNW A;  2QJS A;  1JT1 A;  5A5Z A;  4C1E A;  2UYX A;  5B3R A;  4WD6 A;  4Z5Y A;  3X2X A;  4JO0 A;  4UWO B;  4Z7R A;  4ZO3 A;  4EXY A;  4V0H A;  2QDS A;  3IOG A;  2VW8 A;  4UWR B;  3VPE A;  4J5F A;  3MD7 A;  3AF6 A;  3IEK A;  4D02 A;  3BK2 A;  4TZE A;  3X2Y A;  3BC2 A;  1A7T A; 
#chains in the Genus database with same CATH topology
 5FQC A;  3T3O A;  5EVK A;  2YNV B;  2BMI A;  2GMN A;  2NZE A;  4U4L A;  3DH8 A;  2QDT A;  2WYL A;  3SPU A;  5ACR A;  2WHG A;  5ACS A;  5AXR A;  2ZWR A;  4AXH A;  5ACX A;  1X8I A;  2P97 A;  1DXK A;  5LM6 A;  2Q0J A;  2DOO A;  1VME A;  4LE6 A;  2ZZI A;  3KNS A;  2Y8A A;  2CFZ A;  2Q9U A;  3DHB A;  3IOF A;  3L6N A;  2BR6 A;  2Y8B A;  1SML A;  5DPX A;  4TYF A;  5HIP A;  3TP9 A;  4D1T A;  1MQO A;  4ZO2 A;  4GCW A;  4YSK A;  4Z67 A;  5A0T A;  1X8G A;  4GYU A;  5LCA A;  4KEQ A;  4PVT A;  2CG3 A;  4UA4 A;  4DIL A;  4Z60 A;  2I7T A;  4RM5 A;  5ACV A;  1ZKP A;  3R2U A;  2BGA A;  4AX1 B;  5HIO A;  3RKK A;  2FU6 A;  2CFU A;  2YNT A;  3AJ3 A;  4TZF A;  4NQ6 A;  3ZQ4 A;  2FHX B;  2XR1 A;  4RAM A;  2BG8 A;  3ESH A;  3LVZ A;  2E7Y A;  5ACW A;  4D1U A;  4D1V A;  2QED A;  3IE1 A;  3VQZ A;  4XWW A;  1WRA A;  5EV8 A;  5ACU A;  4HKY A;  2WYM C;  2FM6 A;  1HLK A;  5AEB A;  4BP0 A;  2YNT B;  4RAW A;  3Q6V A;  3SBL A;  3I14 A;  3RKJ A;  2A7M A;  1VJN A;  4F6H A;  1YCF A;  2BTN A;  2YHE A;  5AYA A;  3IDZ A;  4TYT A;  4AD9 A;  2AIO A;  5FQB A;  4Z5Z A;  5LE1 A;  3DHA A;  5HH5 A;  4C09 A;  4B87 A;  5ACT A;  3I15 A;  3KL7 A;  2Y87 A;  3H3E A;  2R2D A;  2BFL A;  4GYQ A;  3PY5 A;  2OHI A;  2Q0I A;  1WW1 A;  2H6A A;  5LLD A;  3SD9 A;  3T9M A;  4PDX A;  5EW0 A;  2BC2 A;  4TZ9 A;  1KR3 A;  5A0V A;  5FQA A;  5A87 A;  2OHH A;  3T3N A;  4NQ5 A;  1Y44 A;  5K0W A;  5HIS A;  2BFZ B;  1BVT A;  2I7V A;  5LCH A;  5EVB A;  4XWT A;  3S0Z A;  4H0D A;  4AX0 B;  4C1F A;  3SFP A;  2GCU A;  1QH5 A;  5AHR A;  3A4Y A;  3ZR9 A;  4C1C A;  3X30 A;  2WRS A;  4TZB A;  4UAM A;  1YCG A;  5B1U A;  4Z6X A;  3WXC A;  4EY2 A;  3PG4 A;  5AIJ A;  1VGN A;  2AZ4 A;  5HIQ A;  4EYF A;  3P2U A;  5KIL A;  5K4N A;  2XF4 A;  3QH8 A;  3PY6 A;  4FR7 A;  2CBN A;  5LMC A;  1KO2 A;  2ZO4 A;  2FU8 A;  4F6Z A;  3SW3 A;  1WUP A;  1YCH A;  2BFZ A;  2P4Z A;  2M5C A;  4C1H A;  4AWZ A;  4BZ3 A;  4EYB A;  4UWP B;  4C1G A;  2QIN A;  5LCF A;  5ACP A;  5EH9 A;  3IEM A;  4RL0 A;  2BFK A;  5HH6 A;  4AV7 A;  3F9O A;  3JXP A;  5ACQ A;  4HL1 A;  3FCZ A;  5B15 A;  1ZTC A;  3ZNB A;  2Q42 A;  3IE2 A;  2BG2 A;  2BG8 B;  2M5D A;  4YSL A;  4EFZ A;  2YCB A;  2P1E A;  5EHT A;  5IQK A;  1JJE A;  4RL2 A;  1A8T A;  5AXO A;  3DHC A;  4EYL A;  4HL2 A;  4ZEJ A;  4FSB A;  3ZWF A;  2NYP A;  2YZ3 A;  2BG6 A;  5EV6 A;  1L9Y A;  2YNU A;  5AHO A;  2BIB A;  2FK6 A;  2NXA A;  1JJT A;  4UBQ A;  2ZNB A;  3G1P A;  4ZNB A;  1XM8 A;  3X2Z A;  3BV6 A;  5LS3 A;  5AJL A;  4NQ2 A;  4KEP A;  4NQ4 A;  1DD6 A;  2OHJ A;  2BG7 A;  4P62 A;  4D1W A;  5KIK A;  2DKF A;  1BMC A;  1QH3 A;  1X8H A;  2GFK A;  2P18 A;  2GKL A;  4FEK A;  3I13 A;  2NZF A;  3ADR A;  2WYM A;  5A23 A;  2HB9 A;  4RBS A;  1KO3 A;  3I11 A;  3AF5 A;  1WUO A;  1K07 A;  4AWY B;  4CHL A;  1E5D A;  1ZNB A;  4EXS A;  1P9E A;  2YNV A;  2CG2 A;  4UWS B;  4PVO A;  5EVD A;  5EWA A;  3IEL A;  4YSB A;  5K4K A;  4DIK A;  3SRX A;  4O98 A;  5LSC A;  3I0V A;  3KNR A;  1XTO A;  5HH4 A;  4XUK A;  3BK1 A;  1M2X A;  3RPC A;  1BC2 A;  2GFJ A;  2FU9 A;  3FAI A;  3IE0 A;  4NUR A;  4J5H A;  2FHX A;  4C1D A;  2I7X A;  2FU7 A;  5K4M A;  1DDK A;  2YNW A;  2QJS A;  1JT1 A;  5A5Z A;  4C1E A;  2UYX A;  5B3R A;  4WD6 A;  4Z5Y A;  3X2X A;  4JO0 A;  4UWO B;  4Z7R A;  4ZO3 A;  4EXY A;  4V0H A;  2QDS A;  3IOG A;  2VW8 A;  4UWR B;  3VPE A;  4J5F A;  3MD7 A;  3AF6 A;  3IEK A;  4D02 A;  3BK2 A;  4TZE A;  3X2Y A;  3BC2 A;  1A7T A; 
#chains in the Genus database with same CATH homology
 5FQC A;  3T3O A;  5EVK A;  2YNV B;  2BMI A;  2GMN A;  2NZE A;  4U4L A;  3DH8 A;  2QDT A;  2WYL A;  3SPU A;  5ACR A;  2WHG A;  5ACS A;  5AXR A;  2ZWR A;  5ACX A;  1X8I A;  2P97 A;  1DXK A;  5LM6 A;  2Q0J A;  2DOO A;  1VME A;  4LE6 A;  2ZZI A;  3KNS A;  2Y8A A;  2Q9U A;  3DHB A;  3IOF A;  3L6N A;  2BR6 A;  2Y8B A;  1SML A;  5DPX A;  4TYF A;  5HIP A;  3TP9 A;  4D1T A;  1MQO A;  4ZO2 A;  4GCW A;  4YSK A;  4Z67 A;  5A0T A;  1X8G A;  4GYU A;  5LCA A;  4KEQ A;  4PVT A;  4UA4 A;  4DIL A;  4Z60 A;  2I7T A;  4RM5 A;  5ACV A;  1ZKP A;  3R2U A;  2BGA A;  4AX1 B;  5HIO A;  3RKK A;  2FU6 A;  2YNT A;  3AJ3 A;  4TZF A;  4NQ6 A;  3ZQ4 A;  2FHX B;  2XR1 A;  4RAM A;  2BG8 A;  3ESH A;  3LVZ A;  2E7Y A;  5ACW A;  4D1U A;  4D1V A;  2QED A;  3IE1 A;  3VQZ A;  4XWW A;  1WRA A;  5EV8 A;  5ACU A;  4HKY A;  2WYM C;  2FM6 A;  1HLK A;  5AEB A;  4BP0 A;  2YNT B;  4RAW A;  3Q6V A;  3SBL A;  3I14 A;  3RKJ A;  2A7M A;  1VJN A;  4F6H A;  1YCF A;  2BTN A;  5AYA A;  3IDZ A;  4TYT A;  4AD9 A;  2AIO A;  5FQB A;  4Z5Z A;  5LE1 A;  3DHA A;  5HH5 A;  4C09 A;  4B87 A;  5ACT A;  3I15 A;  3KL7 A;  2Y87 A;  3H3E A;  2R2D A;  2BFL A;  4GYQ A;  3PY5 A;  2OHI A;  2Q0I A;  1WW1 A;  2H6A A;  5LLD A;  3SD9 A;  3T9M A;  5EW0 A;  2BC2 A;  4TZ9 A;  1KR3 A;  5A0V A;  5FQA A;  5A87 A;  2OHH A;  3T3N A;  4NQ5 A;  1Y44 A;  5K0W A;  5HIS A;  2BFZ B;  1BVT A;  2I7V A;  5LCH A;  5EVB A;  4XWT A;  3S0Z A;  4H0D A;  4AX0 B;  4C1F A;  3SFP A;  2GCU A;  1QH5 A;  5AHR A;  3A4Y A;  3ZR9 A;  4C1C A;  3X30 A;  2WRS A;  4TZB A;  4UAM A;  1YCG A;  5B1U A;  4Z6X A;  3WXC A;  4EY2 A;  3PG4 A;  1VGN A;  2AZ4 A;  5HIQ A;  4EYF A;  3P2U A;  5KIL A;  5K4N A;  2XF4 A;  3QH8 A;  3PY6 A;  4FR7 A;  2CBN A;  5LMC A;  1KO2 A;  2ZO4 A;  2FU8 A;  4F6Z A;  3SW3 A;  1WUP A;  1YCH A;  2BFZ A;  2P4Z A;  2M5C A;  4C1H A;  4AWZ A;  4BZ3 A;  4EYB A;  4UWP B;  4C1G A;  2QIN A;  5LCF A;  5ACP A;  5EH9 A;  3IEM A;  4RL0 A;  2BFK A;  5HH6 A;  3F9O A;  3JXP A;  5ACQ A;  4HL1 A;  3FCZ A;  5B15 A;  1ZTC A;  3ZNB A;  2Q42 A;  3IE2 A;  2BG2 A;  2BG8 B;  2M5D A;  4YSL A;  4EFZ A;  2YCB A;  2P1E A;  5EHT A;  5IQK A;  1JJE A;  4RL2 A;  1A8T A;  5AXO A;  3DHC A;  4EYL A;  4HL2 A;  4ZEJ A;  4FSB A;  3ZWF A;  2NYP A;  2YZ3 A;  2BG6 A;  5EV6 A;  1L9Y A;  2YNU A;  5AHO A;  2BIB A;  2FK6 A;  2NXA A;  1JJT A;  4UBQ A;  2ZNB A;  3G1P A;  4ZNB A;  1XM8 A;  3X2Z A;  3BV6 A;  5LS3 A;  4NQ2 A;  4KEP A;  4NQ4 A;  1DD6 A;  2OHJ A;  2BG7 A;  4P62 A;  4D1W A;  5KIK A;  2DKF A;  1BMC A;  1QH3 A;  1X8H A;  2GFK A;  2P18 A;  2GKL A;  4FEK A;  3I13 A;  2NZF A;  3ADR A;  2WYM A;  2HB9 A;  4RBS A;  1KO3 A;  3I11 A;  3AF5 A;  1WUO A;  1K07 A;  4AWY B;  4CHL A;  1E5D A;  1ZNB A;  4EXS A;  1P9E A;  2YNV A;  4UWS B;  4PVO A;  5EVD A;  5EWA A;  3IEL A;  4YSB A;  5K4K A;  4DIK A;  3SRX A;  4O98 A;  5LSC A;  3I0V A;  3KNR A;  1XTO A;  5HH4 A;  4XUK A;  3BK1 A;  1M2X A;  3RPC A;  1BC2 A;  2GFJ A;  2FU9 A;  3FAI A;  3IE0 A;  4J5H A;  2FHX A;  4C1D A;  2I7X A;  2FU7 A;  5K4M A;  1DDK A;  2YNW A;  2QJS A;  1JT1 A;  5A5Z A;  4C1E A;  2UYX A;  5B3R A;  4WD6 A;  4Z5Y A;  3X2X A;  4JO0 A;  4UWO B;  4Z7R A;  4ZO3 A;  4EXY A;  4V0H A;  2QDS A;  3IOG A;  2VW8 A;  4UWR B;  3VPE A;  4J5F A;  3MD7 A;  3AF6 A;  3IEK A;  4D02 A;  3BK2 A;  4TZE A;  3X2Y A;  3BC2 A;  1A7T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...