4J5HA

Crystal structure of b. thuringiensis aiia mutant f107w with n-decanoyl-l-homoserine bound at the active site
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
250
structure length
250
Chain Sequence
MTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHWDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIETEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase substrate
molecule keywords N-acyl homoserine lactonase
publication title A phenylalanine clamp controls substrate specificity in the quorum-quenching metallo-gamma-lactonase from Bacillus thuringiensis.
pubmed doi rcsb
source organism Bacillus thuringiensis
total genus 82
structure length 250
sequence length 250
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2013-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4j5hA01
3BC2A 2GMNA 4ZO2A 4J5HA 2YNUA 2FU6A 2WYMC 5KILA 3I13A 1SMLA 4NQ6A 1KO2A 2WYMA 5EW0A 3AF6A 3BV6A 2NYPA 4TZBA 2YCBA 5LCFA 4D1TA 1BC2A 2BG6A 1YCGA 5FQAA 3L6NA 3T3NA 4AWZA 4FEKA 5K4MA 4KEQA 1X8HA 5AHOA 3F9OA 2R2DA 4WD6A 4NQ5A 1BMCA 2BFZB 5LM6A 3ADRA 4BZ3A 1JJTA 5LLDA 2NXAA 3X2YA 5IQKA 3X30A 5AEBA 4GCWA 2GKLA 3WXCA 1VJNA 3X2ZA 2ZNBA 4YSKA 3LVZA 4AD9A 2ZO4A 1A7TA 3ZWFA 2CBNA 3MD7A 5HISA 2GCUA 5LE1A 3RKJA 2Y8BA 2Q0IA 2OHIA 4RL0A 4HKYA 4XWTA 3IEKA 3I11A 3PY5A 1YCHA 5HIOA 3AF5A 4AX1B 4XUKA 4TYTA 4D1VA 2BMIA 5LCAA 1E5DA 3SW3A 2NZEA 4EXSA 4EXYA 5A87A 3IELA 2QDTA 2P97A 3X2XA 4BP0A 2H6AA 3PY6A 2QJSA 4ZO3A 2Q0JA 2YNWA 3IOGA 1DDKA 5ACRA 3T3OA 5B3RA 4V0HA 1L9YA 4NQ4A 4C1GA 5AXOA 4Z5YA 2I7TA 2WYLA 3DH8A 5LS3A 4PVOA 1JJEA 4D02A 4GYUA 5B1UA 4Z60A 2M5CA 2P1EA 5HH5A 2BFZA 2YNVB 5EV8A 5FQBA 2P4ZA 1HLKA 4YSBA 5K4NA 3IE1A 4AWYB 2BR6A 2Q9UA 1DXKA 2I7XA 1VMEA 2WHGA 4KEPA 5ACTA 4UBQA 2XR1A 4Z5ZA 4U4LA 2M5DA 2BFKA 4EFZA 3R2UA 2FU7A 5AHRA 1VGNA 2OHHA 4XWWA 2FHXB 5ACWA 4DILA 5ACSA 5EHTA 2BGAA 4TYFA 1P9EA 2QDSA 1MQOA 2AIOA 1ZKPA 3Q6VA 1KR3A 4PVTA 4RAWA 4AX0B 3DHCA 4B87A 5LSCA 2DOOA 4RL2A 5A0VA 1ZNBA 5A5ZA 3KL7A 4CHLA 4Z67A 3DHAA 2HB9A 2BG8B 3IOFA 2WRSA 5KIKA 2ZZIA 5EVDA 2FM6A 1WUOA 5EVKA 5ACQA 2A7MA 5FQCA 2Y8AA 3IE2A 3JXPA 1YCFA 2Y87A 2YNTB 4F6HA 1K07A 3TP9A 3RPCA 3FCZA 4C1FA 2BC2A 5K0WA 3RKKA 4EY2A 1A8TA 4ZNBA 4EYLA 5HIPA 4J5FA 3I14A 2YNVA 3T9MA 2P18A 5ACUA 2YZ3A 3ZQ4A 4D1UA 3IEMA 1ZTCA 4FSBA 1WRAA 3PG4A 4P62A 2I7VA 3A4YA 1DD6A 1KO3A 3ESHA 4UA4A 2NZFA 4UWRB 2GFJA 5AXRA 5ACXA 3SPUA 5ACPA 3KNSA 4F6ZA 2UYXA 5HH6A 4LE6A 3ZR9A 2FHXA 4Z6XA 4HL1A 5ACVA 2DKFA 2ZWRA 4TZ9A 4C09A 3SFPA 2QEDA 2BIBA 2OHJA 5EH9A 2E7YA 4EYFA 4RAMA 3QH8A 4UWPB 1QH5A 2Q42A 4TZFA 1BVTA 2FU9A 4RM5A 3SD9A 4ZEJA 1M2XA 3FAIA 1WUPA 1X8IA 4FR7A 4JO0A 3VPEA 2BG8A 4EYBA 4GYQA 3I0VA 1XM8A 2BFLA 3S0ZA 5HH4A 4HL2A 2YNTA 3BK2A 4TZEA 2BG7A 4UAMA 1Y44A 3VQZA 5LCHA 4D1WA 1JT1A 5EWAA 4NQ2A 3BK1A 3IE0A 4UWOB 1XTOA 4C1HA 4RBSA 3G1PA 3KNRA 5B15A 4UWSB 1QH3A 2XF4A 3SBLA 3H3EA 2AZ4A 5LMCA 2QINA 2BTNA 5DPXA 5EV6A 2BG2A 3P2UA 2FU8A 2GFKA 3AJ3A 3ZNBA 4Z7RA 4YSLA 2FK6A 3SRXA 1WW1A 4DIKA 4O98A 4C1CA 4H0DA 5K4KA 3IDZA 5HIQA 4C1EA 5EVBA 1X8GA 2VW8A 5AYAA 4C1DA 3I15A 5A0TA 3DHBA
chains in the Genus database with same CATH superfamily
3BC2A 2GMNA 4ZO2A 4J5HA 2YNUA 2FU6A 2WYMC 5KILA 3I13A 1SMLA 4NQ6A 1KO2A 2WYMA 5EW0A 3AF6A 3BV6A 2NYPA 5AJLA 4TZBA 2YCBA 5LCFA 4D1TA 1BC2A 2BG6A 1YCGA 5FQAA 3L6NA 3T3NA 4AWZA 4FEKA 5K4MA 4KEQA 1X8HA 5AHOA 3F9OA 2R2DA 4WD6A 4NQ5A 1BMCA 2BFZB 5LM6A 3ADRA 4BZ3A 1JJTA 5LLDA 2NXAA 3X2YA 5IQKA 3X30A 5AEBA 4GCWA 2GKLA 3WXCA 1VJNA 3X2ZA 2ZNBA 4YSKA 3LVZA 4AD9A 2ZO4A 1A7TA 3ZWFA 2CBNA 3MD7A 5HISA 2GCUA 2CFUA 5LE1A 3RKJA 4PDXA 2Y8BA 2Q0IA 2OHIA 4RL0A 4HKYA 4XWTA 3IEKA 3I11A 3PY5A 1YCHA 5HIOA 3AF5A 4AX1B 4XUKA 4TYTA 4D1VA 2BMIA 5LCAA 1E5DA 3SW3A 2NZEA 4EXSA 4EXYA 5A87A 3IELA 2QDTA 2P97A 3X2XA 4BP0A 2H6AA 3PY6A 2QJSA 4ZO3A 2Q0JA 2YNWA 3IOGA 1DDKA 5ACRA 3T3OA 5B3RA 4V0HA 1L9YA 4NQ4A 4C1GA 5AXOA 4Z5YA 2I7TA 2WYLA 3DH8A 5LS3A 4PVOA 1JJEA 2CG3A 4D02A 4GYUA 4NURA 5B1UA 4Z60A 2M5CA 2P1EA 5HH5A 2BFZA 2YNVB 5EV8A 5FQBA 2P4ZA 1HLKA 4YSBA 5K4NA 3IE1A 4AWYB 2BR6A 2Q9UA 1DXKA 2I7XA 1VMEA 2WHGA 4KEPA 5ACTA 4UBQA 2XR1A 4Z5ZA 4U4LA 2M5DA 2BFKA 4EFZA 3R2UA 2FU7A 5AHRA 1VGNA 4AXHA 2OHHA 4XWWA 2FHXB 5ACWA 4DILA 5ACSA 5EHTA 2BGAA 4TYFA 1P9EA 2QDSA 1MQOA 2AIOA 1ZKPA 3Q6VA 1KR3A 4PVTA 4RAWA 4AX0B 3DHCA 4B87A 5LSCA 2DOOA 4RL2A 5A0VA 1ZNBA 5A5ZA 3KL7A 4CHLA 2YHEA 4Z67A 3DHAA 2HB9A 2BG8B 3IOFA 2WRSA 5KIKA 2ZZIA 5EVDA 2FM6A 1WUOA 5EVKA 5ACQA 2A7MA 5FQCA 2Y8AA 3IE2A 3JXPA 1YCFA 2Y87A 2YNTB 4F6HA 1K07A 3TP9A 3RPCA 3FCZA 4C1FA 2BC2A 5K0WA 3RKKA 4EY2A 1A8TA 4ZNBA 4EYLA 5HIPA 4J5FA 3I14A 2YNVA 3T9MA 2P18A 5ACUA 2YZ3A 3ZQ4A 4D1UA 3IEMA 1ZTCA 4FSBA 1WRAA 3PG4A 4AV7A 4P62A 2I7VA 3A4YA 1DD6A 1KO3A 3ESHA 4UA4A 2NZFA 4UWRB 2GFJA 5AXRA 5ACXA 3SPUA 5ACPA 3KNSA 4F6ZA 2UYXA 5HH6A 4LE6A 5AIJA 3ZR9A 2FHXA 4Z6XA 4HL1A 5ACVA 2DKFA 2ZWRA 4TZ9A 4C09A 3SFPA 2CFZA 2QEDA 2BIBA 2OHJA 5EH9A 2E7YA 4EYFA 4RAMA 3QH8A 4UWPB 1QH5A 2Q42A 4TZFA 1BVTA 2FU9A 4RM5A 3SD9A 4ZEJA 1M2XA 3FAIA 1WUPA 1X8IA 4FR7A 4JO0A 3VPEA 2BG8A 4EYBA 4GYQA 3I0VA 1XM8A 5A23A 2BFLA 3S0ZA 5HH4A 4HL2A 2YNTA 3BK2A 4TZEA 2BG7A 4UAMA 1Y44A 3VQZA 5LCHA 4D1WA 1JT1A 5EWAA 4NQ2A 3BK1A 3IE0A 4UWOB 1XTOA 4C1HA 4RBSA 3G1PA 3KNRA 5B15A 4UWSB 1QH3A 2XF4A 3SBLA 3H3EA 2AZ4A 5LMCA 2QINA 2BTNA 5DPXA 2CG2A 5EV6A 2BG2A 3P2UA 2FU8A 2GFKA 3AJ3A 3ZNBA 4Z7RA 4YSLA 2FK6A 3SRXA 1WW1A 4DIKA 4O98A 4C1CA 4H0DA 5K4KA 3IDZA 5HIQA 4C1EA 5EVBA 1X8GA 2VW8A 5AYAA 4C1DA 3I15A 5A0TA 3DHBA
chains in the Genus database with same CATH topology
3BC2A 2GMNA 4ZO2A 4J5HA 2YNUA 2FU6A 2WYMC 5KILA 3I13A 1SMLA 4NQ6A 1KO2A 2WYMA 5EW0A 3AF6A 3BV6A 2NYPA 4TZBA 2YCBA 5LCFA 4D1TA 1BC2A 2BG6A 1YCGA 5FQAA 3L6NA 3T3NA 4AWZA 4FEKA 5K4MA 4KEQA 1X8HA 5AHOA 3F9OA 2R2DA 4WD6A 4NQ5A 1BMCA 2BFZB 5LM6A 3ADRA 4BZ3A 1JJTA 5LLDA 2NXAA 3X2YA 5IQKA 3X30A 5AEBA 4GCWA 2GKLA 3WXCA 1VJNA 3X2ZA 2ZNBA 4YSKA 3LVZA 4AD9A 2ZO4A 1A7TA 3ZWFA 2CBNA 3MD7A 5HISA 2GCUA 5LE1A 3RKJA 2Y8BA 2Q0IA 2OHIA 4RL0A 4HKYA 4XWTA 3IEKA 3I11A 3PY5A 1YCHA 5HIOA 3AF5A 4AX1B 4XUKA 4TYTA 4D1VA 2BMIA 5LCAA 1E5DA 3SW3A 2NZEA 4EXSA 4EXYA 5A87A 3IELA 2QDTA 2P97A 3X2XA 4BP0A 2H6AA 3PY6A 2QJSA 4ZO3A 2Q0JA 2YNWA 3IOGA 1DDKA 5ACRA 3T3OA 5B3RA 4V0HA 1L9YA 4NQ4A 4C1GA 5AXOA 4Z5YA 2I7TA 2WYLA 3DH8A 5LS3A 4PVOA 1JJEA 4D02A 4GYUA 5B1UA 4Z60A 2M5CA 2P1EA 5HH5A 2BFZA 2YNVB 5EV8A 5FQBA 2P4ZA 1HLKA 4YSBA 5K4NA 3IE1A 4AWYB 2BR6A 2Q9UA 1DXKA 2I7XA 1VMEA 2WHGA 4KEPA 5ACTA 4UBQA 2XR1A 4Z5ZA 4U4LA 2M5DA 2BFKA 4EFZA 3R2UA 2FU7A 5AHRA 1VGNA 2OHHA 4XWWA 2FHXB 5ACWA 4DILA 5ACSA 5EHTA 2BGAA 4TYFA 1P9EA 2QDSA 1MQOA 2AIOA 1ZKPA 3Q6VA 1KR3A 4PVTA 4RAWA 4AX0B 3DHCA 4B87A 5LSCA 2DOOA 4RL2A 5A0VA 1ZNBA 5A5ZA 3KL7A 4CHLA 4Z67A 3DHAA 2HB9A 2BG8B 3IOFA 2WRSA 5KIKA 2ZZIA 5EVDA 2FM6A 1WUOA 5EVKA 5ACQA 2A7MA 5FQCA 2Y8AA 3IE2A 3JXPA 1YCFA 2Y87A 2YNTB 4F6HA 1K07A 3TP9A 3RPCA 3FCZA 4C1FA 2BC2A 5K0WA 3RKKA 4EY2A 1A8TA 4ZNBA 4EYLA 5HIPA 4J5FA 3I14A 2YNVA 3T9MA 2P18A 5ACUA 2YZ3A 3ZQ4A 4D1UA 3IEMA 1ZTCA 4FSBA 1WRAA 3PG4A 4P62A 2I7VA 3A4YA 1DD6A 1KO3A 3ESHA 4UA4A 2NZFA 4UWRB 2GFJA 5AXRA 5ACXA 3SPUA 5ACPA 3KNSA 4F6ZA 2UYXA 5HH6A 4LE6A 3ZR9A 2FHXA 4Z6XA 4HL1A 5ACVA 2DKFA 2ZWRA 4TZ9A 4C09A 3SFPA 2QEDA 2BIBA 2OHJA 5EH9A 2E7YA 4EYFA 4RAMA 3QH8A 4UWPB 1QH5A 2Q42A 4TZFA 1BVTA 2FU9A 4RM5A 3SD9A 4ZEJA 1M2XA 3FAIA 1WUPA 1X8IA 4FR7A 4JO0A 3VPEA 2BG8A 4EYBA 4GYQA 3I0VA 1XM8A 2BFLA 3S0ZA 5HH4A 4HL2A 2YNTA 3BK2A 4TZEA 2BG7A 4UAMA 1Y44A 3VQZA 5LCHA 4D1WA 1JT1A 5EWAA 4NQ2A 3BK1A 3IE0A 4UWOB 1XTOA 4C1HA 4RBSA 3G1PA 3KNRA 5B15A 4UWSB 1QH3A 2XF4A 3SBLA 3H3EA 2AZ4A 5LMCA 2QINA 2BTNA 5DPXA 5EV6A 2BG2A 3P2UA 2FU8A 2GFKA 3AJ3A 3ZNBA 4Z7RA 4YSLA 2FK6A 3SRXA 1WW1A 4DIKA 4O98A 4C1CA 4H0DA 5K4KA 3IDZA 5HIQA 4C1EA 5EVBA 1X8GA 2VW8A 5AYAA 4C1DA 3I15A 5A0TA 3DHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BC2 A;  2GMN A;  4ZO2 A;  4J5H A;  2YNU A;  2FU6 A;  2WYM C;  5KIL A;  3I13 A;  1SML A;  4NQ6 A;  1KO2 A;  2WYM A;  5EW0 A;  3AF6 A;  3BV6 A;  2NYP A;  4TZB A;  2YCB A;  5LCF A;  4D1T A;  1BC2 A;  2BG6 A;  1YCG A;  5FQA A;  3L6N A;  3T3N A;  4AWZ A;  4FEK A;  5K4M A;  4KEQ A;  1X8H A;  5AHO A;  3F9O A;  2R2D A;  4WD6 A;  4NQ5 A;  1BMC A;  2BFZ B;  5LM6 A;  3ADR A;  4BZ3 A;  1JJT A;  5LLD A;  2NXA A;  3X2Y A;  5IQK A;  3X30 A;  5AEB A;  4GCW A;  2GKL A;  3WXC A;  1VJN A;  3X2Z A;  2ZNB A;  4YSK A;  3LVZ A;  4AD9 A;  2ZO4 A;  1A7T A;  3ZWF A;  2CBN A;  3MD7 A;  5HIS A;  2GCU A;  5LE1 A;  3RKJ A;  2Y8B A;  2Q0I A;  2OHI A;  4RL0 A;  4HKY A;  4XWT A;  3IEK A;  3I11 A;  3PY5 A;  1YCH A;  5HIO A;  3AF5 A;  4AX1 B;  4XUK A;  4TYT A;  4D1V A;  2BMI A;  5LCA A;  1E5D A;  3SW3 A;  2NZE A;  4EXS A;  4EXY A;  5A87 A;  3IEL A;  2QDT A;  2P97 A;  3X2X A;  4BP0 A;  2H6A A;  3PY6 A;  2QJS A;  4ZO3 A;  2Q0J A;  2YNW A;  3IOG A;  1DDK A;  5ACR A;  3T3O A;  5B3R A;  4V0H A;  1L9Y A;  4NQ4 A;  4C1G A;  5AXO A;  4Z5Y A;  2I7T A;  2WYL A;  3DH8 A;  5LS3 A;  4PVO A;  1JJE A;  4D02 A;  4GYU A;  5B1U A;  4Z60 A;  2M5C A;  2P1E A;  5HH5 A;  2BFZ A;  2YNV B;  5EV8 A;  5FQB A;  2P4Z A;  1HLK A;  4YSB A;  5K4N A;  3IE1 A;  4AWY B;  2BR6 A;  2Q9U A;  1DXK A;  2I7X A;  1VME A;  2WHG A;  4KEP A;  5ACT A;  4UBQ A;  2XR1 A;  4Z5Z A;  4U4L A;  2M5D A;  2BFK A;  4EFZ A;  3R2U A;  2FU7 A;  5AHR A;  1VGN A;  2OHH A;  4XWW A;  2FHX B;  5ACW A;  4DIL A;  5ACS A;  5EHT A;  2BGA A;  4TYF A;  1P9E A;  2QDS A;  1MQO A;  2AIO A;  1ZKP A;  3Q6V A;  1KR3 A;  4PVT A;  4RAW A;  4AX0 B;  3DHC A;  4B87 A;  5LSC A;  2DOO A;  4RL2 A;  5A0V A;  1ZNB A;  5A5Z A;  3KL7 A;  4CHL A;  4Z67 A;  3DHA A;  2HB9 A;  2BG8 B;  3IOF A;  2WRS A;  5KIK A;  2ZZI A;  5EVD A;  2FM6 A;  1WUO A;  5EVK A;  5ACQ A;  2A7M A;  5FQC A;  2Y8A A;  3IE2 A;  3JXP A;  1YCF A;  2Y87 A;  2YNT B;  4F6H A;  1K07 A;  3TP9 A;  3RPC A;  3FCZ A;  4C1F A;  2BC2 A;  5K0W A;  3RKK A;  4EY2 A;  1A8T A;  4ZNB A;  4EYL A;  5HIP A;  4J5F A;  3I14 A;  2YNV A;  3T9M A;  2P18 A;  5ACU A;  2YZ3 A;  3ZQ4 A;  4D1U A;  3IEM A;  1ZTC A;  4FSB A;  1WRA A;  3PG4 A;  4P62 A;  2I7V A;  3A4Y A;  1DD6 A;  1KO3 A;  3ESH A;  4UA4 A;  2NZF A;  4UWR B;  2GFJ A;  5AXR A;  5ACX A;  3SPU A;  5ACP A;  3KNS A;  4F6Z A;  2UYX A;  5HH6 A;  4LE6 A;  3ZR9 A;  2FHX A;  4Z6X A;  4HL1 A;  5ACV A;  2DKF A;  2ZWR A;  4TZ9 A;  4C09 A;  3SFP A;  2QED A;  2BIB A;  2OHJ A;  5EH9 A;  2E7Y A;  4EYF A;  4RAM A;  3QH8 A;  4UWP B;  1QH5 A;  2Q42 A;  4TZF A;  1BVT A;  2FU9 A;  4RM5 A;  3SD9 A;  4ZEJ A;  1M2X A;  3FAI A;  1WUP A;  1X8I A;  4FR7 A;  4JO0 A;  3VPE A;  2BG8 A;  4EYB A;  4GYQ A;  3I0V A;  1XM8 A;  2BFL A;  3S0Z A;  5HH4 A;  4HL2 A;  2YNT A;  3BK2 A;  4TZE A;  2BG7 A;  4UAM A;  1Y44 A;  3VQZ A;  5LCH A;  4D1W A;  1JT1 A;  5EWA A;  4NQ2 A;  3BK1 A;  3IE0 A;  4UWO B;  1XTO A;  4C1H A;  4RBS A;  3G1P A;  3KNR A;  5B15 A;  4UWS B;  1QH3 A;  2XF4 A;  3SBL A;  3H3E A;  2AZ4 A;  5LMC A;  2QIN A;  2BTN A;  5DPX A;  5EV6 A;  2BG2 A;  3P2U A;  2FU8 A;  2GFK A;  3AJ3 A;  3ZNB A;  4Z7R A;  4YSL A;  2FK6 A;  3SRX A;  1WW1 A;  4DIK A;  4O98 A;  4C1C A;  4H0D A;  5K4K A;  3IDZ A;  5HIQ A;  4C1E A;  5EVB A;  1X8G A;  2VW8 A;  5AYA A;  4C1D A;  3I15 A;  5A0T A;  3DHB A; 
#chains in the Genus database with same CATH topology
 3BC2 A;  2GMN A;  4ZO2 A;  4J5H A;  2YNU A;  2FU6 A;  2WYM C;  5KIL A;  3I13 A;  1SML A;  4NQ6 A;  1KO2 A;  2WYM A;  5EW0 A;  3AF6 A;  3BV6 A;  2NYP A;  5AJL A;  4TZB A;  2YCB A;  5LCF A;  4D1T A;  1BC2 A;  2BG6 A;  1YCG A;  5FQA A;  3L6N A;  3T3N A;  4AWZ A;  4FEK A;  5K4M A;  4KEQ A;  1X8H A;  5AHO A;  3F9O A;  2R2D A;  4WD6 A;  4NQ5 A;  1BMC A;  2BFZ B;  5LM6 A;  3ADR A;  4BZ3 A;  1JJT A;  5LLD A;  2NXA A;  3X2Y A;  5IQK A;  3X30 A;  5AEB A;  4GCW A;  2GKL A;  3WXC A;  1VJN A;  3X2Z A;  2ZNB A;  4YSK A;  3LVZ A;  4AD9 A;  2ZO4 A;  1A7T A;  3ZWF A;  2CBN A;  3MD7 A;  5HIS A;  2GCU A;  2CFU A;  5LE1 A;  3RKJ A;  4PDX A;  2Y8B A;  2Q0I A;  2OHI A;  4RL0 A;  4HKY A;  4XWT A;  3IEK A;  3I11 A;  3PY5 A;  1YCH A;  5HIO A;  3AF5 A;  4AX1 B;  4XUK A;  4TYT A;  4D1V A;  2BMI A;  5LCA A;  1E5D A;  3SW3 A;  2NZE A;  4EXS A;  4EXY A;  5A87 A;  3IEL A;  2QDT A;  2P97 A;  3X2X A;  4BP0 A;  2H6A A;  3PY6 A;  2QJS A;  4ZO3 A;  2Q0J A;  2YNW A;  3IOG A;  1DDK A;  5ACR A;  3T3O A;  5B3R A;  4V0H A;  1L9Y A;  4NQ4 A;  4C1G A;  5AXO A;  4Z5Y A;  2I7T A;  2WYL A;  3DH8 A;  5LS3 A;  4PVO A;  1JJE A;  2CG3 A;  4D02 A;  4GYU A;  4NUR A;  5B1U A;  4Z60 A;  2M5C A;  2P1E A;  5HH5 A;  2BFZ A;  2YNV B;  5EV8 A;  5FQB A;  2P4Z A;  1HLK A;  4YSB A;  5K4N A;  3IE1 A;  4AWY B;  2BR6 A;  2Q9U A;  1DXK A;  2I7X A;  1VME A;  2WHG A;  4KEP A;  5ACT A;  4UBQ A;  2XR1 A;  4Z5Z A;  4U4L A;  2M5D A;  2BFK A;  4EFZ A;  3R2U A;  2FU7 A;  5AHR A;  1VGN A;  4AXH A;  2OHH A;  4XWW A;  2FHX B;  5ACW A;  4DIL A;  5ACS A;  5EHT A;  2BGA A;  4TYF A;  1P9E A;  2QDS A;  1MQO A;  2AIO A;  1ZKP A;  3Q6V A;  1KR3 A;  4PVT A;  4RAW A;  4AX0 B;  3DHC A;  4B87 A;  5LSC A;  2DOO A;  4RL2 A;  5A0V A;  1ZNB A;  5A5Z A;  3KL7 A;  4CHL A;  2YHE A;  4Z67 A;  3DHA A;  2HB9 A;  2BG8 B;  3IOF A;  2WRS A;  5KIK A;  2ZZI A;  5EVD A;  2FM6 A;  1WUO A;  5EVK A;  5ACQ A;  2A7M A;  5FQC A;  2Y8A A;  3IE2 A;  3JXP A;  1YCF A;  2Y87 A;  2YNT B;  4F6H A;  1K07 A;  3TP9 A;  3RPC A;  3FCZ A;  4C1F A;  2BC2 A;  5K0W A;  3RKK A;  4EY2 A;  1A8T A;  4ZNB A;  4EYL A;  5HIP A;  4J5F A;  3I14 A;  2YNV A;  3T9M A;  2P18 A;  5ACU A;  2YZ3 A;  3ZQ4 A;  4D1U A;  3IEM A;  1ZTC A;  4FSB A;  1WRA A;  3PG4 A;  4AV7 A;  4P62 A;  2I7V A;  3A4Y A;  1DD6 A;  1KO3 A;  3ESH A;  4UA4 A;  2NZF A;  4UWR B;  2GFJ A;  5AXR A;  5ACX A;  3SPU A;  5ACP A;  3KNS A;  4F6Z A;  2UYX A;  5HH6 A;  4LE6 A;  5AIJ A;  3ZR9 A;  2FHX A;  4Z6X A;  4HL1 A;  5ACV A;  2DKF A;  2ZWR A;  4TZ9 A;  4C09 A;  3SFP A;  2CFZ A;  2QED A;  2BIB A;  2OHJ A;  5EH9 A;  2E7Y A;  4EYF A;  4RAM A;  3QH8 A;  4UWP B;  1QH5 A;  2Q42 A;  4TZF A;  1BVT A;  2FU9 A;  4RM5 A;  3SD9 A;  4ZEJ A;  1M2X A;  3FAI A;  1WUP A;  1X8I A;  4FR7 A;  4JO0 A;  3VPE A;  2BG8 A;  4EYB A;  4GYQ A;  3I0V A;  1XM8 A;  5A23 A;  2BFL A;  3S0Z A;  5HH4 A;  4HL2 A;  2YNT A;  3BK2 A;  4TZE A;  2BG7 A;  4UAM A;  1Y44 A;  3VQZ A;  5LCH A;  4D1W A;  1JT1 A;  5EWA A;  4NQ2 A;  3BK1 A;  3IE0 A;  4UWO B;  1XTO A;  4C1H A;  4RBS A;  3G1P A;  3KNR A;  5B15 A;  4UWS B;  1QH3 A;  2XF4 A;  3SBL A;  3H3E A;  2AZ4 A;  5LMC A;  2QIN A;  2BTN A;  5DPX A;  2CG2 A;  5EV6 A;  2BG2 A;  3P2U A;  2FU8 A;  2GFK A;  3AJ3 A;  3ZNB A;  4Z7R A;  4YSL A;  2FK6 A;  3SRX A;  1WW1 A;  4DIK A;  4O98 A;  4C1C A;  4H0D A;  5K4K A;  3IDZ A;  5HIQ A;  4C1E A;  5EVB A;  1X8G A;  2VW8 A;  5AYA A;  4C1D A;  3I15 A;  5A0T A;  3DHB A; 
#chains in the Genus database with same CATH homology
 3BC2 A;  2GMN A;  4ZO2 A;  4J5H A;  2YNU A;  2FU6 A;  2WYM C;  5KIL A;  3I13 A;  1SML A;  4NQ6 A;  1KO2 A;  2WYM A;  5EW0 A;  3AF6 A;  3BV6 A;  2NYP A;  4TZB A;  2YCB A;  5LCF A;  4D1T A;  1BC2 A;  2BG6 A;  1YCG A;  5FQA A;  3L6N A;  3T3N A;  4AWZ A;  4FEK A;  5K4M A;  4KEQ A;  1X8H A;  5AHO A;  3F9O A;  2R2D A;  4WD6 A;  4NQ5 A;  1BMC A;  2BFZ B;  5LM6 A;  3ADR A;  4BZ3 A;  1JJT A;  5LLD A;  2NXA A;  3X2Y A;  5IQK A;  3X30 A;  5AEB A;  4GCW A;  2GKL A;  3WXC A;  1VJN A;  3X2Z A;  2ZNB A;  4YSK A;  3LVZ A;  4AD9 A;  2ZO4 A;  1A7T A;  3ZWF A;  2CBN A;  3MD7 A;  5HIS A;  2GCU A;  5LE1 A;  3RKJ A;  2Y8B A;  2Q0I A;  2OHI A;  4RL0 A;  4HKY A;  4XWT A;  3IEK A;  3I11 A;  3PY5 A;  1YCH A;  5HIO A;  3AF5 A;  4AX1 B;  4XUK A;  4TYT A;  4D1V A;  2BMI A;  5LCA A;  1E5D A;  3SW3 A;  2NZE A;  4EXS A;  4EXY A;  5A87 A;  3IEL A;  2QDT A;  2P97 A;  3X2X A;  4BP0 A;  2H6A A;  3PY6 A;  2QJS A;  4ZO3 A;  2Q0J A;  2YNW A;  3IOG A;  1DDK A;  5ACR A;  3T3O A;  5B3R A;  4V0H A;  1L9Y A;  4NQ4 A;  4C1G A;  5AXO A;  4Z5Y A;  2I7T A;  2WYL A;  3DH8 A;  5LS3 A;  4PVO A;  1JJE A;  4D02 A;  4GYU A;  5B1U A;  4Z60 A;  2M5C A;  2P1E A;  5HH5 A;  2BFZ A;  2YNV B;  5EV8 A;  5FQB A;  2P4Z A;  1HLK A;  4YSB A;  5K4N A;  3IE1 A;  4AWY B;  2BR6 A;  2Q9U A;  1DXK A;  2I7X A;  1VME A;  2WHG A;  4KEP A;  5ACT A;  4UBQ A;  2XR1 A;  4Z5Z A;  4U4L A;  2M5D A;  2BFK A;  4EFZ A;  3R2U A;  2FU7 A;  5AHR A;  1VGN A;  2OHH A;  4XWW A;  2FHX B;  5ACW A;  4DIL A;  5ACS A;  5EHT A;  2BGA A;  4TYF A;  1P9E A;  2QDS A;  1MQO A;  2AIO A;  1ZKP A;  3Q6V A;  1KR3 A;  4PVT A;  4RAW A;  4AX0 B;  3DHC A;  4B87 A;  5LSC A;  2DOO A;  4RL2 A;  5A0V A;  1ZNB A;  5A5Z A;  3KL7 A;  4CHL A;  4Z67 A;  3DHA A;  2HB9 A;  2BG8 B;  3IOF A;  2WRS A;  5KIK A;  2ZZI A;  5EVD A;  2FM6 A;  1WUO A;  5EVK A;  5ACQ A;  2A7M A;  5FQC A;  2Y8A A;  3IE2 A;  3JXP A;  1YCF A;  2Y87 A;  2YNT B;  4F6H A;  1K07 A;  3TP9 A;  3RPC A;  3FCZ A;  4C1F A;  2BC2 A;  5K0W A;  3RKK A;  4EY2 A;  1A8T A;  4ZNB A;  4EYL A;  5HIP A;  4J5F A;  3I14 A;  2YNV A;  3T9M A;  2P18 A;  5ACU A;  2YZ3 A;  3ZQ4 A;  4D1U A;  3IEM A;  1ZTC A;  4FSB A;  1WRA A;  3PG4 A;  4P62 A;  2I7V A;  3A4Y A;  1DD6 A;  1KO3 A;  3ESH A;  4UA4 A;  2NZF A;  4UWR B;  2GFJ A;  5AXR A;  5ACX A;  3SPU A;  5ACP A;  3KNS A;  4F6Z A;  2UYX A;  5HH6 A;  4LE6 A;  3ZR9 A;  2FHX A;  4Z6X A;  4HL1 A;  5ACV A;  2DKF A;  2ZWR A;  4TZ9 A;  4C09 A;  3SFP A;  2QED A;  2BIB A;  2OHJ A;  5EH9 A;  2E7Y A;  4EYF A;  4RAM A;  3QH8 A;  4UWP B;  1QH5 A;  2Q42 A;  4TZF A;  1BVT A;  2FU9 A;  4RM5 A;  3SD9 A;  4ZEJ A;  1M2X A;  3FAI A;  1WUP A;  1X8I A;  4FR7 A;  4JO0 A;  3VPE A;  2BG8 A;  4EYB A;  4GYQ A;  3I0V A;  1XM8 A;  2BFL A;  3S0Z A;  5HH4 A;  4HL2 A;  2YNT A;  3BK2 A;  4TZE A;  2BG7 A;  4UAM A;  1Y44 A;  3VQZ A;  5LCH A;  4D1W A;  1JT1 A;  5EWA A;  4NQ2 A;  3BK1 A;  3IE0 A;  4UWO B;  1XTO A;  4C1H A;  4RBS A;  3G1P A;  3KNR A;  5B15 A;  4UWS B;  1QH3 A;  2XF4 A;  3SBL A;  3H3E A;  2AZ4 A;  5LMC A;  2QIN A;  2BTN A;  5DPX A;  5EV6 A;  2BG2 A;  3P2U A;  2FU8 A;  2GFK A;  3AJ3 A;  3ZNB A;  4Z7R A;  4YSL A;  2FK6 A;  3SRX A;  1WW1 A;  4DIK A;  4O98 A;  4C1C A;  4H0D A;  5K4K A;  3IDZ A;  5HIQ A;  4C1E A;  5EVB A;  1X8G A;  2VW8 A;  5AYA A;  4C1D A;  3I15 A;  5A0T A;  3DHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...