1JJTA

Imp-1 metallo beta-lactamase from pseudomonas aeruginosa in complex with a biaryl succinic acid inhibitor (1)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
220
structure length
220
Chain Sequence
SLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Succinic acids as potent inhibitors of plasmid-borne IMP-1 metallo-beta-lactamase.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords IMP-1 METALLO BETA-LACTAMASE
total genus 67
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1jjtA00
5A87A 5AHRA 1XTOA 4UAMA 1YCGA 3FCZA 4JO0A 4UWOB 4NQ5A 4FEKA 4D1TA 4NQ4A 4TZFA 4P62A 2ZZIA 4EYFA 5LSCA 4V0HA 5ACPA 5A0TA 4Z67A 4F6HA 3VPEA 3JXPA 5ACRA 1JT1A 5LCFA 5ACUA 4Z5ZA 1WUOA 1L9YA 4KEQA 4EYBA 4Z60A 4Z5YA 2BG8A 3A4YA 3X2YA 5HIOA 3SFPA 5FQCA 2DOOA 3RKJA 3X30A 4ZNBA 5K0WA 5K4KA 4GYQA 4XWTA 2I7VA 3SBLA 5EV8A 5ACWA 2VW8A 5HH5A 4D02A 3DH8A 1E5DA 2UYXA 2CBNA 1K07A 1ZNBA 3IDZA 2YCBA 3I13A 2WHGA 3DHBA 2GFKA 4RAMA 2BFLA 3PY6A 2NXAA 3FAIA 3Q6VA 4J5HA 1VGNA 1BC2A 5AEBA 2P4ZA 3BV6A 3G1PA 4B87A 4RL0A 1WRAA 2YNTA 2AIOA 5A5ZA 2GFJA 5AXRA 3ADRA 4TZEA 5EVKA 4RBSA 4NQ6A 5EHTA 3R2UA 4O98A 4BP0A 1X8HA 4YSBA 4LE6A 4H0DA 3IOGA 1DDKA 4Z7RA 3DHAA 2QEDA 4GCWA 4D1WA 2P97A 5ACVA 2BG7A 4UBQA 2YNVB 4EYLA 5LS3A 2BFZB 3H3EA 2OHHA 3IE1A 2FHXB 1KO2A 3VQZA 3ESHA 5EVBA 2M5DA 3I0VA 3PY5A 2YZ3A 2FK6A 4F6ZA 5K4NA 1SMLA 4EXYA 4FSBA 4J5FA 2H6AA 4UWRB 2E7YA 5KIKA 5EVDA 4XWWA 2BG6A 2Q0JA 2WYMA 4DILA 2P18A 3KNSA 4TZBA 3L6NA 4C1CA 5DPXA 2Y8BA 2QDTA 2WYLA 4XUKA 2FU9A 3F9OA 4RM5A 3AJ3A 2M5CA 5ACSA 4HL1A 1QH3A 2ZWRA 3T3OA 3AF6A 2BMIA 5B1UA 2Q42A 1JJEA 2NYPA 2OHIA 3BC2A 4RAWA 4C1EA 4EXSA 3RPCA 2I7XA 5AYAA 2FU7A 1MQOA 1DXKA 2WRSA 4Z6XA 3IELA 3KL7A 5HIPA 1JJTA 2BG2A 4FR7A 4ZO2A 4AWZA 3IOFA 2Q9UA 4TZ9A 2HB9A 3BK2A 5EV6A 5IQKA 3SD9A 2R2DA 2YNUA 2NZEA 2OHJA 5B3RA 4DIKA 3X2ZA 3P2UA 2QDSA 1X8IA 4EFZA 4WD6A 1VJNA 2FHXA 2BFKA 5LM6A 1ZTCA 3IE2A 1M2XA 5ACTA 2YNTB 4D1VA 4YSKA 1QH5A 3IEKA 4YSLA 3IE0A 5LLDA 2BC2A 3QH8A 5HISA 2GKLA 5LE1A 5AXOA 4HKYA 4UWPB 2ZNBA 4BZ3A 4ZO3A 2XF4A 3T3NA 2GMNA 1Y44A 1BMCA 5FQBA 1ZKPA 4D1UA 3TP9A 4C1DA 5EH9A 1KR3A 2Y8AA 3T9MA 2BG8B 3X2XA 3SPUA 3I11A 2BIBA 4AWYB 3IEMA 5AHOA 5HH4A 1YCHA 2Q0IA 2GCUA 2BTNA 4HL2A 1DD6A 3ZNBA 4C09A 5ACQA 1WUPA 1KO3A 2FU6A 4TYFA 5LCHA 5LCAA 1A8TA 2YNWA 3MD7A 3LVZA 3I14A 2BR6A 4AX0B 3S0ZA 2Y87A 5LMCA 1YCFA 2ZO4A 3ZR9A 4NQ2A 3RKKA 4AD9A 4RL2A 1WW1A 2DKFA 2WYMC 3ZWFA 4C1FA 3AF5A 4AX1B 4KEPA 1A7TA 3SRXA 3ZQ4A 1X8GA 4U4LA 2QJSA 3PG4A 5B15A 4C1GA 4EY2A 1BVTA 3DHCA 4UA4A 5EWAA 5K4MA 5HIQA 2P1EA 2FM6A 5A0VA 3SW3A 1VMEA 1XM8A 2XR1A 3KNRA 2BGAA 2FU8A 1HLKA 2BFZA 2I7TA 5EW0A 3I15A 2YNVA 4CHLA 4TYTA 5ACXA 4GYUA 2A7MA 5KILA 2NZFA 2QINA 5FQAA 2AZ4A 1P9EA 4PVOA 5HH6A 4UWSB 3WXCA 4ZEJA 3BK1A 4PVTA 4C1HA
chains in the Genus database with same CATH superfamily
5A87A 5AHRA 1XTOA 4UAMA 1YCGA 3FCZA 4JO0A 4UWOB 4NQ5A 4FEKA 4D1TA 4NQ4A 4TZFA 4P62A 2ZZIA 4EYFA 5LSCA 4V0HA 5ACPA 5A0TA 4Z67A 4F6HA 3VPEA 3JXPA 5ACRA 1JT1A 5LCFA 5ACUA 4Z5ZA 5AJLA 1WUOA 1L9YA 4KEQA 4EYBA 4Z60A 4Z5YA 2BG8A 3A4YA 3X2YA 5HIOA 3SFPA 5FQCA 2DOOA 3RKJA 3X30A 4ZNBA 5K0WA 2CG2A 5K4KA 4GYQA 4XWTA 2I7VA 3SBLA 5EV8A 5ACWA 2VW8A 5HH5A 4D02A 3DH8A 1E5DA 2UYXA 2CBNA 1K07A 1ZNBA 3IDZA 2YCBA 3I13A 2WHGA 3DHBA 2GFKA 4RAMA 2BFLA 3PY6A 2NXAA 3FAIA 3Q6VA 4J5HA 1VGNA 1BC2A 4PDXA 5AEBA 2P4ZA 3BV6A 3G1PA 4B87A 4RL0A 1WRAA 2YNTA 2AIOA 5A5ZA 2GFJA 5AXRA 3ADRA 4TZEA 5EVKA 4RBSA 4NQ6A 5EHTA 3R2UA 4O98A 4BP0A 1X8HA 4YSBA 4LE6A 4H0DA 3IOGA 1DDKA 5AIJA 2YHEA 4Z7RA 3DHAA 2QEDA 4GCWA 4D1WA 2P97A 5ACVA 2BG7A 4UBQA 2YNVB 4EYLA 5LS3A 2BFZB 3H3EA 2OHHA 3IE1A 2FHXB 1KO2A 3VQZA 3ESHA 5EVBA 2M5DA 3I0VA 3PY5A 2YZ3A 4AXHA 2FK6A 4F6ZA 5K4NA 1SMLA 4NURA 4EXYA 4FSBA 4J5FA 2H6AA 4UWRB 2E7YA 5KIKA 5EVDA 4XWWA 2BG6A 2Q0JA 2WYMA 4DILA 2P18A 3KNSA 4TZBA 3L6NA 4C1CA 5DPXA 2Y8BA 2QDTA 2WYLA 4XUKA 2FU9A 3F9OA 4RM5A 3AJ3A 2M5CA 5ACSA 4HL1A 2CFZA 1QH3A 2ZWRA 3T3OA 3AF6A 2BMIA 5B1UA 2Q42A 1JJEA 2NYPA 2OHIA 3BC2A 4RAWA 4C1EA 4EXSA 3RPCA 2I7XA 5AYAA 2FU7A 1MQOA 1DXKA 2WRSA 4Z6XA 3IELA 3KL7A 5HIPA 1JJTA 2BG2A 4FR7A 4ZO2A 4AWZA 3IOFA 2Q9UA 4TZ9A 2HB9A 3BK2A 5EV6A 5IQKA 3SD9A 5A23A 2R2DA 2YNUA 2NZEA 2OHJA 5B3RA 4DIKA 3X2ZA 3P2UA 2QDSA 1X8IA 4EFZA 4WD6A 1VJNA 2FHXA 2BFKA 5LM6A 1ZTCA 3IE2A 1M2XA 5ACTA 2YNTB 4D1VA 4YSKA 1QH5A 3IEKA 4YSLA 3IE0A 5LLDA 2BC2A 3QH8A 5HISA 2GKLA 5LE1A 5AXOA 4HKYA 4UWPB 2ZNBA 4BZ3A 4ZO3A 2XF4A 3T3NA 2GMNA 1Y44A 1BMCA 5FQBA 1ZKPA 4D1UA 3TP9A 4C1DA 5EH9A 1KR3A 2Y8AA 3T9MA 2BG8B 3X2XA 3SPUA 3I11A 2BIBA 4AWYB 3IEMA 5AHOA 5HH4A 1YCHA 2Q0IA 2GCUA 2BTNA 4HL2A 1DD6A 3ZNBA 4C09A 5ACQA 1WUPA 1KO3A 2FU6A 2CFUA 4TYFA 5LCHA 5LCAA 1A8TA 2YNWA 3MD7A 3LVZA 3I14A 2BR6A 4AX0B 4AV7A 3S0ZA 2Y87A 5LMCA 1YCFA 2ZO4A 3ZR9A 4NQ2A 3RKKA 4AD9A 4RL2A 1WW1A 2DKFA 2WYMC 3ZWFA 4C1FA 2CG3A 3AF5A 4AX1B 4KEPA 1A7TA 3SRXA 3ZQ4A 1X8GA 4U4LA 2QJSA 3PG4A 5B15A 4C1GA 4EY2A 1BVTA 3DHCA 4UA4A 5EWAA 5K4MA 5HIQA 2P1EA 2FM6A 5A0VA 3SW3A 1VMEA 1XM8A 2XR1A 3KNRA 2BGAA 2FU8A 1HLKA 2BFZA 2I7TA 5EW0A 3I15A 2YNVA 4CHLA 4TYTA 5ACXA 4GYUA 2A7MA 5KILA 2NZFA 2QINA 5FQAA 2AZ4A 1P9EA 4PVOA 5HH6A 4UWSB 3WXCA 4ZEJA 3BK1A 4PVTA 4C1HA
chains in the Genus database with same CATH topology
5A87A 5AHRA 1XTOA 4UAMA 1YCGA 3FCZA 4JO0A 4UWOB 4NQ5A 4FEKA 4D1TA 4NQ4A 4TZFA 4P62A 2ZZIA 4EYFA 5LSCA 4V0HA 5ACPA 5A0TA 4Z67A 4F6HA 3VPEA 3JXPA 5ACRA 1JT1A 5LCFA 5ACUA 4Z5ZA 1WUOA 1L9YA 4KEQA 4EYBA 4Z60A 4Z5YA 2BG8A 3A4YA 3X2YA 5HIOA 3SFPA 5FQCA 2DOOA 3RKJA 3X30A 4ZNBA 5K0WA 5K4KA 4GYQA 4XWTA 2I7VA 3SBLA 5EV8A 5ACWA 2VW8A 5HH5A 4D02A 3DH8A 1E5DA 2UYXA 2CBNA 1K07A 1ZNBA 3IDZA 2YCBA 3I13A 2WHGA 3DHBA 2GFKA 4RAMA 2BFLA 3PY6A 2NXAA 3FAIA 3Q6VA 4J5HA 1VGNA 1BC2A 5AEBA 2P4ZA 3BV6A 3G1PA 4B87A 4RL0A 1WRAA 2YNTA 2AIOA 5A5ZA 2GFJA 5AXRA 3ADRA 4TZEA 5EVKA 4RBSA 4NQ6A 5EHTA 3R2UA 4O98A 4BP0A 1X8HA 4YSBA 4LE6A 4H0DA 3IOGA 1DDKA 4Z7RA 3DHAA 2QEDA 4GCWA 4D1WA 2P97A 5ACVA 2BG7A 4UBQA 2YNVB 4EYLA 5LS3A 2BFZB 3H3EA 2OHHA 3IE1A 2FHXB 1KO2A 3VQZA 3ESHA 5EVBA 2M5DA 3I0VA 3PY5A 2YZ3A 2FK6A 4F6ZA 5K4NA 1SMLA 4EXYA 4FSBA 4J5FA 2H6AA 4UWRB 2E7YA 5KIKA 5EVDA 4XWWA 2BG6A 2Q0JA 2WYMA 4DILA 2P18A 3KNSA 4TZBA 3L6NA 4C1CA 5DPXA 2Y8BA 2QDTA 2WYLA 4XUKA 2FU9A 3F9OA 4RM5A 3AJ3A 2M5CA 5ACSA 4HL1A 1QH3A 2ZWRA 3T3OA 3AF6A 2BMIA 5B1UA 2Q42A 1JJEA 2NYPA 2OHIA 3BC2A 4RAWA 4C1EA 4EXSA 3RPCA 2I7XA 5AYAA 2FU7A 1MQOA 1DXKA 2WRSA 4Z6XA 3IELA 3KL7A 5HIPA 1JJTA 2BG2A 4FR7A 4ZO2A 4AWZA 3IOFA 2Q9UA 4TZ9A 2HB9A 3BK2A 5EV6A 5IQKA 3SD9A 2R2DA 2YNUA 2NZEA 2OHJA 5B3RA 4DIKA 3X2ZA 3P2UA 2QDSA 1X8IA 4EFZA 4WD6A 1VJNA 2FHXA 2BFKA 5LM6A 1ZTCA 3IE2A 1M2XA 5ACTA 2YNTB 4D1VA 4YSKA 1QH5A 3IEKA 4YSLA 3IE0A 5LLDA 2BC2A 3QH8A 5HISA 2GKLA 5LE1A 5AXOA 4HKYA 4UWPB 2ZNBA 4BZ3A 4ZO3A 2XF4A 3T3NA 2GMNA 1Y44A 1BMCA 5FQBA 1ZKPA 4D1UA 3TP9A 4C1DA 5EH9A 1KR3A 2Y8AA 3T9MA 2BG8B 3X2XA 3SPUA 3I11A 2BIBA 4AWYB 3IEMA 5AHOA 5HH4A 1YCHA 2Q0IA 2GCUA 2BTNA 4HL2A 1DD6A 3ZNBA 4C09A 5ACQA 1WUPA 1KO3A 2FU6A 4TYFA 5LCHA 5LCAA 1A8TA 2YNWA 3MD7A 3LVZA 3I14A 2BR6A 4AX0B 3S0ZA 2Y87A 5LMCA 1YCFA 2ZO4A 3ZR9A 4NQ2A 3RKKA 4AD9A 4RL2A 1WW1A 2DKFA 2WYMC 3ZWFA 4C1FA 3AF5A 4AX1B 4KEPA 1A7TA 3SRXA 3ZQ4A 1X8GA 4U4LA 2QJSA 3PG4A 5B15A 4C1GA 4EY2A 1BVTA 3DHCA 4UA4A 5EWAA 5K4MA 5HIQA 2P1EA 2FM6A 5A0VA 3SW3A 1VMEA 1XM8A 2XR1A 3KNRA 2BGAA 2FU8A 1HLKA 2BFZA 2I7TA 5EW0A 3I15A 2YNVA 4CHLA 4TYTA 5ACXA 4GYUA 2A7MA 5KILA 2NZFA 2QINA 5FQAA 2AZ4A 1P9EA 4PVOA 5HH6A 4UWSB 3WXCA 4ZEJA 3BK1A 4PVTA 4C1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A87 A;  5AHR A;  1XTO A;  4UAM A;  1YCG A;  3FCZ A;  4JO0 A;  4UWO B;  4NQ5 A;  4FEK A;  4D1T A;  4NQ4 A;  4TZF A;  4P62 A;  2ZZI A;  4EYF A;  5LSC A;  4V0H A;  5ACP A;  5A0T A;  4Z67 A;  4F6H A;  3VPE A;  3JXP A;  5ACR A;  1JT1 A;  5LCF A;  5ACU A;  4Z5Z A;  1WUO A;  1L9Y A;  4KEQ A;  4EYB A;  4Z60 A;  4Z5Y A;  2BG8 A;  3A4Y A;  3X2Y A;  5HIO A;  3SFP A;  5FQC A;  2DOO A;  3RKJ A;  3X30 A;  4ZNB A;  5K0W A;  5K4K A;  4GYQ A;  4XWT A;  2I7V A;  3SBL A;  5EV8 A;  5ACW A;  2VW8 A;  5HH5 A;  4D02 A;  3DH8 A;  1E5D A;  2UYX A;  2CBN A;  1K07 A;  1ZNB A;  3IDZ A;  2YCB A;  3I13 A;  2WHG A;  3DHB A;  2GFK A;  4RAM A;  2BFL A;  3PY6 A;  2NXA A;  3FAI A;  3Q6V A;  4J5H A;  1VGN A;  1BC2 A;  5AEB A;  2P4Z A;  3BV6 A;  3G1P A;  4B87 A;  4RL0 A;  1WRA A;  2YNT A;  2AIO A;  5A5Z A;  2GFJ A;  5AXR A;  3ADR A;  4TZE A;  5EVK A;  4RBS A;  4NQ6 A;  5EHT A;  3R2U A;  4O98 A;  4BP0 A;  1X8H A;  4YSB A;  4LE6 A;  4H0D A;  3IOG A;  1DDK A;  4Z7R A;  3DHA A;  2QED A;  4GCW A;  4D1W A;  2P97 A;  5ACV A;  2BG7 A;  4UBQ A;  2YNV B;  4EYL A;  5LS3 A;  2BFZ B;  3H3E A;  2OHH A;  3IE1 A;  2FHX B;  1KO2 A;  3VQZ A;  3ESH A;  5EVB A;  2M5D A;  3I0V A;  3PY5 A;  2YZ3 A;  2FK6 A;  4F6Z A;  5K4N A;  1SML A;  4EXY A;  4FSB A;  4J5F A;  2H6A A;  4UWR B;  2E7Y A;  5KIK A;  5EVD A;  4XWW A;  2BG6 A;  2Q0J A;  2WYM A;  4DIL A;  2P18 A;  3KNS A;  4TZB A;  3L6N A;  4C1C A;  5DPX A;  2Y8B A;  2QDT A;  2WYL A;  4XUK A;  2FU9 A;  3F9O A;  4RM5 A;  3AJ3 A;  2M5C A;  5ACS A;  4HL1 A;  1QH3 A;  2ZWR A;  3T3O A;  3AF6 A;  2BMI A;  5B1U A;  2Q42 A;  1JJE A;  2NYP A;  2OHI A;  3BC2 A;  4RAW A;  4C1E A;  4EXS A;  3RPC A;  2I7X A;  5AYA A;  2FU7 A;  1MQO A;  1DXK A;  2WRS A;  4Z6X A;  3IEL A;  3KL7 A;  5HIP A;  1JJT A;  2BG2 A;  4FR7 A;  4ZO2 A;  4AWZ A;  3IOF A;  2Q9U A;  4TZ9 A;  2HB9 A;  3BK2 A;  5EV6 A;  5IQK A;  3SD9 A;  2R2D A;  2YNU A;  2NZE A;  2OHJ A;  5B3R A;  4DIK A;  3X2Z A;  3P2U A;  2QDS A;  1X8I A;  4EFZ A;  4WD6 A;  1VJN A;  2FHX A;  2BFK A;  5LM6 A;  1ZTC A;  3IE2 A;  1M2X A;  5ACT A;  2YNT B;  4D1V A;  4YSK A;  1QH5 A;  3IEK A;  4YSL A;  3IE0 A;  5LLD A;  2BC2 A;  3QH8 A;  5HIS A;  2GKL A;  5LE1 A;  5AXO A;  4HKY A;  4UWP B;  2ZNB A;  4BZ3 A;  4ZO3 A;  2XF4 A;  3T3N A;  2GMN A;  1Y44 A;  1BMC A;  5FQB A;  1ZKP A;  4D1U A;  3TP9 A;  4C1D A;  5EH9 A;  1KR3 A;  2Y8A A;  3T9M A;  2BG8 B;  3X2X A;  3SPU A;  3I11 A;  2BIB A;  4AWY B;  3IEM A;  5AHO A;  5HH4 A;  1YCH A;  2Q0I A;  2GCU A;  2BTN A;  4HL2 A;  1DD6 A;  3ZNB A;  4C09 A;  5ACQ A;  1WUP A;  1KO3 A;  2FU6 A;  4TYF A;  5LCH A;  5LCA A;  1A8T A;  2YNW A;  3MD7 A;  3LVZ A;  3I14 A;  2BR6 A;  4AX0 B;  3S0Z A;  2Y87 A;  5LMC A;  1YCF A;  2ZO4 A;  3ZR9 A;  4NQ2 A;  3RKK A;  4AD9 A;  4RL2 A;  1WW1 A;  2DKF A;  2WYM C;  3ZWF A;  4C1F A;  3AF5 A;  4AX1 B;  4KEP A;  1A7T A;  3SRX A;  3ZQ4 A;  1X8G A;  4U4L A;  2QJS A;  3PG4 A;  5B15 A;  4C1G A;  4EY2 A;  1BVT A;  3DHC A;  4UA4 A;  5EWA A;  5K4M A;  5HIQ A;  2P1E A;  2FM6 A;  5A0V A;  3SW3 A;  1VME A;  1XM8 A;  2XR1 A;  3KNR A;  2BGA A;  2FU8 A;  1HLK A;  2BFZ A;  2I7T A;  5EW0 A;  3I15 A;  2YNV A;  4CHL A;  4TYT A;  5ACX A;  4GYU A;  2A7M A;  5KIL A;  2NZF A;  2QIN A;  5FQA A;  2AZ4 A;  1P9E A;  4PVO A;  5HH6 A;  4UWS B;  3WXC A;  4ZEJ A;  3BK1 A;  4PVT A;  4C1H A; 
#chains in the Genus database with same CATH topology
 5A87 A;  5AHR A;  1XTO A;  4UAM A;  1YCG A;  3FCZ A;  4JO0 A;  4UWO B;  4NQ5 A;  4FEK A;  4D1T A;  4NQ4 A;  4TZF A;  4P62 A;  2ZZI A;  4EYF A;  5LSC A;  4V0H A;  5ACP A;  5A0T A;  4Z67 A;  4F6H A;  3VPE A;  3JXP A;  5ACR A;  1JT1 A;  5LCF A;  5ACU A;  4Z5Z A;  5AJL A;  1WUO A;  1L9Y A;  4KEQ A;  4EYB A;  4Z60 A;  4Z5Y A;  2BG8 A;  3A4Y A;  3X2Y A;  5HIO A;  3SFP A;  5FQC A;  2DOO A;  3RKJ A;  3X30 A;  4ZNB A;  5K0W A;  2CG2 A;  5K4K A;  4GYQ A;  4XWT A;  2I7V A;  3SBL A;  5EV8 A;  5ACW A;  2VW8 A;  5HH5 A;  4D02 A;  3DH8 A;  1E5D A;  2UYX A;  2CBN A;  1K07 A;  1ZNB A;  3IDZ A;  2YCB A;  3I13 A;  2WHG A;  3DHB A;  2GFK A;  4RAM A;  2BFL A;  3PY6 A;  2NXA A;  3FAI A;  3Q6V A;  4J5H A;  1VGN A;  1BC2 A;  4PDX A;  5AEB A;  2P4Z A;  3BV6 A;  3G1P A;  4B87 A;  4RL0 A;  1WRA A;  2YNT A;  2AIO A;  5A5Z A;  2GFJ A;  5AXR A;  3ADR A;  4TZE A;  5EVK A;  4RBS A;  4NQ6 A;  5EHT A;  3R2U A;  4O98 A;  4BP0 A;  1X8H A;  4YSB A;  4LE6 A;  4H0D A;  3IOG A;  1DDK A;  5AIJ A;  2YHE A;  4Z7R A;  3DHA A;  2QED A;  4GCW A;  4D1W A;  2P97 A;  5ACV A;  2BG7 A;  4UBQ A;  2YNV B;  4EYL A;  5LS3 A;  2BFZ B;  3H3E A;  2OHH A;  3IE1 A;  2FHX B;  1KO2 A;  3VQZ A;  3ESH A;  5EVB A;  2M5D A;  3I0V A;  3PY5 A;  2YZ3 A;  4AXH A;  2FK6 A;  4F6Z A;  5K4N A;  1SML A;  4NUR A;  4EXY A;  4FSB A;  4J5F A;  2H6A A;  4UWR B;  2E7Y A;  5KIK A;  5EVD A;  4XWW A;  2BG6 A;  2Q0J A;  2WYM A;  4DIL A;  2P18 A;  3KNS A;  4TZB A;  3L6N A;  4C1C A;  5DPX A;  2Y8B A;  2QDT A;  2WYL A;  4XUK A;  2FU9 A;  3F9O A;  4RM5 A;  3AJ3 A;  2M5C A;  5ACS A;  4HL1 A;  2CFZ A;  1QH3 A;  2ZWR A;  3T3O A;  3AF6 A;  2BMI A;  5B1U A;  2Q42 A;  1JJE A;  2NYP A;  2OHI A;  3BC2 A;  4RAW A;  4C1E A;  4EXS A;  3RPC A;  2I7X A;  5AYA A;  2FU7 A;  1MQO A;  1DXK A;  2WRS A;  4Z6X A;  3IEL A;  3KL7 A;  5HIP A;  1JJT A;  2BG2 A;  4FR7 A;  4ZO2 A;  4AWZ A;  3IOF A;  2Q9U A;  4TZ9 A;  2HB9 A;  3BK2 A;  5EV6 A;  5IQK A;  3SD9 A;  5A23 A;  2R2D A;  2YNU A;  2NZE A;  2OHJ A;  5B3R A;  4DIK A;  3X2Z A;  3P2U A;  2QDS A;  1X8I A;  4EFZ A;  4WD6 A;  1VJN A;  2FHX A;  2BFK A;  5LM6 A;  1ZTC A;  3IE2 A;  1M2X A;  5ACT A;  2YNT B;  4D1V A;  4YSK A;  1QH5 A;  3IEK A;  4YSL A;  3IE0 A;  5LLD A;  2BC2 A;  3QH8 A;  5HIS A;  2GKL A;  5LE1 A;  5AXO A;  4HKY A;  4UWP B;  2ZNB A;  4BZ3 A;  4ZO3 A;  2XF4 A;  3T3N A;  2GMN A;  1Y44 A;  1BMC A;  5FQB A;  1ZKP A;  4D1U A;  3TP9 A;  4C1D A;  5EH9 A;  1KR3 A;  2Y8A A;  3T9M A;  2BG8 B;  3X2X A;  3SPU A;  3I11 A;  2BIB A;  4AWY B;  3IEM A;  5AHO A;  5HH4 A;  1YCH A;  2Q0I A;  2GCU A;  2BTN A;  4HL2 A;  1DD6 A;  3ZNB A;  4C09 A;  5ACQ A;  1WUP A;  1KO3 A;  2FU6 A;  2CFU A;  4TYF A;  5LCH A;  5LCA A;  1A8T A;  2YNW A;  3MD7 A;  3LVZ A;  3I14 A;  2BR6 A;  4AX0 B;  4AV7 A;  3S0Z A;  2Y87 A;  5LMC A;  1YCF A;  2ZO4 A;  3ZR9 A;  4NQ2 A;  3RKK A;  4AD9 A;  4RL2 A;  1WW1 A;  2DKF A;  2WYM C;  3ZWF A;  4C1F A;  2CG3 A;  3AF5 A;  4AX1 B;  4KEP A;  1A7T A;  3SRX A;  3ZQ4 A;  1X8G A;  4U4L A;  2QJS A;  3PG4 A;  5B15 A;  4C1G A;  4EY2 A;  1BVT A;  3DHC A;  4UA4 A;  5EWA A;  5K4M A;  5HIQ A;  2P1E A;  2FM6 A;  5A0V A;  3SW3 A;  1VME A;  1XM8 A;  2XR1 A;  3KNR A;  2BGA A;  2FU8 A;  1HLK A;  2BFZ A;  2I7T A;  5EW0 A;  3I15 A;  2YNV A;  4CHL A;  4TYT A;  5ACX A;  4GYU A;  2A7M A;  5KIL A;  2NZF A;  2QIN A;  5FQA A;  2AZ4 A;  1P9E A;  4PVO A;  5HH6 A;  4UWS B;  3WXC A;  4ZEJ A;  3BK1 A;  4PVT A;  4C1H A; 
#chains in the Genus database with same CATH homology
 5A87 A;  5AHR A;  1XTO A;  4UAM A;  1YCG A;  3FCZ A;  4JO0 A;  4UWO B;  4NQ5 A;  4FEK A;  4D1T A;  4NQ4 A;  4TZF A;  4P62 A;  2ZZI A;  4EYF A;  5LSC A;  4V0H A;  5ACP A;  5A0T A;  4Z67 A;  4F6H A;  3VPE A;  3JXP A;  5ACR A;  1JT1 A;  5LCF A;  5ACU A;  4Z5Z A;  1WUO A;  1L9Y A;  4KEQ A;  4EYB A;  4Z60 A;  4Z5Y A;  2BG8 A;  3A4Y A;  3X2Y A;  5HIO A;  3SFP A;  5FQC A;  2DOO A;  3RKJ A;  3X30 A;  4ZNB A;  5K0W A;  5K4K A;  4GYQ A;  4XWT A;  2I7V A;  3SBL A;  5EV8 A;  5ACW A;  2VW8 A;  5HH5 A;  4D02 A;  3DH8 A;  1E5D A;  2UYX A;  2CBN A;  1K07 A;  1ZNB A;  3IDZ A;  2YCB A;  3I13 A;  2WHG A;  3DHB A;  2GFK A;  4RAM A;  2BFL A;  3PY6 A;  2NXA A;  3FAI A;  3Q6V A;  4J5H A;  1VGN A;  1BC2 A;  5AEB A;  2P4Z A;  3BV6 A;  3G1P A;  4B87 A;  4RL0 A;  1WRA A;  2YNT A;  2AIO A;  5A5Z A;  2GFJ A;  5AXR A;  3ADR A;  4TZE A;  5EVK A;  4RBS A;  4NQ6 A;  5EHT A;  3R2U A;  4O98 A;  4BP0 A;  1X8H A;  4YSB A;  4LE6 A;  4H0D A;  3IOG A;  1DDK A;  4Z7R A;  3DHA A;  2QED A;  4GCW A;  4D1W A;  2P97 A;  5ACV A;  2BG7 A;  4UBQ A;  2YNV B;  4EYL A;  5LS3 A;  2BFZ B;  3H3E A;  2OHH A;  3IE1 A;  2FHX B;  1KO2 A;  3VQZ A;  3ESH A;  5EVB A;  2M5D A;  3I0V A;  3PY5 A;  2YZ3 A;  2FK6 A;  4F6Z A;  5K4N A;  1SML A;  4EXY A;  4FSB A;  4J5F A;  2H6A A;  4UWR B;  2E7Y A;  5KIK A;  5EVD A;  4XWW A;  2BG6 A;  2Q0J A;  2WYM A;  4DIL A;  2P18 A;  3KNS A;  4TZB A;  3L6N A;  4C1C A;  5DPX A;  2Y8B A;  2QDT A;  2WYL A;  4XUK A;  2FU9 A;  3F9O A;  4RM5 A;  3AJ3 A;  2M5C A;  5ACS A;  4HL1 A;  1QH3 A;  2ZWR A;  3T3O A;  3AF6 A;  2BMI A;  5B1U A;  2Q42 A;  1JJE A;  2NYP A;  2OHI A;  3BC2 A;  4RAW A;  4C1E A;  4EXS A;  3RPC A;  2I7X A;  5AYA A;  2FU7 A;  1MQO A;  1DXK A;  2WRS A;  4Z6X A;  3IEL A;  3KL7 A;  5HIP A;  1JJT A;  2BG2 A;  4FR7 A;  4ZO2 A;  4AWZ A;  3IOF A;  2Q9U A;  4TZ9 A;  2HB9 A;  3BK2 A;  5EV6 A;  5IQK A;  3SD9 A;  2R2D A;  2YNU A;  2NZE A;  2OHJ A;  5B3R A;  4DIK A;  3X2Z A;  3P2U A;  2QDS A;  1X8I A;  4EFZ A;  4WD6 A;  1VJN A;  2FHX A;  2BFK A;  5LM6 A;  1ZTC A;  3IE2 A;  1M2X A;  5ACT A;  2YNT B;  4D1V A;  4YSK A;  1QH5 A;  3IEK A;  4YSL A;  3IE0 A;  5LLD A;  2BC2 A;  3QH8 A;  5HIS A;  2GKL A;  5LE1 A;  5AXO A;  4HKY A;  4UWP B;  2ZNB A;  4BZ3 A;  4ZO3 A;  2XF4 A;  3T3N A;  2GMN A;  1Y44 A;  1BMC A;  5FQB A;  1ZKP A;  4D1U A;  3TP9 A;  4C1D A;  5EH9 A;  1KR3 A;  2Y8A A;  3T9M A;  2BG8 B;  3X2X A;  3SPU A;  3I11 A;  2BIB A;  4AWY B;  3IEM A;  5AHO A;  5HH4 A;  1YCH A;  2Q0I A;  2GCU A;  2BTN A;  4HL2 A;  1DD6 A;  3ZNB A;  4C09 A;  5ACQ A;  1WUP A;  1KO3 A;  2FU6 A;  4TYF A;  5LCH A;  5LCA A;  1A8T A;  2YNW A;  3MD7 A;  3LVZ A;  3I14 A;  2BR6 A;  4AX0 B;  3S0Z A;  2Y87 A;  5LMC A;  1YCF A;  2ZO4 A;  3ZR9 A;  4NQ2 A;  3RKK A;  4AD9 A;  4RL2 A;  1WW1 A;  2DKF A;  2WYM C;  3ZWF A;  4C1F A;  3AF5 A;  4AX1 B;  4KEP A;  1A7T A;  3SRX A;  3ZQ4 A;  1X8G A;  4U4L A;  2QJS A;  3PG4 A;  5B15 A;  4C1G A;  4EY2 A;  1BVT A;  3DHC A;  4UA4 A;  5EWA A;  5K4M A;  5HIQ A;  2P1E A;  2FM6 A;  5A0V A;  3SW3 A;  1VME A;  1XM8 A;  2XR1 A;  3KNR A;  2BGA A;  2FU8 A;  1HLK A;  2BFZ A;  2I7T A;  5EW0 A;  3I15 A;  2YNV A;  4CHL A;  4TYT A;  5ACX A;  4GYU A;  2A7M A;  5KIL A;  2NZF A;  2QIN A;  5FQA A;  2AZ4 A;  1P9E A;  4PVO A;  5HH6 A;  4UWS B;  3WXC A;  4ZEJ A;  3BK1 A;  4PVT A;  4C1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...