4J5HA

Crystal structure of b. thuringiensis aiia mutant f107w with n-decanoyl-l-homoserine bound at the active site
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
250
structure length
250
Chain Sequence
MTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHWDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIETEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acyl homoserine lactonase
publication title A phenylalanine clamp controls substrate specificity in the quorum-quenching metallo-gamma-lactonase from Bacillus thuringiensis.
pubmed doi rcsb
source organism Bacillus thuringiensis
molecule tags Hydrolase/hydrolase substrate
total genus 82
structure length 250
sequence length 250
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2013-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4j5hA01
4ZEJA 4YSLA 2FU8A 4DIKA 4HL1A 1Y44A 4F6ZA 4GYQA 4XUKA 5AEBA 4TYTA 5K0WA 2NZEA 2GFJA 2FU9A 3ZQ4A 5A87A 2AIOA 2H6AA 2BIBA 4V0HA 4EYLA 3LVZA 3DHAA 3I0VA 3ADRA 2ZWRA 4CHLA 1YCFA 3IOGA 4J5HA 5EH9A 2QEDA 4D1VA 4U4LA 2OHJA 2HB9A 3RKJA 5EW0A 4EFZA 3X2ZA 2Q9UA 2VW8A 2YNWA 3P2UA 2WYMA 3X30A 5ACRA 4WD6A 2WYLA 2ZNBA 1QH5A 5ACQA 4AX0B 2OHHA 3AF5A 3IE2A 4FR7A 4TZBA 5IQKA 2XF4A 4TZEA 2GKLA 4C1HA 2QDSA 5ACSA 3T3OA 3IEKA 3MD7A 5LS3A 3F9OA 1M2XA 2OHIA 4Z60A 3PY5A 3BK2A 4EXYA 2P18A 5AHRA 5ACTA 5LCHA 4EXSA 3A4YA 2BGAA 2YZ3A 5LCFA 4BZ3A 4RAMA 5LSCA 3R2UA 5A0VA 5HH4A 4FEKA 5ACPA 3RPCA 1XM8A 3VQZA 2YNVA 5FQBA 4UWSB 4TZ9A 3SW3A 5HISA 5FQCA 2Q42A 5B1UA 2I7VA 2DKFA 3I15A 4NQ2A 2BFLA 2FU7A 3PG4A 3IEMA 5HIPA 2YNTA 5K4KA 4HL2A 2UYXA 1WUOA 4D02A 3FAIA 4FSBA 3SRXA 3ZR9A 4RL0A 3IE1A 1E5DA 4ZO3A 5EVKA 4C1FA 1JT1A 5LCAA 3BV6A 2FHXA 4NQ6A 4D1WA 1L9YA 1BMCA 5EWAA 2BFZB 3H3EA 4C1DA 1X8HA 3RKKA 5LLDA 5A5ZA 2NYPA 5FQAA 4AWZA 2Y87A 2QJSA 3ZWFA 4RM5A 4GCWA 1KR3A 2BFZA 2BC2A 2BG7A 3JXPA 5EV6A 1YCGA 4HKYA 4UBQA 3T3NA 3I11A 4PVTA 1VGNA 1JJTA 4C1GA 1WRAA 2DOOA 4TYFA 5B3RA 4H0DA 3QH8A 4RL2A 5B15A 5HIOA 3DH8A 5EVBA 1MQOA 3FCZA 5LM6A 3SBLA 3L6NA 2BTNA 1WW1A 2BR6A 3I13A 2WRSA 2YNVB 5ACXA 1SMLA 2P97A 4Z7RA 4UA4A 1A7TA 4RBSA 4NQ5A 1VJNA 3IDZA 5HH5A 4LE6A 5K4MA 2YNTB 3SFPA 1ZNBA 5K4NA 2I7XA 4C09A 2P4ZA 4YSKA 3AJ3A 2BG2A 2FHXB 4TZFA 2M5DA 2WYMC 3TP9A 4XWWA 4Z6XA 1BVTA 5HH6A 3AF6A 1QH3A 1XTOA 2QINA 4UWRB 4RAWA 3KNRA 4AX1B 3X2XA 2YCBA 4ZO2A 4KEPA 4GYUA 4Z5ZA 1KO2A 2A7MA 4UAMA 3ZNBA 3DHCA 3S0ZA 2FM6A 1YCHA 5A0TA 4KEQA 3KL7A 4O98A 3G1PA 3Q6VA 4EYFA 5KIKA 4C1EA 2Q0JA 2BG8A 1VMEA 4AD9A 4C1CA 2CBNA 2Y8BA 5EVDA 3SPUA 4EY2A 5EHTA 4AWYB 4Z67A 1BC2A 2WHGA 5ACVA 5LMCA 1DXKA 5LE1A 1DD6A 3BK1A 1DDKA 1K07A 5HIQA 5AHOA 2FU6A 5DPXA 5AXRA 4D1TA 3PY6A 2NZFA 1ZKPA 4ZNBA 4YSBA 1A8TA 3VPEA 2ZZIA 4P62A 3WXCA 2GMNA 3KNSA 2Y8AA 5ACWA 2M5CA 4J5FA 5EV8A 5ACUA 4Z5YA 2NXAA 3IOFA 2YNUA 3BC2A 1ZTCA 2E7YA 4XWTA 4D1UA 1X8GA 1P9EA 2I7TA 1JJEA 3I14A 2P1EA 4B87A 5AYAA 1HLKA 4F6HA 2AZ4A 2ZO4A 2GCUA 2GFKA 3IE0A 4UWOB 2FK6A 5AXOA 4BP0A 1X8IA 4UWPB 3T9MA 2XR1A 3SD9A 3IELA 3ESHA 2BMIA 4PVOA 3X2YA 4JO0A 2Q0IA 2R2DA 4DILA 2QDTA 5KILA 1WUPA 3DHBA 1KO3A 2BG6A 4EYBA 2BFKA 4NQ4A 2BG8B
chains in the Genus database with same CATH superfamily
4ZEJA 4YSLA 2FU8A 4DIKA 4HL1A 1Y44A 4F6ZA 4GYQA 4XUKA 5AEBA 4TYTA 5K0WA 2NZEA 2GFJA 2FU9A 3ZQ4A 5A87A 2AIOA 2H6AA 2BIBA 4V0HA 4EYLA 3LVZA 3DHAA 3I0VA 2CFUA 3ADRA 2ZWRA 4CHLA 1YCFA 3IOGA 4J5HA 5EH9A 2QEDA 4D1VA 4U4LA 2OHJA 2HB9A 3RKJA 5EW0A 4EFZA 3X2ZA 2Q9UA 2VW8A 2YNWA 3P2UA 2WYMA 3X30A 5ACRA 4WD6A 2WYLA 2ZNBA 1QH5A 5ACQA 4AX0B 2OHHA 3AF5A 3IE2A 4FR7A 4TZBA 5IQKA 2XF4A 4TZEA 5AIJA 2GKLA 4C1HA 2QDSA 5ACSA 3T3OA 3IEKA 3MD7A 5AJLA 5LS3A 3F9OA 1M2XA 2OHIA 4Z60A 3PY5A 3BK2A 4EXYA 2YHEA 2P18A 5AHRA 5ACTA 5LCHA 4EXSA 3A4YA 2BGAA 2YZ3A 2CG2A 5LCFA 4BZ3A 4RAMA 5A23A 5LSCA 3R2UA 5A0VA 5HH4A 4FEKA 5ACPA 3RPCA 1XM8A 3VQZA 2YNVA 5FQBA 4UWSB 4TZ9A 3SW3A 5HISA 5FQCA 2Q42A 5B1UA 2I7VA 2DKFA 3I15A 4NQ2A 2BFLA 2FU7A 3PG4A 3IEMA 5HIPA 2YNTA 5K4KA 4HL2A 2UYXA 1WUOA 4D02A 3FAIA 4FSBA 3SRXA 3ZR9A 4RL0A 3IE1A 1E5DA 4ZO3A 5EVKA 4C1FA 1JT1A 5LCAA 3BV6A 2FHXA 4NQ6A 4D1WA 1L9YA 1BMCA 2CG3A 5EWAA 2BFZB 3H3EA 4C1DA 1X8HA 3RKKA 5LLDA 5A5ZA 2NYPA 5FQAA 4AWZA 2Y87A 2QJSA 3ZWFA 4RM5A 4GCWA 1KR3A 2BFZA 2BC2A 2BG7A 3JXPA 5EV6A 1YCGA 4HKYA 4UBQA 3T3NA 3I11A 4PVTA 1VGNA 1JJTA 4AV7A 4C1GA 1WRAA 2DOOA 4TYFA 5B3RA 4H0DA 3QH8A 4RL2A 5B15A 5HIOA 3DH8A 5EVBA 1MQOA 3FCZA 5LM6A 3SBLA 3L6NA 2BTNA 1WW1A 2BR6A 3I13A 2WRSA 2YNVB 5ACXA 1SMLA 2P97A 4Z7RA 4UA4A 1A7TA 4RBSA 4NQ5A 1VJNA 3IDZA 5HH5A 4LE6A 5K4MA 2YNTB 3SFPA 1ZNBA 5K4NA 2I7XA 4C09A 2P4ZA 4YSKA 3AJ3A 2BG2A 2FHXB 4TZFA 2M5DA 2WYMC 3TP9A 4XWWA 4NURA 4Z6XA 1BVTA 5HH6A 3AF6A 1QH3A 1XTOA 2QINA 4UWRB 4RAWA 3KNRA 4AX1B 3X2XA 2YCBA 4ZO2A 4KEPA 4GYUA 4Z5ZA 1KO2A 2A7MA 4UAMA 3ZNBA 3DHCA 4AXHA 3S0ZA 2FM6A 1YCHA 5A0TA 4KEQA 3KL7A 4O98A 3G1PA 3Q6VA 4EYFA 5KIKA 4C1EA 2Q0JA 2BG8A 1VMEA 4AD9A 4C1CA 2CBNA 2Y8BA 5EVDA 3SPUA 4EY2A 5EHTA 4AWYB 4Z67A 1BC2A 2WHGA 5ACVA 5LMCA 1DXKA 5LE1A 1DD6A 3BK1A 1DDKA 1K07A 5HIQA 5AHOA 2FU6A 5DPXA 5AXRA 4D1TA 3PY6A 2NZFA 1ZKPA 4ZNBA 4YSBA 1A8TA 3VPEA 2ZZIA 4P62A 3WXCA 2GMNA 3KNSA 2Y8AA 5ACWA 2M5CA 4J5FA 5EV8A 5ACUA 4Z5YA 2NXAA 3IOFA 2YNUA 3BC2A 1ZTCA 2E7YA 4XWTA 4D1UA 1X8GA 1P9EA 2I7TA 1JJEA 3I14A 2P1EA 4B87A 5AYAA 1HLKA 4F6HA 2AZ4A 2ZO4A 2GCUA 2GFKA 3IE0A 4UWOB 2FK6A 5AXOA 4BP0A 1X8IA 4UWPB 3T9MA 2XR1A 3SD9A 3IELA 3ESHA 2BMIA 4PVOA 3X2YA 4JO0A 2Q0IA 2R2DA 4DILA 2QDTA 4PDXA 5KILA 1WUPA 3DHBA 1KO3A 2BG6A 4EYBA 2BFKA 4NQ4A 2BG8B 2CFZA
chains in the Genus database with same CATH topology
4ZEJA 4YSLA 2FU8A 4DIKA 4HL1A 1Y44A 4F6ZA 4GYQA 4XUKA 5AEBA 4TYTA 5K0WA 2NZEA 2GFJA 2FU9A 3ZQ4A 5A87A 2AIOA 2H6AA 2BIBA 4V0HA 4EYLA 3LVZA 3DHAA 3I0VA 3ADRA 2ZWRA 4CHLA 1YCFA 3IOGA 4J5HA 5EH9A 2QEDA 4D1VA 4U4LA 2OHJA 2HB9A 3RKJA 5EW0A 4EFZA 3X2ZA 2Q9UA 2VW8A 2YNWA 3P2UA 2WYMA 3X30A 5ACRA 4WD6A 2WYLA 2ZNBA 1QH5A 5ACQA 4AX0B 2OHHA 3AF5A 3IE2A 4FR7A 4TZBA 5IQKA 2XF4A 4TZEA 2GKLA 4C1HA 2QDSA 5ACSA 3T3OA 3IEKA 3MD7A 5LS3A 3F9OA 1M2XA 2OHIA 4Z60A 3PY5A 3BK2A 4EXYA 2P18A 5AHRA 5ACTA 5LCHA 4EXSA 3A4YA 2BGAA 2YZ3A 5LCFA 4BZ3A 4RAMA 5LSCA 3R2UA 5A0VA 5HH4A 4FEKA 5ACPA 3RPCA 1XM8A 3VQZA 2YNVA 5FQBA 4UWSB 4TZ9A 3SW3A 5HISA 5FQCA 2Q42A 5B1UA 2I7VA 2DKFA 3I15A 4NQ2A 2BFLA 2FU7A 3PG4A 3IEMA 5HIPA 2YNTA 5K4KA 4HL2A 2UYXA 1WUOA 4D02A 3FAIA 4FSBA 3SRXA 3ZR9A 4RL0A 3IE1A 1E5DA 4ZO3A 5EVKA 4C1FA 1JT1A 5LCAA 3BV6A 2FHXA 4NQ6A 4D1WA 1L9YA 1BMCA 5EWAA 2BFZB 3H3EA 4C1DA 1X8HA 3RKKA 5LLDA 5A5ZA 2NYPA 5FQAA 4AWZA 2Y87A 2QJSA 3ZWFA 4RM5A 4GCWA 1KR3A 2BFZA 2BC2A 2BG7A 3JXPA 5EV6A 1YCGA 4HKYA 4UBQA 3T3NA 3I11A 4PVTA 1VGNA 1JJTA 4C1GA 1WRAA 2DOOA 4TYFA 5B3RA 4H0DA 3QH8A 4RL2A 5B15A 5HIOA 3DH8A 5EVBA 1MQOA 3FCZA 5LM6A 3SBLA 3L6NA 2BTNA 1WW1A 2BR6A 3I13A 2WRSA 2YNVB 5ACXA 1SMLA 2P97A 4Z7RA 4UA4A 1A7TA 4RBSA 4NQ5A 1VJNA 3IDZA 5HH5A 4LE6A 5K4MA 2YNTB 3SFPA 1ZNBA 5K4NA 2I7XA 4C09A 2P4ZA 4YSKA 3AJ3A 2BG2A 2FHXB 4TZFA 2M5DA 2WYMC 3TP9A 4XWWA 4Z6XA 1BVTA 5HH6A 3AF6A 1QH3A 1XTOA 2QINA 4UWRB 4RAWA 3KNRA 4AX1B 3X2XA 2YCBA 4ZO2A 4KEPA 4GYUA 4Z5ZA 1KO2A 2A7MA 4UAMA 3ZNBA 3DHCA 3S0ZA 2FM6A 1YCHA 5A0TA 4KEQA 3KL7A 4O98A 3G1PA 3Q6VA 4EYFA 5KIKA 4C1EA 2Q0JA 2BG8A 1VMEA 4AD9A 4C1CA 2CBNA 2Y8BA 5EVDA 3SPUA 4EY2A 5EHTA 4AWYB 4Z67A 1BC2A 2WHGA 5ACVA 5LMCA 1DXKA 5LE1A 1DD6A 3BK1A 1DDKA 1K07A 5HIQA 5AHOA 2FU6A 5DPXA 5AXRA 4D1TA 3PY6A 2NZFA 1ZKPA 4ZNBA 4YSBA 1A8TA 3VPEA 2ZZIA 4P62A 3WXCA 2GMNA 3KNSA 2Y8AA 5ACWA 2M5CA 4J5FA 5EV8A 5ACUA 4Z5YA 2NXAA 3IOFA 2YNUA 3BC2A 1ZTCA 2E7YA 4XWTA 4D1UA 1X8GA 1P9EA 2I7TA 1JJEA 3I14A 2P1EA 4B87A 5AYAA 1HLKA 4F6HA 2AZ4A 2ZO4A 2GCUA 2GFKA 3IE0A 4UWOB 2FK6A 5AXOA 4BP0A 1X8IA 4UWPB 3T9MA 2XR1A 3SD9A 3IELA 3ESHA 2BMIA 4PVOA 3X2YA 4JO0A 2Q0IA 2R2DA 4DILA 2QDTA 5KILA 1WUPA 3DHBA 1KO3A 2BG6A 4EYBA 2BFKA 4NQ4A 2BG8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZEJ A;  4YSL A;  2FU8 A;  4DIK A;  4HL1 A;  1Y44 A;  4F6Z A;  4GYQ A;  4XUK A;  5AEB A;  4TYT A;  5K0W A;  2NZE A;  2GFJ A;  2FU9 A;  3ZQ4 A;  5A87 A;  2AIO A;  2H6A A;  2BIB A;  4V0H A;  4EYL A;  3LVZ A;  3DHA A;  3I0V A;  3ADR A;  2ZWR A;  4CHL A;  1YCF A;  3IOG A;  4J5H A;  5EH9 A;  2QED A;  4D1V A;  4U4L A;  2OHJ A;  2HB9 A;  3RKJ A;  5EW0 A;  4EFZ A;  3X2Z A;  2Q9U A;  2VW8 A;  2YNW A;  3P2U A;  2WYM A;  3X30 A;  5ACR A;  4WD6 A;  2WYL A;  2ZNB A;  1QH5 A;  5ACQ A;  4AX0 B;  2OHH A;  3AF5 A;  3IE2 A;  4FR7 A;  4TZB A;  5IQK A;  2XF4 A;  4TZE A;  2GKL A;  4C1H A;  2QDS A;  5ACS A;  3T3O A;  3IEK A;  3MD7 A;  5LS3 A;  3F9O A;  1M2X A;  2OHI A;  4Z60 A;  3PY5 A;  3BK2 A;  4EXY A;  2P18 A;  5AHR A;  5ACT A;  5LCH A;  4EXS A;  3A4Y A;  2BGA A;  2YZ3 A;  5LCF A;  4BZ3 A;  4RAM A;  5LSC A;  3R2U A;  5A0V A;  5HH4 A;  4FEK A;  5ACP A;  3RPC A;  1XM8 A;  3VQZ A;  2YNV A;  5FQB A;  4UWS B;  4TZ9 A;  3SW3 A;  5HIS A;  5FQC A;  2Q42 A;  5B1U A;  2I7V A;  2DKF A;  3I15 A;  4NQ2 A;  2BFL A;  2FU7 A;  3PG4 A;  3IEM A;  5HIP A;  2YNT A;  5K4K A;  4HL2 A;  2UYX A;  1WUO A;  4D02 A;  3FAI A;  4FSB A;  3SRX A;  3ZR9 A;  4RL0 A;  3IE1 A;  1E5D A;  4ZO3 A;  5EVK A;  4C1F A;  1JT1 A;  5LCA A;  3BV6 A;  2FHX A;  4NQ6 A;  4D1W A;  1L9Y A;  1BMC A;  5EWA A;  2BFZ B;  3H3E A;  4C1D A;  1X8H A;  3RKK A;  5LLD A;  5A5Z A;  2NYP A;  5FQA A;  4AWZ A;  2Y87 A;  2QJS A;  3ZWF A;  4RM5 A;  4GCW A;  1KR3 A;  2BFZ A;  2BC2 A;  2BG7 A;  3JXP A;  5EV6 A;  1YCG A;  4HKY A;  4UBQ A;  3T3N A;  3I11 A;  4PVT A;  1VGN A;  1JJT A;  4C1G A;  1WRA A;  2DOO A;  4TYF A;  5B3R A;  4H0D A;  3QH8 A;  4RL2 A;  5B15 A;  5HIO A;  3DH8 A;  5EVB A;  1MQO A;  3FCZ A;  5LM6 A;  3SBL A;  3L6N A;  2BTN A;  1WW1 A;  2BR6 A;  3I13 A;  2WRS A;  2YNV B;  5ACX A;  1SML A;  2P97 A;  4Z7R A;  4UA4 A;  1A7T A;  4RBS A;  4NQ5 A;  1VJN A;  3IDZ A;  5HH5 A;  4LE6 A;  5K4M A;  2YNT B;  3SFP A;  1ZNB A;  5K4N A;  2I7X A;  4C09 A;  2P4Z A;  4YSK A;  3AJ3 A;  2BG2 A;  2FHX B;  4TZF A;  2M5D A;  2WYM C;  3TP9 A;  4XWW A;  4Z6X A;  1BVT A;  5HH6 A;  3AF6 A;  1QH3 A;  1XTO A;  2QIN A;  4UWR B;  4RAW A;  3KNR A;  4AX1 B;  3X2X A;  2YCB A;  4ZO2 A;  4KEP A;  4GYU A;  4Z5Z A;  1KO2 A;  2A7M A;  4UAM A;  3ZNB A;  3DHC A;  3S0Z A;  2FM6 A;  1YCH A;  5A0T A;  4KEQ A;  3KL7 A;  4O98 A;  3G1P A;  3Q6V A;  4EYF A;  5KIK A;  4C1E A;  2Q0J A;  2BG8 A;  1VME A;  4AD9 A;  4C1C A;  2CBN A;  2Y8B A;  5EVD A;  3SPU A;  4EY2 A;  5EHT A;  4AWY B;  4Z67 A;  1BC2 A;  2WHG A;  5ACV A;  5LMC A;  1DXK A;  5LE1 A;  1DD6 A;  3BK1 A;  1DDK A;  1K07 A;  5HIQ A;  5AHO A;  2FU6 A;  5DPX A;  5AXR A;  4D1T A;  3PY6 A;  2NZF A;  1ZKP A;  4ZNB A;  4YSB A;  1A8T A;  3VPE A;  2ZZI A;  4P62 A;  3WXC A;  2GMN A;  3KNS A;  2Y8A A;  5ACW A;  2M5C A;  4J5F A;  5EV8 A;  5ACU A;  4Z5Y A;  2NXA A;  3IOF A;  2YNU A;  3BC2 A;  1ZTC A;  2E7Y A;  4XWT A;  4D1U A;  1X8G A;  1P9E A;  2I7T A;  1JJE A;  3I14 A;  2P1E A;  4B87 A;  5AYA A;  1HLK A;  4F6H A;  2AZ4 A;  2ZO4 A;  2GCU A;  2GFK A;  3IE0 A;  4UWO B;  2FK6 A;  5AXO A;  4BP0 A;  1X8I A;  4UWP B;  3T9M A;  2XR1 A;  3SD9 A;  3IEL A;  3ESH A;  2BMI A;  4PVO A;  3X2Y A;  4JO0 A;  2Q0I A;  2R2D A;  4DIL A;  2QDT A;  5KIL A;  1WUP A;  3DHB A;  1KO3 A;  2BG6 A;  4EYB A;  2BFK A;  4NQ4 A;  2BG8 B; 
#chains in the Genus database with same CATH topology
 4ZEJ A;  4YSL A;  2FU8 A;  4DIK A;  4HL1 A;  1Y44 A;  4F6Z A;  4GYQ A;  4XUK A;  5AEB A;  4TYT A;  5K0W A;  2NZE A;  2GFJ A;  2FU9 A;  3ZQ4 A;  5A87 A;  2AIO A;  2H6A A;  2BIB A;  4V0H A;  4EYL A;  3LVZ A;  3DHA A;  3I0V A;  2CFU A;  3ADR A;  2ZWR A;  4CHL A;  1YCF A;  3IOG A;  4J5H A;  5EH9 A;  2QED A;  4D1V A;  4U4L A;  2OHJ A;  2HB9 A;  3RKJ A;  5EW0 A;  4EFZ A;  3X2Z A;  2Q9U A;  2VW8 A;  2YNW A;  3P2U A;  2WYM A;  3X30 A;  5ACR A;  4WD6 A;  2WYL A;  2ZNB A;  1QH5 A;  5ACQ A;  4AX0 B;  2OHH A;  3AF5 A;  3IE2 A;  4FR7 A;  4TZB A;  5IQK A;  2XF4 A;  4TZE A;  5AIJ A;  2GKL A;  4C1H A;  2QDS A;  5ACS A;  3T3O A;  3IEK A;  3MD7 A;  5AJL A;  5LS3 A;  3F9O A;  1M2X A;  2OHI A;  4Z60 A;  3PY5 A;  3BK2 A;  4EXY A;  2YHE A;  2P18 A;  5AHR A;  5ACT A;  5LCH A;  4EXS A;  3A4Y A;  2BGA A;  2YZ3 A;  2CG2 A;  5LCF A;  4BZ3 A;  4RAM A;  5A23 A;  5LSC A;  3R2U A;  5A0V A;  5HH4 A;  4FEK A;  5ACP A;  3RPC A;  1XM8 A;  3VQZ A;  2YNV A;  5FQB A;  4UWS B;  4TZ9 A;  3SW3 A;  5HIS A;  5FQC A;  2Q42 A;  5B1U A;  2I7V A;  2DKF A;  3I15 A;  4NQ2 A;  2BFL A;  2FU7 A;  3PG4 A;  3IEM A;  5HIP A;  2YNT A;  5K4K A;  4HL2 A;  2UYX A;  1WUO A;  4D02 A;  3FAI A;  4FSB A;  3SRX A;  3ZR9 A;  4RL0 A;  3IE1 A;  1E5D A;  4ZO3 A;  5EVK A;  4C1F A;  1JT1 A;  5LCA A;  3BV6 A;  2FHX A;  4NQ6 A;  4D1W A;  1L9Y A;  1BMC A;  2CG3 A;  5EWA A;  2BFZ B;  3H3E A;  4C1D A;  1X8H A;  3RKK A;  5LLD A;  5A5Z A;  2NYP A;  5FQA A;  4AWZ A;  2Y87 A;  2QJS A;  3ZWF A;  4RM5 A;  4GCW A;  1KR3 A;  2BFZ A;  2BC2 A;  2BG7 A;  3JXP A;  5EV6 A;  1YCG A;  4HKY A;  4UBQ A;  3T3N A;  3I11 A;  4PVT A;  1VGN A;  1JJT A;  4AV7 A;  4C1G A;  1WRA A;  2DOO A;  4TYF A;  5B3R A;  4H0D A;  3QH8 A;  4RL2 A;  5B15 A;  5HIO A;  3DH8 A;  5EVB A;  1MQO A;  3FCZ A;  5LM6 A;  3SBL A;  3L6N A;  2BTN A;  1WW1 A;  2BR6 A;  3I13 A;  2WRS A;  2YNV B;  5ACX A;  1SML A;  2P97 A;  4Z7R A;  4UA4 A;  1A7T A;  4RBS A;  4NQ5 A;  1VJN A;  3IDZ A;  5HH5 A;  4LE6 A;  5K4M A;  2YNT B;  3SFP A;  1ZNB A;  5K4N A;  2I7X A;  4C09 A;  2P4Z A;  4YSK A;  3AJ3 A;  2BG2 A;  2FHX B;  4TZF A;  2M5D A;  2WYM C;  3TP9 A;  4XWW A;  4NUR A;  4Z6X A;  1BVT A;  5HH6 A;  3AF6 A;  1QH3 A;  1XTO A;  2QIN A;  4UWR B;  4RAW A;  3KNR A;  4AX1 B;  3X2X A;  2YCB A;  4ZO2 A;  4KEP A;  4GYU A;  4Z5Z A;  1KO2 A;  2A7M A;  4UAM A;  3ZNB A;  3DHC A;  4AXH A;  3S0Z A;  2FM6 A;  1YCH A;  5A0T A;  4KEQ A;  3KL7 A;  4O98 A;  3G1P A;  3Q6V A;  4EYF A;  5KIK A;  4C1E A;  2Q0J A;  2BG8 A;  1VME A;  4AD9 A;  4C1C A;  2CBN A;  2Y8B A;  5EVD A;  3SPU A;  4EY2 A;  5EHT A;  4AWY B;  4Z67 A;  1BC2 A;  2WHG A;  5ACV A;  5LMC A;  1DXK A;  5LE1 A;  1DD6 A;  3BK1 A;  1DDK A;  1K07 A;  5HIQ A;  5AHO A;  2FU6 A;  5DPX A;  5AXR A;  4D1T A;  3PY6 A;  2NZF A;  1ZKP A;  4ZNB A;  4YSB A;  1A8T A;  3VPE A;  2ZZI A;  4P62 A;  3WXC A;  2GMN A;  3KNS A;  2Y8A A;  5ACW A;  2M5C A;  4J5F A;  5EV8 A;  5ACU A;  4Z5Y A;  2NXA A;  3IOF A;  2YNU A;  3BC2 A;  1ZTC A;  2E7Y A;  4XWT A;  4D1U A;  1X8G A;  1P9E A;  2I7T A;  1JJE A;  3I14 A;  2P1E A;  4B87 A;  5AYA A;  1HLK A;  4F6H A;  2AZ4 A;  2ZO4 A;  2GCU A;  2GFK A;  3IE0 A;  4UWO B;  2FK6 A;  5AXO A;  4BP0 A;  1X8I A;  4UWP B;  3T9M A;  2XR1 A;  3SD9 A;  3IEL A;  3ESH A;  2BMI A;  4PVO A;  3X2Y A;  4JO0 A;  2Q0I A;  2R2D A;  4DIL A;  2QDT A;  4PDX A;  5KIL A;  1WUP A;  3DHB A;  1KO3 A;  2BG6 A;  4EYB A;  2BFK A;  4NQ4 A;  2BG8 B;  2CFZ A; 
#chains in the Genus database with same CATH homology
 4ZEJ A;  4YSL A;  2FU8 A;  4DIK A;  4HL1 A;  1Y44 A;  4F6Z A;  4GYQ A;  4XUK A;  5AEB A;  4TYT A;  5K0W A;  2NZE A;  2GFJ A;  2FU9 A;  3ZQ4 A;  5A87 A;  2AIO A;  2H6A A;  2BIB A;  4V0H A;  4EYL A;  3LVZ A;  3DHA A;  3I0V A;  3ADR A;  2ZWR A;  4CHL A;  1YCF A;  3IOG A;  4J5H A;  5EH9 A;  2QED A;  4D1V A;  4U4L A;  2OHJ A;  2HB9 A;  3RKJ A;  5EW0 A;  4EFZ A;  3X2Z A;  2Q9U A;  2VW8 A;  2YNW A;  3P2U A;  2WYM A;  3X30 A;  5ACR A;  4WD6 A;  2WYL A;  2ZNB A;  1QH5 A;  5ACQ A;  4AX0 B;  2OHH A;  3AF5 A;  3IE2 A;  4FR7 A;  4TZB A;  5IQK A;  2XF4 A;  4TZE A;  2GKL A;  4C1H A;  2QDS A;  5ACS A;  3T3O A;  3IEK A;  3MD7 A;  5LS3 A;  3F9O A;  1M2X A;  2OHI A;  4Z60 A;  3PY5 A;  3BK2 A;  4EXY A;  2P18 A;  5AHR A;  5ACT A;  5LCH A;  4EXS A;  3A4Y A;  2BGA A;  2YZ3 A;  5LCF A;  4BZ3 A;  4RAM A;  5LSC A;  3R2U A;  5A0V A;  5HH4 A;  4FEK A;  5ACP A;  3RPC A;  1XM8 A;  3VQZ A;  2YNV A;  5FQB A;  4UWS B;  4TZ9 A;  3SW3 A;  5HIS A;  5FQC A;  2Q42 A;  5B1U A;  2I7V A;  2DKF A;  3I15 A;  4NQ2 A;  2BFL A;  2FU7 A;  3PG4 A;  3IEM A;  5HIP A;  2YNT A;  5K4K A;  4HL2 A;  2UYX A;  1WUO A;  4D02 A;  3FAI A;  4FSB A;  3SRX A;  3ZR9 A;  4RL0 A;  3IE1 A;  1E5D A;  4ZO3 A;  5EVK A;  4C1F A;  1JT1 A;  5LCA A;  3BV6 A;  2FHX A;  4NQ6 A;  4D1W A;  1L9Y A;  1BMC A;  5EWA A;  2BFZ B;  3H3E A;  4C1D A;  1X8H A;  3RKK A;  5LLD A;  5A5Z A;  2NYP A;  5FQA A;  4AWZ A;  2Y87 A;  2QJS A;  3ZWF A;  4RM5 A;  4GCW A;  1KR3 A;  2BFZ A;  2BC2 A;  2BG7 A;  3JXP A;  5EV6 A;  1YCG A;  4HKY A;  4UBQ A;  3T3N A;  3I11 A;  4PVT A;  1VGN A;  1JJT A;  4C1G A;  1WRA A;  2DOO A;  4TYF A;  5B3R A;  4H0D A;  3QH8 A;  4RL2 A;  5B15 A;  5HIO A;  3DH8 A;  5EVB A;  1MQO A;  3FCZ A;  5LM6 A;  3SBL A;  3L6N A;  2BTN A;  1WW1 A;  2BR6 A;  3I13 A;  2WRS A;  2YNV B;  5ACX A;  1SML A;  2P97 A;  4Z7R A;  4UA4 A;  1A7T A;  4RBS A;  4NQ5 A;  1VJN A;  3IDZ A;  5HH5 A;  4LE6 A;  5K4M A;  2YNT B;  3SFP A;  1ZNB A;  5K4N A;  2I7X A;  4C09 A;  2P4Z A;  4YSK A;  3AJ3 A;  2BG2 A;  2FHX B;  4TZF A;  2M5D A;  2WYM C;  3TP9 A;  4XWW A;  4Z6X A;  1BVT A;  5HH6 A;  3AF6 A;  1QH3 A;  1XTO A;  2QIN A;  4UWR B;  4RAW A;  3KNR A;  4AX1 B;  3X2X A;  2YCB A;  4ZO2 A;  4KEP A;  4GYU A;  4Z5Z A;  1KO2 A;  2A7M A;  4UAM A;  3ZNB A;  3DHC A;  3S0Z A;  2FM6 A;  1YCH A;  5A0T A;  4KEQ A;  3KL7 A;  4O98 A;  3G1P A;  3Q6V A;  4EYF A;  5KIK A;  4C1E A;  2Q0J A;  2BG8 A;  1VME A;  4AD9 A;  4C1C A;  2CBN A;  2Y8B A;  5EVD A;  3SPU A;  4EY2 A;  5EHT A;  4AWY B;  4Z67 A;  1BC2 A;  2WHG A;  5ACV A;  5LMC A;  1DXK A;  5LE1 A;  1DD6 A;  3BK1 A;  1DDK A;  1K07 A;  5HIQ A;  5AHO A;  2FU6 A;  5DPX A;  5AXR A;  4D1T A;  3PY6 A;  2NZF A;  1ZKP A;  4ZNB A;  4YSB A;  1A8T A;  3VPE A;  2ZZI A;  4P62 A;  3WXC A;  2GMN A;  3KNS A;  2Y8A A;  5ACW A;  2M5C A;  4J5F A;  5EV8 A;  5ACU A;  4Z5Y A;  2NXA A;  3IOF A;  2YNU A;  3BC2 A;  1ZTC A;  2E7Y A;  4XWT A;  4D1U A;  1X8G A;  1P9E A;  2I7T A;  1JJE A;  3I14 A;  2P1E A;  4B87 A;  5AYA A;  1HLK A;  4F6H A;  2AZ4 A;  2ZO4 A;  2GCU A;  2GFK A;  3IE0 A;  4UWO B;  2FK6 A;  5AXO A;  4BP0 A;  1X8I A;  4UWP B;  3T9M A;  2XR1 A;  3SD9 A;  3IEL A;  3ESH A;  2BMI A;  4PVO A;  3X2Y A;  4JO0 A;  2Q0I A;  2R2D A;  4DIL A;  2QDT A;  5KIL A;  1WUP A;  3DHB A;  1KO3 A;  2BG6 A;  4EYB A;  2BFK A;  4NQ4 A;  2BG8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...