4J5HA

Crystal structure of b. thuringiensis aiia mutant f107w with n-decanoyl-l-homoserine bound at the active site
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
250
structure length
250
Chain Sequence
MTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHWDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIETEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A phenylalanine clamp controls substrate specificity in the quorum-quenching metallo-gamma-lactonase from Bacillus thuringiensis.
pubmed doi rcsb
source organism Bacillus thuringiensis
molecule tags Hydrolase/hydrolase substrate
molecule keywords N-acyl homoserine lactonase
total genus 82
structure length 250
sequence length 250
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2013-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4j5hA01
5ACVA 1YCHA 4JO0A 5A87A 2OHIA 1KR3A 3AJ3A 2UYXA 1X8GA 4XWTA 2P1EA 2BFZA 1YCGA 5FQAA 5ACRA 4ZEJA 4ZO3A 3H3EA 4FEKA 4TYTA 3DHCA 5AEBA 2VW8A 2YNTB 4C09A 2QDTA 4O98A 2I7XA 5ACSA 3DH8A 4UBQA 1VJNA 5ACWA 4D1TA 5A0VA 2YZ3A 2XF4A 3PY5A 4ZNBA 4F6HA 3FAIA 5AXOA 5K4MA 4F6ZA 2WYMA 5EV8A 5HIOA 2BG8B 1ZNBA 3G1PA 5LM6A 4EFZA 4FR7A 4XUKA 5EVKA 2AZ4A 1DDKA 1X8HA 2QEDA 5EHTA 2XR1A 2FU7A 2DOOA 4TZ9A 4EYFA 3SW3A 4AX1B 1JJTA 4TZBA 1VMEA 3VPEA 5EH9A 4C1GA 2I7VA 3RPCA 3T3NA 4D1WA 5EVBA 4J5HA 3L6NA 2YCBA 2M5CA 4RAWA 5HH5A 5K4NA 2BMIA 4EXYA 4TYFA 3ZWFA 4Z5ZA 5FQCA 1BMCA 4Z5YA 3I14A 2H6AA 3JXPA 2BTNA 5B3RA 3DHBA 4P62A 4RAMA 1WUPA 1XM8A 3IEKA 2NXAA 1X8IA 1DD6A 3BK1A 4HL1A 4UWPB 5LMCA 2BG7A 3AF6A 3BC2A 4C1DA 1BC2A 2YNWA 3I0VA 2HB9A 3F9OA 4PVTA 4B87A 4DIKA 2NZFA 4DILA 3IE1A 2FU6A 2BFKA 1VGNA 3X2ZA 4AD9A 5K0WA 4KEQA 1QH5A 2FK6A 2Y8BA 3FCZA 2BG6A 1KO3A 2WHGA 2FU9A 4Z60A 3SD9A 4EY2A 4V0HA 4GCWA 1K07A 4BP0A 4YSLA 3SPUA 4UAMA 3SRXA 4Z7RA 3SBLA 4Z67A 2WYMC 4H0DA 2Y8AA 3AF5A 4UWRB 4RL2A 2GKLA 4NQ4A 5HH4A 3WXCA 1DXKA 4AX0B 5B15A 5DPXA 3TP9A 1E5DA 1YCFA 4U4LA 5ACQA 4ZO2A 1M2XA 2OHJA 5K4KA 3IE2A 4XWWA 5EWAA 3Q6VA 4Z6XA 5HISA 3T9MA 2Q42A 1A7TA 2OHHA 2FHXA 2AIOA 4GYQA 5LCFA 1XTOA 4TZFA 5AYAA 5ACXA 2GCUA 5KIKA 3LVZA 3IOGA 1SMLA 1WW1A 5LSCA 2BC2A 5ACPA 5AHOA 3ZQ4A 5FQBA 5LCAA 4C1EA 5A0TA 1JJEA 3X30A 5KILA 1MQOA 3I11A 2FHXB 4RM5A 2GFKA 5ACTA 2NYPA 4RBSA 5LE1A 5EVDA 3P2UA 2FM6A 5HH6A 1WRAA 2A7MA 2M5DA 1ZTCA 4AWZA 4J5FA 1L9YA 2E7YA 3KNSA 3IOFA 3BV6A 4PVOA 2GMNA 4C1CA 2Q0IA 5B1UA 2Q0JA 5HIQA 1WUOA 4NQ6A 3ADRA 2YNVB 2R2DA 2P4ZA 2QINA 2ZO4A 3SFPA 3X2YA 4D1VA 3A4YA 2Y87A 2BFLA 2BR6A 3S0ZA 2ZNBA 2BG2A 4AWYB 4UWSB 2BFZB 1KO2A 2I7TA 3PY6A 5A5ZA 3I15A 4WD6A 4HL2A 3ESHA 4EYBA 2CBNA 3BK2A 4EXSA 3R2UA 4UWOB 2P97A 2YNUA 1QH3A 4NQ2A 2P18A 1BVTA 4KEPA 3X2XA 4FSBA 4RL0A 1Y44A 5LCHA 2YNTA 4C1FA 3IDZA 5HIPA 2FU8A 3PG4A 3RKJA 2Q9UA 5LLDA 2ZWRA 5AXRA 3RKKA 2ZZIA 4C1HA 3ZR9A 3KNRA 1ZKPA 3IELA 2NZEA 2QDSA 2DKFA 3ZNBA 1JT1A 4YSKA 4NQ5A 1HLKA 4EYLA 2YNVA 4BZ3A 3DHAA 4D02A 4UA4A 1A8TA 5ACUA 5LS3A 3VQZA 5AHRA 4CHLA 4HKYA 2BG8A 1P9EA 3MD7A 2GFJA 2BGAA 5EW0A 3IE0A 4GYUA 3KL7A 5EV6A 4D1UA 3QH8A 2WRSA 5IQKA 4LE6A 2WYLA 4YSBA 2QJSA 3T3OA 2BIBA 3IEMA 3I13A 4TZEA
chains in the Genus database with same CATH superfamily
5ACVA 1YCHA 4JO0A 5A87A 2OHIA 1KR3A 3AJ3A 2UYXA 1X8GA 4XWTA 2P1EA 2BFZA 1YCGA 5A23A 5FQAA 5ACRA 4ZEJA 4ZO3A 3H3EA 4FEKA 4TYTA 3DHCA 5AEBA 2CFUA 2VW8A 2YNTB 4C09A 2QDTA 4O98A 2I7XA 5ACSA 3DH8A 4UBQA 1VJNA 5ACWA 2CG3A 4D1TA 5A0VA 2YZ3A 2XF4A 3PY5A 4ZNBA 4F6HA 3FAIA 5AXOA 5K4MA 4F6ZA 2WYMA 5EV8A 5HIOA 2BG8B 1ZNBA 3G1PA 5LM6A 4EFZA 4FR7A 4XUKA 5EVKA 2AZ4A 1DDKA 1X8HA 2QEDA 5EHTA 2XR1A 2FU7A 2DOOA 4TZ9A 4EYFA 3SW3A 4AX1B 1JJTA 4TZBA 1VMEA 3VPEA 5EH9A 4C1GA 2I7VA 3RPCA 3T3NA 4D1WA 5EVBA 4J5HA 3L6NA 2YCBA 2M5CA 4RAWA 5HH5A 5K4NA 2BMIA 4EXYA 4TYFA 3ZWFA 4Z5ZA 5FQCA 1BMCA 4Z5YA 3I14A 2H6AA 3JXPA 2BTNA 5B3RA 3DHBA 4P62A 4RAMA 1WUPA 1XM8A 3IEKA 2NXAA 1X8IA 1DD6A 3BK1A 4HL1A 4UWPB 5LMCA 2BG7A 3AF6A 3BC2A 4C1DA 1BC2A 2YNWA 3I0VA 2HB9A 3F9OA 4PVTA 4B87A 4DIKA 2NZFA 4DILA 3IE1A 2FU6A 2BFKA 1VGNA 3X2ZA 4AD9A 5K0WA 4KEQA 1QH5A 2FK6A 2Y8BA 3FCZA 2BG6A 1KO3A 2WHGA 2FU9A 4Z60A 3SD9A 4EY2A 4V0HA 4GCWA 1K07A 4BP0A 4YSLA 3SPUA 4UAMA 3SRXA 4Z7RA 3SBLA 4Z67A 2WYMC 4H0DA 2Y8AA 3AF5A 4UWRB 4RL2A 2GKLA 4NQ4A 5HH4A 3WXCA 1DXKA 4AX0B 5B15A 5DPXA 3TP9A 1E5DA 1YCFA 4U4LA 5ACQA 4ZO2A 1M2XA 2OHJA 5K4KA 3IE2A 4XWWA 5EWAA 3Q6VA 4Z6XA 5HISA 3T9MA 2Q42A 1A7TA 2OHHA 2FHXA 2AIOA 4GYQA 5LCFA 1XTOA 4TZFA 5AYAA 5ACXA 2GCUA 5KIKA 3LVZA 3IOGA 1SMLA 1WW1A 5AJLA 5LSCA 2BC2A 5ACPA 5AHOA 3ZQ4A 5FQBA 5LCAA 4C1EA 5A0TA 1JJEA 3X30A 5KILA 1MQOA 3I11A 2FHXB 4RM5A 2GFKA 5ACTA 2NYPA 4RBSA 5LE1A 5EVDA 3P2UA 2FM6A 5HH6A 1WRAA 2A7MA 2M5DA 1ZTCA 4AWZA 4J5FA 1L9YA 2E7YA 3KNSA 3IOFA 3BV6A 4PVOA 2GMNA 4C1CA 2Q0IA 5B1UA 2Q0JA 5HIQA 1WUOA 4NQ6A 3ADRA 2YNVB 2R2DA 2P4ZA 2QINA 2ZO4A 3SFPA 3X2YA 4D1VA 3A4YA 4AXHA 2Y87A 2BFLA 2BR6A 3S0ZA 2ZNBA 2BG2A 4AWYB 4UWSB 2BFZB 1KO2A 2I7TA 3PY6A 5A5ZA 3I15A 4AV7A 4WD6A 4HL2A 3ESHA 4EYBA 2CBNA 3BK2A 4EXSA 3R2UA 4UWOB 2P97A 2YNUA 1QH3A 4NQ2A 2P18A 1BVTA 4KEPA 3X2XA 4FSBA 4RL0A 1Y44A 5LCHA 2YNTA 4NURA 4C1FA 4PDXA 3IDZA 2CG2A 5HIPA 2FU8A 3PG4A 3RKJA 2Q9UA 2CFZA 5LLDA 2ZWRA 5AXRA 3RKKA 2ZZIA 4C1HA 3ZR9A 3KNRA 1ZKPA 3IELA 2NZEA 2QDSA 2DKFA 3ZNBA 1JT1A 4YSKA 4NQ5A 1HLKA 4EYLA 2YNVA 4BZ3A 3DHAA 4D02A 4UA4A 1A8TA 5ACUA 5LS3A 3VQZA 5AHRA 4CHLA 4HKYA 2BG8A 1P9EA 3MD7A 2GFJA 2BGAA 5EW0A 3IE0A 4GYUA 3KL7A 5EV6A 2YHEA 4D1UA 5AIJA 3QH8A 2WRSA 5IQKA 4LE6A 2WYLA 4YSBA 2QJSA 3T3OA 2BIBA 3IEMA 3I13A 4TZEA
chains in the Genus database with same CATH topology
5ACVA 1YCHA 4JO0A 5A87A 2OHIA 1KR3A 3AJ3A 2UYXA 1X8GA 4XWTA 2P1EA 2BFZA 1YCGA 5FQAA 5ACRA 4ZEJA 4ZO3A 3H3EA 4FEKA 4TYTA 3DHCA 5AEBA 2VW8A 2YNTB 4C09A 2QDTA 4O98A 2I7XA 5ACSA 3DH8A 4UBQA 1VJNA 5ACWA 4D1TA 5A0VA 2YZ3A 2XF4A 3PY5A 4ZNBA 4F6HA 3FAIA 5AXOA 5K4MA 4F6ZA 2WYMA 5EV8A 5HIOA 2BG8B 1ZNBA 3G1PA 5LM6A 4EFZA 4FR7A 4XUKA 5EVKA 2AZ4A 1DDKA 1X8HA 2QEDA 5EHTA 2XR1A 2FU7A 2DOOA 4TZ9A 4EYFA 3SW3A 4AX1B 1JJTA 4TZBA 1VMEA 3VPEA 5EH9A 4C1GA 2I7VA 3RPCA 3T3NA 4D1WA 5EVBA 4J5HA 3L6NA 2YCBA 2M5CA 4RAWA 5HH5A 5K4NA 2BMIA 4EXYA 4TYFA 3ZWFA 4Z5ZA 5FQCA 1BMCA 4Z5YA 3I14A 2H6AA 3JXPA 2BTNA 5B3RA 3DHBA 4P62A 4RAMA 1WUPA 1XM8A 3IEKA 2NXAA 1X8IA 1DD6A 3BK1A 4HL1A 4UWPB 5LMCA 2BG7A 3AF6A 3BC2A 4C1DA 1BC2A 2YNWA 3I0VA 2HB9A 3F9OA 4PVTA 4B87A 4DIKA 2NZFA 4DILA 3IE1A 2FU6A 2BFKA 1VGNA 3X2ZA 4AD9A 5K0WA 4KEQA 1QH5A 2FK6A 2Y8BA 3FCZA 2BG6A 1KO3A 2WHGA 2FU9A 4Z60A 3SD9A 4EY2A 4V0HA 4GCWA 1K07A 4BP0A 4YSLA 3SPUA 4UAMA 3SRXA 4Z7RA 3SBLA 4Z67A 2WYMC 4H0DA 2Y8AA 3AF5A 4UWRB 4RL2A 2GKLA 4NQ4A 5HH4A 3WXCA 1DXKA 4AX0B 5B15A 5DPXA 3TP9A 1E5DA 1YCFA 4U4LA 5ACQA 4ZO2A 1M2XA 2OHJA 5K4KA 3IE2A 4XWWA 5EWAA 3Q6VA 4Z6XA 5HISA 3T9MA 2Q42A 1A7TA 2OHHA 2FHXA 2AIOA 4GYQA 5LCFA 1XTOA 4TZFA 5AYAA 5ACXA 2GCUA 5KIKA 3LVZA 3IOGA 1SMLA 1WW1A 5LSCA 2BC2A 5ACPA 5AHOA 3ZQ4A 5FQBA 5LCAA 4C1EA 5A0TA 1JJEA 3X30A 5KILA 1MQOA 3I11A 2FHXB 4RM5A 2GFKA 5ACTA 2NYPA 4RBSA 5LE1A 5EVDA 3P2UA 2FM6A 5HH6A 1WRAA 2A7MA 2M5DA 1ZTCA 4AWZA 4J5FA 1L9YA 2E7YA 3KNSA 3IOFA 3BV6A 4PVOA 2GMNA 4C1CA 2Q0IA 5B1UA 2Q0JA 5HIQA 1WUOA 4NQ6A 3ADRA 2YNVB 2R2DA 2P4ZA 2QINA 2ZO4A 3SFPA 3X2YA 4D1VA 3A4YA 2Y87A 2BFLA 2BR6A 3S0ZA 2ZNBA 2BG2A 4AWYB 4UWSB 2BFZB 1KO2A 2I7TA 3PY6A 5A5ZA 3I15A 4WD6A 4HL2A 3ESHA 4EYBA 2CBNA 3BK2A 4EXSA 3R2UA 4UWOB 2P97A 2YNUA 1QH3A 4NQ2A 2P18A 1BVTA 4KEPA 3X2XA 4FSBA 4RL0A 1Y44A 5LCHA 2YNTA 4C1FA 3IDZA 5HIPA 2FU8A 3PG4A 3RKJA 2Q9UA 5LLDA 2ZWRA 5AXRA 3RKKA 2ZZIA 4C1HA 3ZR9A 3KNRA 1ZKPA 3IELA 2NZEA 2QDSA 2DKFA 3ZNBA 1JT1A 4YSKA 4NQ5A 1HLKA 4EYLA 2YNVA 4BZ3A 3DHAA 4D02A 4UA4A 1A8TA 5ACUA 5LS3A 3VQZA 5AHRA 4CHLA 4HKYA 2BG8A 1P9EA 3MD7A 2GFJA 2BGAA 5EW0A 3IE0A 4GYUA 3KL7A 5EV6A 4D1UA 3QH8A 2WRSA 5IQKA 4LE6A 2WYLA 4YSBA 2QJSA 3T3OA 2BIBA 3IEMA 3I13A 4TZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ACV A;  1YCH A;  4JO0 A;  5A87 A;  2OHI A;  1KR3 A;  3AJ3 A;  2UYX A;  1X8G A;  4XWT A;  2P1E A;  2BFZ A;  1YCG A;  5FQA A;  5ACR A;  4ZEJ A;  4ZO3 A;  3H3E A;  4FEK A;  4TYT A;  3DHC A;  5AEB A;  2VW8 A;  2YNT B;  4C09 A;  2QDT A;  4O98 A;  2I7X A;  5ACS A;  3DH8 A;  4UBQ A;  1VJN A;  5ACW A;  4D1T A;  5A0V A;  2YZ3 A;  2XF4 A;  3PY5 A;  4ZNB A;  4F6H A;  3FAI A;  5AXO A;  5K4M A;  4F6Z A;  2WYM A;  5EV8 A;  5HIO A;  2BG8 B;  1ZNB A;  3G1P A;  5LM6 A;  4EFZ A;  4FR7 A;  4XUK A;  5EVK A;  2AZ4 A;  1DDK A;  1X8H A;  2QED A;  5EHT A;  2XR1 A;  2FU7 A;  2DOO A;  4TZ9 A;  4EYF A;  3SW3 A;  4AX1 B;  1JJT A;  4TZB A;  1VME A;  3VPE A;  5EH9 A;  4C1G A;  2I7V A;  3RPC A;  3T3N A;  4D1W A;  5EVB A;  4J5H A;  3L6N A;  2YCB A;  2M5C A;  4RAW A;  5HH5 A;  5K4N A;  2BMI A;  4EXY A;  4TYF A;  3ZWF A;  4Z5Z A;  5FQC A;  1BMC A;  4Z5Y A;  3I14 A;  2H6A A;  3JXP A;  2BTN A;  5B3R A;  3DHB A;  4P62 A;  4RAM A;  1WUP A;  1XM8 A;  3IEK A;  2NXA A;  1X8I A;  1DD6 A;  3BK1 A;  4HL1 A;  4UWP B;  5LMC A;  2BG7 A;  3AF6 A;  3BC2 A;  4C1D A;  1BC2 A;  2YNW A;  3I0V A;  2HB9 A;  3F9O A;  4PVT A;  4B87 A;  4DIK A;  2NZF A;  4DIL A;  3IE1 A;  2FU6 A;  2BFK A;  1VGN A;  3X2Z A;  4AD9 A;  5K0W A;  4KEQ A;  1QH5 A;  2FK6 A;  2Y8B A;  3FCZ A;  2BG6 A;  1KO3 A;  2WHG A;  2FU9 A;  4Z60 A;  3SD9 A;  4EY2 A;  4V0H A;  4GCW A;  1K07 A;  4BP0 A;  4YSL A;  3SPU A;  4UAM A;  3SRX A;  4Z7R A;  3SBL A;  4Z67 A;  2WYM C;  4H0D A;  2Y8A A;  3AF5 A;  4UWR B;  4RL2 A;  2GKL A;  4NQ4 A;  5HH4 A;  3WXC A;  1DXK A;  4AX0 B;  5B15 A;  5DPX A;  3TP9 A;  1E5D A;  1YCF A;  4U4L A;  5ACQ A;  4ZO2 A;  1M2X A;  2OHJ A;  5K4K A;  3IE2 A;  4XWW A;  5EWA A;  3Q6V A;  4Z6X A;  5HIS A;  3T9M A;  2Q42 A;  1A7T A;  2OHH A;  2FHX A;  2AIO A;  4GYQ A;  5LCF A;  1XTO A;  4TZF A;  5AYA A;  5ACX A;  2GCU A;  5KIK A;  3LVZ A;  3IOG A;  1SML A;  1WW1 A;  5LSC A;  2BC2 A;  5ACP A;  5AHO A;  3ZQ4 A;  5FQB A;  5LCA A;  4C1E A;  5A0T A;  1JJE A;  3X30 A;  5KIL A;  1MQO A;  3I11 A;  2FHX B;  4RM5 A;  2GFK A;  5ACT A;  2NYP A;  4RBS A;  5LE1 A;  5EVD A;  3P2U A;  2FM6 A;  5HH6 A;  1WRA A;  2A7M A;  2M5D A;  1ZTC A;  4AWZ A;  4J5F A;  1L9Y A;  2E7Y A;  3KNS A;  3IOF A;  3BV6 A;  4PVO A;  2GMN A;  4C1C A;  2Q0I A;  5B1U A;  2Q0J A;  5HIQ A;  1WUO A;  4NQ6 A;  3ADR A;  2YNV B;  2R2D A;  2P4Z A;  2QIN A;  2ZO4 A;  3SFP A;  3X2Y A;  4D1V A;  3A4Y A;  2Y87 A;  2BFL A;  2BR6 A;  3S0Z A;  2ZNB A;  2BG2 A;  4AWY B;  4UWS B;  2BFZ B;  1KO2 A;  2I7T A;  3PY6 A;  5A5Z A;  3I15 A;  4WD6 A;  4HL2 A;  3ESH A;  4EYB A;  2CBN A;  3BK2 A;  4EXS A;  3R2U A;  4UWO B;  2P97 A;  2YNU A;  1QH3 A;  4NQ2 A;  2P18 A;  1BVT A;  4KEP A;  3X2X A;  4FSB A;  4RL0 A;  1Y44 A;  5LCH A;  2YNT A;  4C1F A;  3IDZ A;  5HIP A;  2FU8 A;  3PG4 A;  3RKJ A;  2Q9U A;  5LLD A;  2ZWR A;  5AXR A;  3RKK A;  2ZZI A;  4C1H A;  3ZR9 A;  3KNR A;  1ZKP A;  3IEL A;  2NZE A;  2QDS A;  2DKF A;  3ZNB A;  1JT1 A;  4YSK A;  4NQ5 A;  1HLK A;  4EYL A;  2YNV A;  4BZ3 A;  3DHA A;  4D02 A;  4UA4 A;  1A8T A;  5ACU A;  5LS3 A;  3VQZ A;  5AHR A;  4CHL A;  4HKY A;  2BG8 A;  1P9E A;  3MD7 A;  2GFJ A;  2BGA A;  5EW0 A;  3IE0 A;  4GYU A;  3KL7 A;  5EV6 A;  4D1U A;  3QH8 A;  2WRS A;  5IQK A;  4LE6 A;  2WYL A;  4YSB A;  2QJS A;  3T3O A;  2BIB A;  3IEM A;  3I13 A;  4TZE A; 
#chains in the Genus database with same CATH topology
 5ACV A;  1YCH A;  4JO0 A;  5A87 A;  2OHI A;  1KR3 A;  3AJ3 A;  2UYX A;  1X8G A;  4XWT A;  2P1E A;  2BFZ A;  1YCG A;  5A23 A;  5FQA A;  5ACR A;  4ZEJ A;  4ZO3 A;  3H3E A;  4FEK A;  4TYT A;  3DHC A;  5AEB A;  2CFU A;  2VW8 A;  2YNT B;  4C09 A;  2QDT A;  4O98 A;  2I7X A;  5ACS A;  3DH8 A;  4UBQ A;  1VJN A;  5ACW A;  2CG3 A;  4D1T A;  5A0V A;  2YZ3 A;  2XF4 A;  3PY5 A;  4ZNB A;  4F6H A;  3FAI A;  5AXO A;  5K4M A;  4F6Z A;  2WYM A;  5EV8 A;  5HIO A;  2BG8 B;  1ZNB A;  3G1P A;  5LM6 A;  4EFZ A;  4FR7 A;  4XUK A;  5EVK A;  2AZ4 A;  1DDK A;  1X8H A;  2QED A;  5EHT A;  2XR1 A;  2FU7 A;  2DOO A;  4TZ9 A;  4EYF A;  3SW3 A;  4AX1 B;  1JJT A;  4TZB A;  1VME A;  3VPE A;  5EH9 A;  4C1G A;  2I7V A;  3RPC A;  3T3N A;  4D1W A;  5EVB A;  4J5H A;  3L6N A;  2YCB A;  2M5C A;  4RAW A;  5HH5 A;  5K4N A;  2BMI A;  4EXY A;  4TYF A;  3ZWF A;  4Z5Z A;  5FQC A;  1BMC A;  4Z5Y A;  3I14 A;  2H6A A;  3JXP A;  2BTN A;  5B3R A;  3DHB A;  4P62 A;  4RAM A;  1WUP A;  1XM8 A;  3IEK A;  2NXA A;  1X8I A;  1DD6 A;  3BK1 A;  4HL1 A;  4UWP B;  5LMC A;  2BG7 A;  3AF6 A;  3BC2 A;  4C1D A;  1BC2 A;  2YNW A;  3I0V A;  2HB9 A;  3F9O A;  4PVT A;  4B87 A;  4DIK A;  2NZF A;  4DIL A;  3IE1 A;  2FU6 A;  2BFK A;  1VGN A;  3X2Z A;  4AD9 A;  5K0W A;  4KEQ A;  1QH5 A;  2FK6 A;  2Y8B A;  3FCZ A;  2BG6 A;  1KO3 A;  2WHG A;  2FU9 A;  4Z60 A;  3SD9 A;  4EY2 A;  4V0H A;  4GCW A;  1K07 A;  4BP0 A;  4YSL A;  3SPU A;  4UAM A;  3SRX A;  4Z7R A;  3SBL A;  4Z67 A;  2WYM C;  4H0D A;  2Y8A A;  3AF5 A;  4UWR B;  4RL2 A;  2GKL A;  4NQ4 A;  5HH4 A;  3WXC A;  1DXK A;  4AX0 B;  5B15 A;  5DPX A;  3TP9 A;  1E5D A;  1YCF A;  4U4L A;  5ACQ A;  4ZO2 A;  1M2X A;  2OHJ A;  5K4K A;  3IE2 A;  4XWW A;  5EWA A;  3Q6V A;  4Z6X A;  5HIS A;  3T9M A;  2Q42 A;  1A7T A;  2OHH A;  2FHX A;  2AIO A;  4GYQ A;  5LCF A;  1XTO A;  4TZF A;  5AYA A;  5ACX A;  2GCU A;  5KIK A;  3LVZ A;  3IOG A;  1SML A;  1WW1 A;  5AJL A;  5LSC A;  2BC2 A;  5ACP A;  5AHO A;  3ZQ4 A;  5FQB A;  5LCA A;  4C1E A;  5A0T A;  1JJE A;  3X30 A;  5KIL A;  1MQO A;  3I11 A;  2FHX B;  4RM5 A;  2GFK A;  5ACT A;  2NYP A;  4RBS A;  5LE1 A;  5EVD A;  3P2U A;  2FM6 A;  5HH6 A;  1WRA A;  2A7M A;  2M5D A;  1ZTC A;  4AWZ A;  4J5F A;  1L9Y A;  2E7Y A;  3KNS A;  3IOF A;  3BV6 A;  4PVO A;  2GMN A;  4C1C A;  2Q0I A;  5B1U A;  2Q0J A;  5HIQ A;  1WUO A;  4NQ6 A;  3ADR A;  2YNV B;  2R2D A;  2P4Z A;  2QIN A;  2ZO4 A;  3SFP A;  3X2Y A;  4D1V A;  3A4Y A;  4AXH A;  2Y87 A;  2BFL A;  2BR6 A;  3S0Z A;  2ZNB A;  2BG2 A;  4AWY B;  4UWS B;  2BFZ B;  1KO2 A;  2I7T A;  3PY6 A;  5A5Z A;  3I15 A;  4AV7 A;  4WD6 A;  4HL2 A;  3ESH A;  4EYB A;  2CBN A;  3BK2 A;  4EXS A;  3R2U A;  4UWO B;  2P97 A;  2YNU A;  1QH3 A;  4NQ2 A;  2P18 A;  1BVT A;  4KEP A;  3X2X A;  4FSB A;  4RL0 A;  1Y44 A;  5LCH A;  2YNT A;  4NUR A;  4C1F A;  4PDX A;  3IDZ A;  2CG2 A;  5HIP A;  2FU8 A;  3PG4 A;  3RKJ A;  2Q9U A;  2CFZ A;  5LLD A;  2ZWR A;  5AXR A;  3RKK A;  2ZZI A;  4C1H A;  3ZR9 A;  3KNR A;  1ZKP A;  3IEL A;  2NZE A;  2QDS A;  2DKF A;  3ZNB A;  1JT1 A;  4YSK A;  4NQ5 A;  1HLK A;  4EYL A;  2YNV A;  4BZ3 A;  3DHA A;  4D02 A;  4UA4 A;  1A8T A;  5ACU A;  5LS3 A;  3VQZ A;  5AHR A;  4CHL A;  4HKY A;  2BG8 A;  1P9E A;  3MD7 A;  2GFJ A;  2BGA A;  5EW0 A;  3IE0 A;  4GYU A;  3KL7 A;  5EV6 A;  2YHE A;  4D1U A;  5AIJ A;  3QH8 A;  2WRS A;  5IQK A;  4LE6 A;  2WYL A;  4YSB A;  2QJS A;  3T3O A;  2BIB A;  3IEM A;  3I13 A;  4TZE A; 
#chains in the Genus database with same CATH homology
 5ACV A;  1YCH A;  4JO0 A;  5A87 A;  2OHI A;  1KR3 A;  3AJ3 A;  2UYX A;  1X8G A;  4XWT A;  2P1E A;  2BFZ A;  1YCG A;  5FQA A;  5ACR A;  4ZEJ A;  4ZO3 A;  3H3E A;  4FEK A;  4TYT A;  3DHC A;  5AEB A;  2VW8 A;  2YNT B;  4C09 A;  2QDT A;  4O98 A;  2I7X A;  5ACS A;  3DH8 A;  4UBQ A;  1VJN A;  5ACW A;  4D1T A;  5A0V A;  2YZ3 A;  2XF4 A;  3PY5 A;  4ZNB A;  4F6H A;  3FAI A;  5AXO A;  5K4M A;  4F6Z A;  2WYM A;  5EV8 A;  5HIO A;  2BG8 B;  1ZNB A;  3G1P A;  5LM6 A;  4EFZ A;  4FR7 A;  4XUK A;  5EVK A;  2AZ4 A;  1DDK A;  1X8H A;  2QED A;  5EHT A;  2XR1 A;  2FU7 A;  2DOO A;  4TZ9 A;  4EYF A;  3SW3 A;  4AX1 B;  1JJT A;  4TZB A;  1VME A;  3VPE A;  5EH9 A;  4C1G A;  2I7V A;  3RPC A;  3T3N A;  4D1W A;  5EVB A;  4J5H A;  3L6N A;  2YCB A;  2M5C A;  4RAW A;  5HH5 A;  5K4N A;  2BMI A;  4EXY A;  4TYF A;  3ZWF A;  4Z5Z A;  5FQC A;  1BMC A;  4Z5Y A;  3I14 A;  2H6A A;  3JXP A;  2BTN A;  5B3R A;  3DHB A;  4P62 A;  4RAM A;  1WUP A;  1XM8 A;  3IEK A;  2NXA A;  1X8I A;  1DD6 A;  3BK1 A;  4HL1 A;  4UWP B;  5LMC A;  2BG7 A;  3AF6 A;  3BC2 A;  4C1D A;  1BC2 A;  2YNW A;  3I0V A;  2HB9 A;  3F9O A;  4PVT A;  4B87 A;  4DIK A;  2NZF A;  4DIL A;  3IE1 A;  2FU6 A;  2BFK A;  1VGN A;  3X2Z A;  4AD9 A;  5K0W A;  4KEQ A;  1QH5 A;  2FK6 A;  2Y8B A;  3FCZ A;  2BG6 A;  1KO3 A;  2WHG A;  2FU9 A;  4Z60 A;  3SD9 A;  4EY2 A;  4V0H A;  4GCW A;  1K07 A;  4BP0 A;  4YSL A;  3SPU A;  4UAM A;  3SRX A;  4Z7R A;  3SBL A;  4Z67 A;  2WYM C;  4H0D A;  2Y8A A;  3AF5 A;  4UWR B;  4RL2 A;  2GKL A;  4NQ4 A;  5HH4 A;  3WXC A;  1DXK A;  4AX0 B;  5B15 A;  5DPX A;  3TP9 A;  1E5D A;  1YCF A;  4U4L A;  5ACQ A;  4ZO2 A;  1M2X A;  2OHJ A;  5K4K A;  3IE2 A;  4XWW A;  5EWA A;  3Q6V A;  4Z6X A;  5HIS A;  3T9M A;  2Q42 A;  1A7T A;  2OHH A;  2FHX A;  2AIO A;  4GYQ A;  5LCF A;  1XTO A;  4TZF A;  5AYA A;  5ACX A;  2GCU A;  5KIK A;  3LVZ A;  3IOG A;  1SML A;  1WW1 A;  5LSC A;  2BC2 A;  5ACP A;  5AHO A;  3ZQ4 A;  5FQB A;  5LCA A;  4C1E A;  5A0T A;  1JJE A;  3X30 A;  5KIL A;  1MQO A;  3I11 A;  2FHX B;  4RM5 A;  2GFK A;  5ACT A;  2NYP A;  4RBS A;  5LE1 A;  5EVD A;  3P2U A;  2FM6 A;  5HH6 A;  1WRA A;  2A7M A;  2M5D A;  1ZTC A;  4AWZ A;  4J5F A;  1L9Y A;  2E7Y A;  3KNS A;  3IOF A;  3BV6 A;  4PVO A;  2GMN A;  4C1C A;  2Q0I A;  5B1U A;  2Q0J A;  5HIQ A;  1WUO A;  4NQ6 A;  3ADR A;  2YNV B;  2R2D A;  2P4Z A;  2QIN A;  2ZO4 A;  3SFP A;  3X2Y A;  4D1V A;  3A4Y A;  2Y87 A;  2BFL A;  2BR6 A;  3S0Z A;  2ZNB A;  2BG2 A;  4AWY B;  4UWS B;  2BFZ B;  1KO2 A;  2I7T A;  3PY6 A;  5A5Z A;  3I15 A;  4WD6 A;  4HL2 A;  3ESH A;  4EYB A;  2CBN A;  3BK2 A;  4EXS A;  3R2U A;  4UWO B;  2P97 A;  2YNU A;  1QH3 A;  4NQ2 A;  2P18 A;  1BVT A;  4KEP A;  3X2X A;  4FSB A;  4RL0 A;  1Y44 A;  5LCH A;  2YNT A;  4C1F A;  3IDZ A;  5HIP A;  2FU8 A;  3PG4 A;  3RKJ A;  2Q9U A;  5LLD A;  2ZWR A;  5AXR A;  3RKK A;  2ZZI A;  4C1H A;  3ZR9 A;  3KNR A;  1ZKP A;  3IEL A;  2NZE A;  2QDS A;  2DKF A;  3ZNB A;  1JT1 A;  4YSK A;  4NQ5 A;  1HLK A;  4EYL A;  2YNV A;  4BZ3 A;  3DHA A;  4D02 A;  4UA4 A;  1A8T A;  5ACU A;  5LS3 A;  3VQZ A;  5AHR A;  4CHL A;  4HKY A;  2BG8 A;  1P9E A;  3MD7 A;  2GFJ A;  2BGA A;  5EW0 A;  3IE0 A;  4GYU A;  3KL7 A;  5EV6 A;  4D1U A;  3QH8 A;  2WRS A;  5IQK A;  4LE6 A;  2WYL A;  4YSB A;  2QJS A;  3T3O A;  2BIB A;  3IEM A;  3I13 A;  4TZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...