1JJTA

Imp-1 metallo beta-lactamase from pseudomonas aeruginosa in complex with a biaryl succinic acid inhibitor (1)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
220
structure length
220
Chain Sequence
SLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Succinic acids as potent inhibitors of plasmid-borne IMP-1 metallo-beta-lactamase.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords IMP-1 METALLO BETA-LACTAMASE
total genus 67
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1jjtA00
5LCHA 5HISA 3IE0A 4FEKA 2WRSA 4KEQA 1YCGA 2CBNA 4TYTA 5K4NA 3WXCA 4EYBA 4EXSA 4C1DA 4AWYB 4Z5YA 5LE1A 2QDTA 1X8IA 3JXPA 4AX1B 4GYQA 4D1WA 2GKLA 2FU6A 2NXAA 4WD6A 1WRAA 4Z7RA 3ADRA 5A5ZA 1BC2A 4TZEA 2P18A 3ZNBA 3Q6VA 3TP9A 2YNVA 4Z60A 1WUPA 2I7XA 4ZO2A 4HKYA 2BGAA 4ZEJA 3X30A 2YNTA 1DD6A 5ACXA 4PVOA 4UWOB 4P62A 4C1GA 1XTOA 1A7TA 5AHRA 4EYFA 2E7YA 2GFKA 4XWTA 3DHBA 4EFZA 5IQKA 4XUKA 4FSBA 2BMIA 1Y44A 2UYXA 2BG7A 5EV8A 3PG4A 2Y8AA 3SD9A 2I7TA 3AJ3A 2DOOA 3DH8A 3SFPA 4NQ6A 2M5CA 3IOGA 3ZR9A 3MD7A 2VW8A 2Q9UA 5HH4A 2YCBA 1VGNA 3I11A 4HL1A 4H0DA 5LCAA 3DHAA 5EWAA 5FQBA 4D1VA 2P1EA 3H3EA 5K0WA 3SPUA 2BG8B 5EVKA 5ACUA 2FHXA 4UWPB 4NQ4A 4YSLA 3I15A 1KO3A 4TYFA 2ZWRA 2BG8A 5ACSA 5ACQA 5ACPA 2Q0IA 5LCFA 5ACTA 1X8GA 2BTNA 4JO0A 5EV6A 2FHXB 5EHTA 3FCZA 5B15A 3T3OA 3DHCA 3KNRA 3L6NA 3VQZA 5A0VA 4Z6XA 4RAMA 1DDKA 5ACWA 4C09A 1HLKA 4LE6A 2QINA 2Y87A 1X8HA 3R2UA 5K4KA 4TZ9A 5AXRA 2H6AA 4DIKA 3SRXA 4RL0A 3IE2A 3VPEA 4C1CA 2NZEA 2BFZA 5HH5A 5B1UA 1A8TA 4O98A 1K07A 5LSCA 1WUOA 1XM8A 1ZTCA 3BC2A 4D1UA 2BC2A 2Q42A 4XWWA 2DKFA 4GCWA 3I13A 2M5DA 4NQ2A 4UWSB 3RKJA 1M2XA 3IEKA 2GCUA 2QDSA 5AHOA 5K4MA 5AEBA 5LM6A 5ACRA 2Q0JA 2BG2A 2GMNA 2AZ4A 3AF5A 2BG6A 2WYMC 3BV6A 3ZWFA 2FU7A 3IEMA 4J5HA 5ACVA 3AF6A 1ZNBA 2YNTB 3KNSA 4C1FA 2BR6A 2FU8A 1DXKA 3SW3A 3X2YA 2WYMA 3IDZA 4EXYA 3T3NA 5DPXA 3BK2A 4EYLA 4U4LA 5HIQA 3S0ZA 5FQAA 3IOFA 3IE1A 2HB9A 2XF4A 5EVDA 1VJNA 4TZBA 4UWRB 2R2DA 4B87A 3RKKA 3LVZA 4C1EA 1QH5A 1VMEA 3ESHA 3G1PA 4J5FA 2OHHA 1SMLA 4UA4A 4F6HA 4UBQA 5EW0A 3FAIA 3I0VA 4NQ5A 5LLDA 4V0HA 4YSBA 2WYLA 2NZFA 2YNWA 2YZ3A 2XR1A 1JJTA 4CHLA 2QJSA 5AYAA 5HIPA 2YNUA 4BP0A 4D02A 4AX0B 4FR7A 4RL2A 2BFLA 5LMCA 2QEDA 4GYUA 5KIKA 5B3RA 2NYPA 4C1HA 4EY2A 2A7MA 1JT1A 2Y8BA 5LS3A 5EVBA 1BMCA 2YNVB 4KEPA 4YSKA 3SBLA 3I14A 3IELA 2AIOA 3F9OA 4RAWA 5FQCA 5A87A 2OHIA 4ZO3A 1KR3A 4AD9A 2ZO4A 5A0TA 4RBSA 3T9MA 4F6ZA 1YCFA 3ZQ4A 2GFJA 1JJEA 4HL2A 2P4ZA 3PY6A 4BZ3A 4TZFA 3RPCA 1E5DA 5EH9A 3QH8A 3X2XA 2FM6A 5HH6A 4PVTA 2BFZB 4Z5ZA 3PY5A 4AWZA 1KO2A 1ZKPA 5HIOA 2ZNBA 2OHJA 2I7VA 5KILA 4Z67A 3X2ZA 4D1TA 2ZZIA 2BFKA 1P9EA 4UAMA 4RM5A 2P97A 1YCHA 4ZNBA 2FK6A 2WHGA 2FU9A 1MQOA 1WW1A 1L9YA 1BVTA 2BIBA 5AXOA 3A4YA 3BK1A 4DILA 3KL7A 3P2UA 1QH3A
chains in the Genus database with same CATH superfamily
5LCHA 5HISA 3IE0A 4FEKA 2WRSA 4KEQA 1YCGA 2CBNA 4TYTA 5K4NA 5A23A 3WXCA 4EYBA 4EXSA 4C1DA 4AWYB 4Z5YA 5LE1A 2QDTA 1X8IA 3JXPA 4AX1B 4GYQA 4D1WA 2GKLA 2FU6A 2NXAA 4WD6A 1WRAA 4Z7RA 3ADRA 5A5ZA 1BC2A 4TZEA 2P18A 3ZNBA 3Q6VA 3TP9A 2YNVA 4Z60A 1WUPA 2I7XA 4ZO2A 4HKYA 2BGAA 4ZEJA 3X30A 2YNTA 1DD6A 5ACXA 4PVOA 4UWOB 4P62A 4C1GA 1XTOA 1A7TA 5AHRA 4EYFA 2E7YA 2GFKA 4XWTA 3DHBA 4EFZA 5IQKA 4XUKA 4FSBA 2BMIA 1Y44A 2UYXA 2BG7A 2YHEA 5EV8A 3PG4A 2Y8AA 3SD9A 2I7TA 3AJ3A 2DOOA 3DH8A 3SFPA 4NQ6A 2M5CA 3IOGA 3ZR9A 3MD7A 2VW8A 2Q9UA 5HH4A 2YCBA 1VGNA 3I11A 4HL1A 4H0DA 4NURA 5LCAA 3DHAA 5EWAA 5FQBA 4D1VA 2P1EA 3H3EA 5K0WA 3SPUA 2BG8B 5EVKA 5ACUA 2FHXA 4UWPB 4NQ4A 4YSLA 3I15A 1KO3A 4TYFA 2ZWRA 2BG8A 5ACSA 5ACQA 5ACPA 2Q0IA 5LCFA 5ACTA 1X8GA 2BTNA 4JO0A 5EV6A 2FHXB 5EHTA 3FCZA 5B15A 3T3OA 3DHCA 3KNRA 3L6NA 3VQZA 5A0VA 4Z6XA 4RAMA 1DDKA 5ACWA 4C09A 1HLKA 4LE6A 2QINA 2Y87A 1X8HA 3R2UA 5K4KA 4TZ9A 5AXRA 2H6AA 4DIKA 3SRXA 4RL0A 3IE2A 3VPEA 4C1CA 2NZEA 2BFZA 5HH5A 5B1UA 1A8TA 4O98A 5AJLA 1K07A 5LSCA 1WUOA 1XM8A 1ZTCA 3BC2A 4D1UA 2BC2A 2Q42A 4XWWA 2DKFA 4GCWA 3I13A 2M5DA 4NQ2A 4PDXA 4UWSB 3RKJA 1M2XA 3IEKA 2GCUA 2QDSA 5AIJA 5AHOA 5K4MA 5AEBA 5LM6A 5ACRA 2Q0JA 2BG2A 2GMNA 2AZ4A 3AF5A 2BG6A 2WYMC 3BV6A 3ZWFA 2FU7A 3IEMA 4J5HA 5ACVA 3AF6A 1ZNBA 2YNTB 3KNSA 4C1FA 2BR6A 2FU8A 1DXKA 2CG2A 3SW3A 3X2YA 2WYMA 3IDZA 4EXYA 3T3NA 5DPXA 3BK2A 4EYLA 4U4LA 5HIQA 3S0ZA 5FQAA 3IOFA 3IE1A 2HB9A 2XF4A 5EVDA 1VJNA 4TZBA 4UWRB 2R2DA 4B87A 3RKKA 3LVZA 4C1EA 1QH5A 1VMEA 3ESHA 3G1PA 4J5FA 2OHHA 1SMLA 4AXHA 4UA4A 4F6HA 4UBQA 5EW0A 3FAIA 3I0VA 4NQ5A 5LLDA 4V0HA 4YSBA 2WYLA 2NZFA 2YNWA 2YZ3A 2XR1A 1JJTA 4CHLA 2QJSA 5AYAA 5HIPA 2YNUA 4BP0A 4D02A 4AX0B 4FR7A 4RL2A 2BFLA 5LMCA 2QEDA 4GYUA 5KIKA 5B3RA 2NYPA 4C1HA 4EY2A 2A7MA 1JT1A 2CFZA 2Y8BA 5LS3A 5EVBA 1BMCA 2YNVB 2CG3A 4KEPA 4YSKA 3SBLA 3I14A 3IELA 2AIOA 3F9OA 4RAWA 5FQCA 5A87A 2OHIA 4ZO3A 1KR3A 4AD9A 2ZO4A 5A0TA 4RBSA 3T9MA 4F6ZA 1YCFA 3ZQ4A 2GFJA 1JJEA 4HL2A 2P4ZA 3PY6A 4BZ3A 4TZFA 3RPCA 1E5DA 5EH9A 3QH8A 3X2XA 2FM6A 5HH6A 4PVTA 2BFZB 4Z5ZA 3PY5A 4AWZA 1KO2A 1ZKPA 5HIOA 2ZNBA 2OHJA 2I7VA 5KILA 4AV7A 4Z67A 3X2ZA 2CFUA 4D1TA 2ZZIA 2BFKA 1P9EA 4UAMA 4RM5A 2P97A 1YCHA 4ZNBA 2FK6A 2WHGA 2FU9A 1MQOA 1WW1A 1L9YA 1BVTA 2BIBA 5AXOA 3A4YA 3BK1A 4DILA 3KL7A 3P2UA 1QH3A
chains in the Genus database with same CATH topology
5LCHA 5HISA 3IE0A 4FEKA 2WRSA 4KEQA 1YCGA 2CBNA 4TYTA 5K4NA 3WXCA 4EYBA 4EXSA 4C1DA 4AWYB 4Z5YA 5LE1A 2QDTA 1X8IA 3JXPA 4AX1B 4GYQA 4D1WA 2GKLA 2FU6A 2NXAA 4WD6A 1WRAA 4Z7RA 3ADRA 5A5ZA 1BC2A 4TZEA 2P18A 3ZNBA 3Q6VA 3TP9A 2YNVA 4Z60A 1WUPA 2I7XA 4ZO2A 4HKYA 2BGAA 4ZEJA 3X30A 2YNTA 1DD6A 5ACXA 4PVOA 4UWOB 4P62A 4C1GA 1XTOA 1A7TA 5AHRA 4EYFA 2E7YA 2GFKA 4XWTA 3DHBA 4EFZA 5IQKA 4XUKA 4FSBA 2BMIA 1Y44A 2UYXA 2BG7A 5EV8A 3PG4A 2Y8AA 3SD9A 2I7TA 3AJ3A 2DOOA 3DH8A 3SFPA 4NQ6A 2M5CA 3IOGA 3ZR9A 3MD7A 2VW8A 2Q9UA 5HH4A 2YCBA 1VGNA 3I11A 4HL1A 4H0DA 5LCAA 3DHAA 5EWAA 5FQBA 4D1VA 2P1EA 3H3EA 5K0WA 3SPUA 2BG8B 5EVKA 5ACUA 2FHXA 4UWPB 4NQ4A 4YSLA 3I15A 1KO3A 4TYFA 2ZWRA 2BG8A 5ACSA 5ACQA 5ACPA 2Q0IA 5LCFA 5ACTA 1X8GA 2BTNA 4JO0A 5EV6A 2FHXB 5EHTA 3FCZA 5B15A 3T3OA 3DHCA 3KNRA 3L6NA 3VQZA 5A0VA 4Z6XA 4RAMA 1DDKA 5ACWA 4C09A 1HLKA 4LE6A 2QINA 2Y87A 1X8HA 3R2UA 5K4KA 4TZ9A 5AXRA 2H6AA 4DIKA 3SRXA 4RL0A 3IE2A 3VPEA 4C1CA 2NZEA 2BFZA 5HH5A 5B1UA 1A8TA 4O98A 1K07A 5LSCA 1WUOA 1XM8A 1ZTCA 3BC2A 4D1UA 2BC2A 2Q42A 4XWWA 2DKFA 4GCWA 3I13A 2M5DA 4NQ2A 4UWSB 3RKJA 1M2XA 3IEKA 2GCUA 2QDSA 5AHOA 5K4MA 5AEBA 5LM6A 5ACRA 2Q0JA 2BG2A 2GMNA 2AZ4A 3AF5A 2BG6A 2WYMC 3BV6A 3ZWFA 2FU7A 3IEMA 4J5HA 5ACVA 3AF6A 1ZNBA 2YNTB 3KNSA 4C1FA 2BR6A 2FU8A 1DXKA 3SW3A 3X2YA 2WYMA 3IDZA 4EXYA 3T3NA 5DPXA 3BK2A 4EYLA 4U4LA 5HIQA 3S0ZA 5FQAA 3IOFA 3IE1A 2HB9A 2XF4A 5EVDA 1VJNA 4TZBA 4UWRB 2R2DA 4B87A 3RKKA 3LVZA 4C1EA 1QH5A 1VMEA 3ESHA 3G1PA 4J5FA 2OHHA 1SMLA 4UA4A 4F6HA 4UBQA 5EW0A 3FAIA 3I0VA 4NQ5A 5LLDA 4V0HA 4YSBA 2WYLA 2NZFA 2YNWA 2YZ3A 2XR1A 1JJTA 4CHLA 2QJSA 5AYAA 5HIPA 2YNUA 4BP0A 4D02A 4AX0B 4FR7A 4RL2A 2BFLA 5LMCA 2QEDA 4GYUA 5KIKA 5B3RA 2NYPA 4C1HA 4EY2A 2A7MA 1JT1A 2Y8BA 5LS3A 5EVBA 1BMCA 2YNVB 4KEPA 4YSKA 3SBLA 3I14A 3IELA 2AIOA 3F9OA 4RAWA 5FQCA 5A87A 2OHIA 4ZO3A 1KR3A 4AD9A 2ZO4A 5A0TA 4RBSA 3T9MA 4F6ZA 1YCFA 3ZQ4A 2GFJA 1JJEA 4HL2A 2P4ZA 3PY6A 4BZ3A 4TZFA 3RPCA 1E5DA 5EH9A 3QH8A 3X2XA 2FM6A 5HH6A 4PVTA 2BFZB 4Z5ZA 3PY5A 4AWZA 1KO2A 1ZKPA 5HIOA 2ZNBA 2OHJA 2I7VA 5KILA 4Z67A 3X2ZA 4D1TA 2ZZIA 2BFKA 1P9EA 4UAMA 4RM5A 2P97A 1YCHA 4ZNBA 2FK6A 2WHGA 2FU9A 1MQOA 1WW1A 1L9YA 1BVTA 2BIBA 5AXOA 3A4YA 3BK1A 4DILA 3KL7A 3P2UA 1QH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LCH A;  5HIS A;  3IE0 A;  4FEK A;  2WRS A;  4KEQ A;  1YCG A;  2CBN A;  4TYT A;  5K4N A;  3WXC A;  4EYB A;  4EXS A;  4C1D A;  4AWY B;  4Z5Y A;  5LE1 A;  2QDT A;  1X8I A;  3JXP A;  4AX1 B;  4GYQ A;  4D1W A;  2GKL A;  2FU6 A;  2NXA A;  4WD6 A;  1WRA A;  4Z7R A;  3ADR A;  5A5Z A;  1BC2 A;  4TZE A;  2P18 A;  3ZNB A;  3Q6V A;  3TP9 A;  2YNV A;  4Z60 A;  1WUP A;  2I7X A;  4ZO2 A;  4HKY A;  2BGA A;  4ZEJ A;  3X30 A;  2YNT A;  1DD6 A;  5ACX A;  4PVO A;  4UWO B;  4P62 A;  4C1G A;  1XTO A;  1A7T A;  5AHR A;  4EYF A;  2E7Y A;  2GFK A;  4XWT A;  3DHB A;  4EFZ A;  5IQK A;  4XUK A;  4FSB A;  2BMI A;  1Y44 A;  2UYX A;  2BG7 A;  5EV8 A;  3PG4 A;  2Y8A A;  3SD9 A;  2I7T A;  3AJ3 A;  2DOO A;  3DH8 A;  3SFP A;  4NQ6 A;  2M5C A;  3IOG A;  3ZR9 A;  3MD7 A;  2VW8 A;  2Q9U A;  5HH4 A;  2YCB A;  1VGN A;  3I11 A;  4HL1 A;  4H0D A;  5LCA A;  3DHA A;  5EWA A;  5FQB A;  4D1V A;  2P1E A;  3H3E A;  5K0W A;  3SPU A;  2BG8 B;  5EVK A;  5ACU A;  2FHX A;  4UWP B;  4NQ4 A;  4YSL A;  3I15 A;  1KO3 A;  4TYF A;  2ZWR A;  2BG8 A;  5ACS A;  5ACQ A;  5ACP A;  2Q0I A;  5LCF A;  5ACT A;  1X8G A;  2BTN A;  4JO0 A;  5EV6 A;  2FHX B;  5EHT A;  3FCZ A;  5B15 A;  3T3O A;  3DHC A;  3KNR A;  3L6N A;  3VQZ A;  5A0V A;  4Z6X A;  4RAM A;  1DDK A;  5ACW A;  4C09 A;  1HLK A;  4LE6 A;  2QIN A;  2Y87 A;  1X8H A;  3R2U A;  5K4K A;  4TZ9 A;  5AXR A;  2H6A A;  4DIK A;  3SRX A;  4RL0 A;  3IE2 A;  3VPE A;  4C1C A;  2NZE A;  2BFZ A;  5HH5 A;  5B1U A;  1A8T A;  4O98 A;  1K07 A;  5LSC A;  1WUO A;  1XM8 A;  1ZTC A;  3BC2 A;  4D1U A;  2BC2 A;  2Q42 A;  4XWW A;  2DKF A;  4GCW A;  3I13 A;  2M5D A;  4NQ2 A;  4UWS B;  3RKJ A;  1M2X A;  3IEK A;  2GCU A;  2QDS A;  5AHO A;  5K4M A;  5AEB A;  5LM6 A;  5ACR A;  2Q0J A;  2BG2 A;  2GMN A;  2AZ4 A;  3AF5 A;  2BG6 A;  2WYM C;  3BV6 A;  3ZWF A;  2FU7 A;  3IEM A;  4J5H A;  5ACV A;  3AF6 A;  1ZNB A;  2YNT B;  3KNS A;  4C1F A;  2BR6 A;  2FU8 A;  1DXK A;  3SW3 A;  3X2Y A;  2WYM A;  3IDZ A;  4EXY A;  3T3N A;  5DPX A;  3BK2 A;  4EYL A;  4U4L A;  5HIQ A;  3S0Z A;  5FQA A;  3IOF A;  3IE1 A;  2HB9 A;  2XF4 A;  5EVD A;  1VJN A;  4TZB A;  4UWR B;  2R2D A;  4B87 A;  3RKK A;  3LVZ A;  4C1E A;  1QH5 A;  1VME A;  3ESH A;  3G1P A;  4J5F A;  2OHH A;  1SML A;  4UA4 A;  4F6H A;  4UBQ A;  5EW0 A;  3FAI A;  3I0V A;  4NQ5 A;  5LLD A;  4V0H A;  4YSB A;  2WYL A;  2NZF A;  2YNW A;  2YZ3 A;  2XR1 A;  1JJT A;  4CHL A;  2QJS A;  5AYA A;  5HIP A;  2YNU A;  4BP0 A;  4D02 A;  4AX0 B;  4FR7 A;  4RL2 A;  2BFL A;  5LMC A;  2QED A;  4GYU A;  5KIK A;  5B3R A;  2NYP A;  4C1H A;  4EY2 A;  2A7M A;  1JT1 A;  2Y8B A;  5LS3 A;  5EVB A;  1BMC A;  2YNV B;  4KEP A;  4YSK A;  3SBL A;  3I14 A;  3IEL A;  2AIO A;  3F9O A;  4RAW A;  5FQC A;  5A87 A;  2OHI A;  4ZO3 A;  1KR3 A;  4AD9 A;  2ZO4 A;  5A0T A;  4RBS A;  3T9M A;  4F6Z A;  1YCF A;  3ZQ4 A;  2GFJ A;  1JJE A;  4HL2 A;  2P4Z A;  3PY6 A;  4BZ3 A;  4TZF A;  3RPC A;  1E5D A;  5EH9 A;  3QH8 A;  3X2X A;  2FM6 A;  5HH6 A;  4PVT A;  2BFZ B;  4Z5Z A;  3PY5 A;  4AWZ A;  1KO2 A;  1ZKP A;  5HIO A;  2ZNB A;  2OHJ A;  2I7V A;  5KIL A;  4Z67 A;  3X2Z A;  4D1T A;  2ZZI A;  2BFK A;  1P9E A;  4UAM A;  4RM5 A;  2P97 A;  1YCH A;  4ZNB A;  2FK6 A;  2WHG A;  2FU9 A;  1MQO A;  1WW1 A;  1L9Y A;  1BVT A;  2BIB A;  5AXO A;  3A4Y A;  3BK1 A;  4DIL A;  3KL7 A;  3P2U A;  1QH3 A; 
#chains in the Genus database with same CATH topology
 5LCH A;  5HIS A;  3IE0 A;  4FEK A;  2WRS A;  4KEQ A;  1YCG A;  2CBN A;  4TYT A;  5K4N A;  5A23 A;  3WXC A;  4EYB A;  4EXS A;  4C1D A;  4AWY B;  4Z5Y A;  5LE1 A;  2QDT A;  1X8I A;  3JXP A;  4AX1 B;  4GYQ A;  4D1W A;  2GKL A;  2FU6 A;  2NXA A;  4WD6 A;  1WRA A;  4Z7R A;  3ADR A;  5A5Z A;  1BC2 A;  4TZE A;  2P18 A;  3ZNB A;  3Q6V A;  3TP9 A;  2YNV A;  4Z60 A;  1WUP A;  2I7X A;  4ZO2 A;  4HKY A;  2BGA A;  4ZEJ A;  3X30 A;  2YNT A;  1DD6 A;  5ACX A;  4PVO A;  4UWO B;  4P62 A;  4C1G A;  1XTO A;  1A7T A;  5AHR A;  4EYF A;  2E7Y A;  2GFK A;  4XWT A;  3DHB A;  4EFZ A;  5IQK A;  4XUK A;  4FSB A;  2BMI A;  1Y44 A;  2UYX A;  2BG7 A;  2YHE A;  5EV8 A;  3PG4 A;  2Y8A A;  3SD9 A;  2I7T A;  3AJ3 A;  2DOO A;  3DH8 A;  3SFP A;  4NQ6 A;  2M5C A;  3IOG A;  3ZR9 A;  3MD7 A;  2VW8 A;  2Q9U A;  5HH4 A;  2YCB A;  1VGN A;  3I11 A;  4HL1 A;  4H0D A;  4NUR A;  5LCA A;  3DHA A;  5EWA A;  5FQB A;  4D1V A;  2P1E A;  3H3E A;  5K0W A;  3SPU A;  2BG8 B;  5EVK A;  5ACU A;  2FHX A;  4UWP B;  4NQ4 A;  4YSL A;  3I15 A;  1KO3 A;  4TYF A;  2ZWR A;  2BG8 A;  5ACS A;  5ACQ A;  5ACP A;  2Q0I A;  5LCF A;  5ACT A;  1X8G A;  2BTN A;  4JO0 A;  5EV6 A;  2FHX B;  5EHT A;  3FCZ A;  5B15 A;  3T3O A;  3DHC A;  3KNR A;  3L6N A;  3VQZ A;  5A0V A;  4Z6X A;  4RAM A;  1DDK A;  5ACW A;  4C09 A;  1HLK A;  4LE6 A;  2QIN A;  2Y87 A;  1X8H A;  3R2U A;  5K4K A;  4TZ9 A;  5AXR A;  2H6A A;  4DIK A;  3SRX A;  4RL0 A;  3IE2 A;  3VPE A;  4C1C A;  2NZE A;  2BFZ A;  5HH5 A;  5B1U A;  1A8T A;  4O98 A;  5AJL A;  1K07 A;  5LSC A;  1WUO A;  1XM8 A;  1ZTC A;  3BC2 A;  4D1U A;  2BC2 A;  2Q42 A;  4XWW A;  2DKF A;  4GCW A;  3I13 A;  2M5D A;  4NQ2 A;  4PDX A;  4UWS B;  3RKJ A;  1M2X A;  3IEK A;  2GCU A;  2QDS A;  5AIJ A;  5AHO A;  5K4M A;  5AEB A;  5LM6 A;  5ACR A;  2Q0J A;  2BG2 A;  2GMN A;  2AZ4 A;  3AF5 A;  2BG6 A;  2WYM C;  3BV6 A;  3ZWF A;  2FU7 A;  3IEM A;  4J5H A;  5ACV A;  3AF6 A;  1ZNB A;  2YNT B;  3KNS A;  4C1F A;  2BR6 A;  2FU8 A;  1DXK A;  2CG2 A;  3SW3 A;  3X2Y A;  2WYM A;  3IDZ A;  4EXY A;  3T3N A;  5DPX A;  3BK2 A;  4EYL A;  4U4L A;  5HIQ A;  3S0Z A;  5FQA A;  3IOF A;  3IE1 A;  2HB9 A;  2XF4 A;  5EVD A;  1VJN A;  4TZB A;  4UWR B;  2R2D A;  4B87 A;  3RKK A;  3LVZ A;  4C1E A;  1QH5 A;  1VME A;  3ESH A;  3G1P A;  4J5F A;  2OHH A;  1SML A;  4AXH A;  4UA4 A;  4F6H A;  4UBQ A;  5EW0 A;  3FAI A;  3I0V A;  4NQ5 A;  5LLD A;  4V0H A;  4YSB A;  2WYL A;  2NZF A;  2YNW A;  2YZ3 A;  2XR1 A;  1JJT A;  4CHL A;  2QJS A;  5AYA A;  5HIP A;  2YNU A;  4BP0 A;  4D02 A;  4AX0 B;  4FR7 A;  4RL2 A;  2BFL A;  5LMC A;  2QED A;  4GYU A;  5KIK A;  5B3R A;  2NYP A;  4C1H A;  4EY2 A;  2A7M A;  1JT1 A;  2CFZ A;  2Y8B A;  5LS3 A;  5EVB A;  1BMC A;  2YNV B;  2CG3 A;  4KEP A;  4YSK A;  3SBL A;  3I14 A;  3IEL A;  2AIO A;  3F9O A;  4RAW A;  5FQC A;  5A87 A;  2OHI A;  4ZO3 A;  1KR3 A;  4AD9 A;  2ZO4 A;  5A0T A;  4RBS A;  3T9M A;  4F6Z A;  1YCF A;  3ZQ4 A;  2GFJ A;  1JJE A;  4HL2 A;  2P4Z A;  3PY6 A;  4BZ3 A;  4TZF A;  3RPC A;  1E5D A;  5EH9 A;  3QH8 A;  3X2X A;  2FM6 A;  5HH6 A;  4PVT A;  2BFZ B;  4Z5Z A;  3PY5 A;  4AWZ A;  1KO2 A;  1ZKP A;  5HIO A;  2ZNB A;  2OHJ A;  2I7V A;  5KIL A;  4AV7 A;  4Z67 A;  3X2Z A;  2CFU A;  4D1T A;  2ZZI A;  2BFK A;  1P9E A;  4UAM A;  4RM5 A;  2P97 A;  1YCH A;  4ZNB A;  2FK6 A;  2WHG A;  2FU9 A;  1MQO A;  1WW1 A;  1L9Y A;  1BVT A;  2BIB A;  5AXO A;  3A4Y A;  3BK1 A;  4DIL A;  3KL7 A;  3P2U A;  1QH3 A; 
#chains in the Genus database with same CATH homology
 5LCH A;  5HIS A;  3IE0 A;  4FEK A;  2WRS A;  4KEQ A;  1YCG A;  2CBN A;  4TYT A;  5K4N A;  3WXC A;  4EYB A;  4EXS A;  4C1D A;  4AWY B;  4Z5Y A;  5LE1 A;  2QDT A;  1X8I A;  3JXP A;  4AX1 B;  4GYQ A;  4D1W A;  2GKL A;  2FU6 A;  2NXA A;  4WD6 A;  1WRA A;  4Z7R A;  3ADR A;  5A5Z A;  1BC2 A;  4TZE A;  2P18 A;  3ZNB A;  3Q6V A;  3TP9 A;  2YNV A;  4Z60 A;  1WUP A;  2I7X A;  4ZO2 A;  4HKY A;  2BGA A;  4ZEJ A;  3X30 A;  2YNT A;  1DD6 A;  5ACX A;  4PVO A;  4UWO B;  4P62 A;  4C1G A;  1XTO A;  1A7T A;  5AHR A;  4EYF A;  2E7Y A;  2GFK A;  4XWT A;  3DHB A;  4EFZ A;  5IQK A;  4XUK A;  4FSB A;  2BMI A;  1Y44 A;  2UYX A;  2BG7 A;  5EV8 A;  3PG4 A;  2Y8A A;  3SD9 A;  2I7T A;  3AJ3 A;  2DOO A;  3DH8 A;  3SFP A;  4NQ6 A;  2M5C A;  3IOG A;  3ZR9 A;  3MD7 A;  2VW8 A;  2Q9U A;  5HH4 A;  2YCB A;  1VGN A;  3I11 A;  4HL1 A;  4H0D A;  5LCA A;  3DHA A;  5EWA A;  5FQB A;  4D1V A;  2P1E A;  3H3E A;  5K0W A;  3SPU A;  2BG8 B;  5EVK A;  5ACU A;  2FHX A;  4UWP B;  4NQ4 A;  4YSL A;  3I15 A;  1KO3 A;  4TYF A;  2ZWR A;  2BG8 A;  5ACS A;  5ACQ A;  5ACP A;  2Q0I A;  5LCF A;  5ACT A;  1X8G A;  2BTN A;  4JO0 A;  5EV6 A;  2FHX B;  5EHT A;  3FCZ A;  5B15 A;  3T3O A;  3DHC A;  3KNR A;  3L6N A;  3VQZ A;  5A0V A;  4Z6X A;  4RAM A;  1DDK A;  5ACW A;  4C09 A;  1HLK A;  4LE6 A;  2QIN A;  2Y87 A;  1X8H A;  3R2U A;  5K4K A;  4TZ9 A;  5AXR A;  2H6A A;  4DIK A;  3SRX A;  4RL0 A;  3IE2 A;  3VPE A;  4C1C A;  2NZE A;  2BFZ A;  5HH5 A;  5B1U A;  1A8T A;  4O98 A;  1K07 A;  5LSC A;  1WUO A;  1XM8 A;  1ZTC A;  3BC2 A;  4D1U A;  2BC2 A;  2Q42 A;  4XWW A;  2DKF A;  4GCW A;  3I13 A;  2M5D A;  4NQ2 A;  4UWS B;  3RKJ A;  1M2X A;  3IEK A;  2GCU A;  2QDS A;  5AHO A;  5K4M A;  5AEB A;  5LM6 A;  5ACR A;  2Q0J A;  2BG2 A;  2GMN A;  2AZ4 A;  3AF5 A;  2BG6 A;  2WYM C;  3BV6 A;  3ZWF A;  2FU7 A;  3IEM A;  4J5H A;  5ACV A;  3AF6 A;  1ZNB A;  2YNT B;  3KNS A;  4C1F A;  2BR6 A;  2FU8 A;  1DXK A;  3SW3 A;  3X2Y A;  2WYM A;  3IDZ A;  4EXY A;  3T3N A;  5DPX A;  3BK2 A;  4EYL A;  4U4L A;  5HIQ A;  3S0Z A;  5FQA A;  3IOF A;  3IE1 A;  2HB9 A;  2XF4 A;  5EVD A;  1VJN A;  4TZB A;  4UWR B;  2R2D A;  4B87 A;  3RKK A;  3LVZ A;  4C1E A;  1QH5 A;  1VME A;  3ESH A;  3G1P A;  4J5F A;  2OHH A;  1SML A;  4UA4 A;  4F6H A;  4UBQ A;  5EW0 A;  3FAI A;  3I0V A;  4NQ5 A;  5LLD A;  4V0H A;  4YSB A;  2WYL A;  2NZF A;  2YNW A;  2YZ3 A;  2XR1 A;  1JJT A;  4CHL A;  2QJS A;  5AYA A;  5HIP A;  2YNU A;  4BP0 A;  4D02 A;  4AX0 B;  4FR7 A;  4RL2 A;  2BFL A;  5LMC A;  2QED A;  4GYU A;  5KIK A;  5B3R A;  2NYP A;  4C1H A;  4EY2 A;  2A7M A;  1JT1 A;  2Y8B A;  5LS3 A;  5EVB A;  1BMC A;  2YNV B;  4KEP A;  4YSK A;  3SBL A;  3I14 A;  3IEL A;  2AIO A;  3F9O A;  4RAW A;  5FQC A;  5A87 A;  2OHI A;  4ZO3 A;  1KR3 A;  4AD9 A;  2ZO4 A;  5A0T A;  4RBS A;  3T9M A;  4F6Z A;  1YCF A;  3ZQ4 A;  2GFJ A;  1JJE A;  4HL2 A;  2P4Z A;  3PY6 A;  4BZ3 A;  4TZF A;  3RPC A;  1E5D A;  5EH9 A;  3QH8 A;  3X2X A;  2FM6 A;  5HH6 A;  4PVT A;  2BFZ B;  4Z5Z A;  3PY5 A;  4AWZ A;  1KO2 A;  1ZKP A;  5HIO A;  2ZNB A;  2OHJ A;  2I7V A;  5KIL A;  4Z67 A;  3X2Z A;  4D1T A;  2ZZI A;  2BFK A;  1P9E A;  4UAM A;  4RM5 A;  2P97 A;  1YCH A;  4ZNB A;  2FK6 A;  2WHG A;  2FU9 A;  1MQO A;  1WW1 A;  1L9Y A;  1BVT A;  2BIB A;  5AXO A;  3A4Y A;  3BK1 A;  4DIL A;  3KL7 A;  3P2U A;  1QH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...