1JJTA

Imp-1 metallo beta-lactamase from pseudomonas aeruginosa in complex with a biaryl succinic acid inhibitor (1)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
220
structure length
220
Chain Sequence
SLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMP-1 METALLO BETA-LACTAMASE
publication title Succinic acids as potent inhibitors of plasmid-borne IMP-1 metallo-beta-lactamase.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 67
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1jjtA00
3IELA 4D1WA 5EV8A 3PY5A 4UBQA 1VMEA 1BMCA 3WXCA 3I0VA 2YNVB 3L6NA 4H0DA 2QDSA 1JT1A 4Z5YA 4NQ4A 2Y87A 3SRXA 5B3RA 3SBLA 2DOOA 1MQOA 5LS3A 4UWPB 3SD9A 3IE2A 5AXOA 2BFKA 2FHXB 3DHCA 5B15A 4EY2A 4RBSA 1YCFA 5AHOA 3ZQ4A 3X30A 4UWSB 3I14A 4XUKA 4EXSA 4XWTA 2Q9UA 4HKYA 5LCFA 1HLKA 4FR7A 1A8TA 5HISA 2BG8B 4C1DA 2BG6A 2M5CA 5ACUA 3IEKA 5AHRA 2YZ3A 1KO2A 4U4LA 5HIOA 5A5ZA 4UWOB 4YSKA 4NQ5A 5EHTA 5K4NA 3X2ZA 4TZEA 4D1UA 5HIQA 2BG7A 4DILA 2BMIA 1DXKA 1DDKA 2AIOA 2YNVA 2XF4A 2FU9A 3P2UA 1P9EA 3VQZA 4TZBA 2GFKA 3BK2A 3LVZA 4RAMA 1X8HA 5HH5A 2Q0JA 4FEKA 2P18A 2WYMA 3BV6A 4BZ3A 4EXYA 1JJTA 2FU7A 2NXAA 4XWWA 5EVDA 1X8IA 2FU6A 4CHLA 5LE1A 3IEMA 5AXRA 2Y8AA 5A0VA 2YNUA 2FHXA 2OHHA 5ACXA 4F6HA 4ZEJA 2FM6A 4J5HA 2BR6A 1WRAA 4TZ9A 5ACRA 5EVKA 3I11A 3ADRA 5K4MA 4C09A 2GKLA 3RKKA 2A7MA 3KNSA 2ZO4A 5EVBA 1L9YA 2BG8A 4GCWA 3JXPA 1KO3A 3SFPA 3IOFA 2BIBA 3A4YA 4HL2A 4AWZA 4TZFA 5ACQA 4D1TA 3H3EA 4UA4A 4YSLA 2QINA 4EYBA 3Q6VA 3AF6A 5EV6A 5FQBA 3PY6A 5FQAA 3ESHA 2H6AA 4P62A 2P4ZA 2YNWA 4AX0B 2XR1A 2UYXA 2P97A 2DKFA 4GYUA 5LLDA 4C1GA 3BK1A 2BTNA 3G1PA 4AD9A 3RPCA 2R2DA 2QEDA 4NQ6A 4LE6A 1QH3A 1XM8A 4UWRB 1E5DA 5LMCA 4C1CA 4DIKA 1QH5A 2BFZB 2Q0IA 3T3OA 5B1UA 1XTOA 1YCHA 1DD6A 4PVOA 1VGNA 4RM5A 5LCHA 2CBNA 5HH6A 3TP9A 4TYTA 3ZWFA 2WRSA 5FQCA 2GFJA 4Z60A 2YCBA 4RAWA 5ACSA 2P1EA 2OHIA 3QH8A 3DH8A 5ACWA 5EH9A 1WUOA 4V0HA 4WD6A 2HB9A 5ACTA 1Y44A 5ACVA 3I13A 1A7TA 4NQ2A 4Z6XA 4F6ZA 3IE1A 4ZNBA 5A87A 4GYQA 5DPXA 1JJEA 5K4KA 2I7TA 4J5FA 2YNTB 1YCGA 5EW0A 4JO0A 3KNRA 2WHGA 4D1VA 2M5DA 3FCZA 1VJNA 4O98A 2WYMC 2WYLA 1KR3A 2ZWRA 3SW3A 3T3NA 2I7XA 4ZO3A 4ZO2A 4KEQA 5ACPA 2I7VA 5LCAA 4RL2A 3T9MA 5AYAA 2FK6A 3SPUA 2BFZA 3AF5A 5A0TA 3MD7A 5LM6A 4EYLA 1ZTCA 2ZZIA 3IDZA 3IOGA 3ZR9A 2Q42A 1M2XA 1BC2A 5EWAA 2BC2A 4AWYB 5KILA 3FAIA 3DHAA 3X2YA 2E7YA 5KIKA 4C1EA 1SMLA 4HL1A 2GCUA 2AZ4A 3AJ3A 2BG2A 2FU8A 1WUPA 1X8GA 4UAMA 3I15A 4RL0A 1K07A 4D02A 4Z5ZA 2VW8A 2NYPA 2GMNA 4TYFA 3X2XA 4C1HA 2BFLA 3DHBA 1WW1A 3KL7A 3R2UA 3S0ZA 3F9OA 3ZNBA 2YNTA 5IQKA 2QDTA 4KEPA 5K0WA 5HIPA 4AX1B 2NZEA 2ZNBA 1BVTA 3PG4A 2BGAA 2Y8BA 5AEBA 4YSBA 5HH4A 3RKJA 4EFZA 1ZKPA 4EYFA 4BP0A 5LSCA 2NZFA 3VPEA 2OHJA 3BC2A 4Z67A 4PVTA 4C1FA 4Z7RA 4B87A 2QJSA 1ZNBA 4FSBA 3IE0A
chains in the Genus database with same CATH superfamily
3IELA 4D1WA 5EV8A 3PY5A 4UBQA 1VMEA 1BMCA 3WXCA 5A23A 3I0VA 2YNVB 3L6NA 4H0DA 2QDSA 1JT1A 4Z5YA 4NQ4A 2Y87A 3SRXA 5B3RA 2CG3A 4PDXA 3SBLA 2DOOA 1MQOA 5LS3A 4UWPB 3SD9A 3IE2A 5AXOA 2BFKA 2FHXB 3DHCA 2CFUA 5B15A 4RBSA 1YCFA 5AHOA 4EY2A 3ZQ4A 3X30A 4UWSB 3I14A 4XUKA 4EXSA 4XWTA 2Q9UA 4HKYA 2CFZA 5LCFA 1HLKA 4FR7A 1A8TA 5HISA 2BG8B 4C1DA 2BG6A 2M5CA 5ACUA 3IEKA 5AHRA 2YZ3A 1KO2A 4U4LA 5HIOA 5A5ZA 4UWOB 4YSKA 4NQ5A 5EHTA 5K4NA 3X2ZA 4TZEA 4D1UA 5HIQA 2BG7A 4DILA 2BMIA 1DXKA 1DDKA 2AIOA 2YNVA 2XF4A 2FU9A 3P2UA 1P9EA 3VQZA 4TZBA 2GFKA 3BK2A 3LVZA 4RAMA 1X8HA 5HH5A 2Q0JA 4FEKA 2P18A 2WYMA 3BV6A 4BZ3A 4EXYA 1JJTA 2FU7A 2NXAA 4XWWA 5EVDA 5AJLA 1X8IA 2FU6A 4CHLA 5LE1A 3IEMA 5AXRA 2Y8AA 5A0VA 2YNUA 2FHXA 2OHHA 5ACXA 2YHEA 4F6HA 4ZEJA 2FM6A 4J5HA 2BR6A 1WRAA 4TZ9A 5ACRA 5EVKA 3I11A 3ADRA 5K4MA 4C09A 2GKLA 3RKKA 2A7MA 3KNSA 2ZO4A 5EVBA 1L9YA 2BG8A 4GCWA 3JXPA 1KO3A 3SFPA 3IOFA 2BIBA 3A4YA 4HL2A 4AWZA 4TZFA 5ACQA 4D1TA 3H3EA 4UA4A 4YSLA 2QINA 4EYBA 3Q6VA 3AF6A 5EV6A 5FQBA 3PY6A 5FQAA 3ESHA 2H6AA 4P62A 2P4ZA 2YNWA 4AX0B 2XR1A 2UYXA 2P97A 2DKFA 4GYUA 5LLDA 4C1GA 3BK1A 2BTNA 3G1PA 4AD9A 3RPCA 2R2DA 2QEDA 4NQ6A 4LE6A 1QH3A 1XM8A 4UWRB 1E5DA 5LMCA 4C1CA 4DIKA 1QH5A 2BFZB 2Q0IA 3T3OA 5B1UA 1XTOA 1YCHA 1DD6A 4PVOA 1VGNA 4RM5A 5LCHA 2CBNA 5HH6A 3TP9A 4TYTA 3ZWFA 2WRSA 5FQCA 2GFJA 4Z60A 2YCBA 4RAWA 5ACSA 2P1EA 2OHIA 3QH8A 3DH8A 5ACWA 5EH9A 1WUOA 4V0HA 4WD6A 2HB9A 5ACTA 1Y44A 5ACVA 3I13A 1A7TA 4NQ2A 4Z6XA 4F6ZA 3IE1A 4ZNBA 5A87A 4GYQA 5DPXA 4NURA 1JJEA 5K4KA 2I7TA 4J5FA 2YNTB 1YCGA 5EW0A 4JO0A 3KNRA 2WHGA 2CG2A 4D1VA 2M5DA 3FCZA 1VJNA 4O98A 2WYMC 2WYLA 1KR3A 2ZWRA 3SW3A 3T3NA 2I7XA 4ZO3A 4ZO2A 4KEQA 5ACPA 2I7VA 5LCAA 4RL2A 3T9MA 5AYAA 2FK6A 4AXHA 3SPUA 2BFZA 3AF5A 5A0TA 3MD7A 5LM6A 4EYLA 1ZTCA 2ZZIA 3IDZA 3IOGA 3ZR9A 2Q42A 1M2XA 1BC2A 5EWAA 2BC2A 4AWYB 5KILA 3FAIA 3DHAA 3X2YA 2E7YA 5KIKA 4C1EA 1SMLA 4HL1A 2GCUA 2AZ4A 3AJ3A 2BG2A 2FU8A 1WUPA 1X8GA 4UAMA 3I15A 4RL0A 1K07A 4D02A 4Z5ZA 5AIJA 2VW8A 2NYPA 2GMNA 4TYFA 3X2XA 4C1HA 2BFLA 3DHBA 1WW1A 3KL7A 3R2UA 3S0ZA 3F9OA 3ZNBA 4AV7A 2YNTA 5IQKA 2QDTA 4KEPA 5K0WA 5HIPA 4AX1B 2NZEA 2ZNBA 1BVTA 3PG4A 2BGAA 2Y8BA 5AEBA 4YSBA 5HH4A 3RKJA 4EFZA 1ZKPA 4EYFA 4BP0A 5LSCA 2NZFA 3VPEA 2OHJA 3BC2A 4Z67A 4PVTA 4C1FA 4Z7RA 4B87A 2QJSA 1ZNBA 4FSBA 3IE0A
chains in the Genus database with same CATH topology
3IELA 4D1WA 5EV8A 3PY5A 4UBQA 1VMEA 1BMCA 3WXCA 3I0VA 2YNVB 3L6NA 4H0DA 2QDSA 1JT1A 4Z5YA 4NQ4A 2Y87A 3SRXA 5B3RA 3SBLA 2DOOA 1MQOA 5LS3A 4UWPB 3SD9A 3IE2A 5AXOA 2BFKA 2FHXB 3DHCA 5B15A 4EY2A 4RBSA 1YCFA 5AHOA 3ZQ4A 3X30A 4UWSB 3I14A 4XUKA 4EXSA 4XWTA 2Q9UA 4HKYA 5LCFA 1HLKA 4FR7A 1A8TA 5HISA 2BG8B 4C1DA 2BG6A 2M5CA 5ACUA 3IEKA 5AHRA 2YZ3A 1KO2A 4U4LA 5HIOA 5A5ZA 4UWOB 4YSKA 4NQ5A 5EHTA 5K4NA 3X2ZA 4TZEA 4D1UA 5HIQA 2BG7A 4DILA 2BMIA 1DXKA 1DDKA 2AIOA 2YNVA 2XF4A 2FU9A 3P2UA 1P9EA 3VQZA 4TZBA 2GFKA 3BK2A 3LVZA 4RAMA 1X8HA 5HH5A 2Q0JA 4FEKA 2P18A 2WYMA 3BV6A 4BZ3A 4EXYA 1JJTA 2FU7A 2NXAA 4XWWA 5EVDA 1X8IA 2FU6A 4CHLA 5LE1A 3IEMA 5AXRA 2Y8AA 5A0VA 2YNUA 2FHXA 2OHHA 5ACXA 4F6HA 4ZEJA 2FM6A 4J5HA 2BR6A 1WRAA 4TZ9A 5ACRA 5EVKA 3I11A 3ADRA 5K4MA 4C09A 2GKLA 3RKKA 2A7MA 3KNSA 2ZO4A 5EVBA 1L9YA 2BG8A 4GCWA 3JXPA 1KO3A 3SFPA 3IOFA 2BIBA 3A4YA 4HL2A 4AWZA 4TZFA 5ACQA 4D1TA 3H3EA 4UA4A 4YSLA 2QINA 4EYBA 3Q6VA 3AF6A 5EV6A 5FQBA 3PY6A 5FQAA 3ESHA 2H6AA 4P62A 2P4ZA 2YNWA 4AX0B 2XR1A 2UYXA 2P97A 2DKFA 4GYUA 5LLDA 4C1GA 3BK1A 2BTNA 3G1PA 4AD9A 3RPCA 2R2DA 2QEDA 4NQ6A 4LE6A 1QH3A 1XM8A 4UWRB 1E5DA 5LMCA 4C1CA 4DIKA 1QH5A 2BFZB 2Q0IA 3T3OA 5B1UA 1XTOA 1YCHA 1DD6A 4PVOA 1VGNA 4RM5A 5LCHA 2CBNA 5HH6A 3TP9A 4TYTA 3ZWFA 2WRSA 5FQCA 2GFJA 4Z60A 2YCBA 4RAWA 5ACSA 2P1EA 2OHIA 3QH8A 3DH8A 5ACWA 5EH9A 1WUOA 4V0HA 4WD6A 2HB9A 5ACTA 1Y44A 5ACVA 3I13A 1A7TA 4NQ2A 4Z6XA 4F6ZA 3IE1A 4ZNBA 5A87A 4GYQA 5DPXA 1JJEA 5K4KA 2I7TA 4J5FA 2YNTB 1YCGA 5EW0A 4JO0A 3KNRA 2WHGA 4D1VA 2M5DA 3FCZA 1VJNA 4O98A 2WYMC 2WYLA 1KR3A 2ZWRA 3SW3A 3T3NA 2I7XA 4ZO3A 4ZO2A 4KEQA 5ACPA 2I7VA 5LCAA 4RL2A 3T9MA 5AYAA 2FK6A 3SPUA 2BFZA 3AF5A 5A0TA 3MD7A 5LM6A 4EYLA 1ZTCA 2ZZIA 3IDZA 3IOGA 3ZR9A 2Q42A 1M2XA 1BC2A 5EWAA 2BC2A 4AWYB 5KILA 3FAIA 3DHAA 3X2YA 2E7YA 5KIKA 4C1EA 1SMLA 4HL1A 2GCUA 2AZ4A 3AJ3A 2BG2A 2FU8A 1WUPA 1X8GA 4UAMA 3I15A 4RL0A 1K07A 4D02A 4Z5ZA 2VW8A 2NYPA 2GMNA 4TYFA 3X2XA 4C1HA 2BFLA 3DHBA 1WW1A 3KL7A 3R2UA 3S0ZA 3F9OA 3ZNBA 2YNTA 5IQKA 2QDTA 4KEPA 5K0WA 5HIPA 4AX1B 2NZEA 2ZNBA 1BVTA 3PG4A 2BGAA 2Y8BA 5AEBA 4YSBA 5HH4A 3RKJA 4EFZA 1ZKPA 4EYFA 4BP0A 5LSCA 2NZFA 3VPEA 2OHJA 3BC2A 4Z67A 4PVTA 4C1FA 4Z7RA 4B87A 2QJSA 1ZNBA 4FSBA 3IE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IEL A;  4D1W A;  5EV8 A;  3PY5 A;  4UBQ A;  1VME A;  1BMC A;  3WXC A;  3I0V A;  2YNV B;  3L6N A;  4H0D A;  2QDS A;  1JT1 A;  4Z5Y A;  4NQ4 A;  2Y87 A;  3SRX A;  5B3R A;  3SBL A;  2DOO A;  1MQO A;  5LS3 A;  4UWP B;  3SD9 A;  3IE2 A;  5AXO A;  2BFK A;  2FHX B;  3DHC A;  5B15 A;  4EY2 A;  4RBS A;  1YCF A;  5AHO A;  3ZQ4 A;  3X30 A;  4UWS B;  3I14 A;  4XUK A;  4EXS A;  4XWT A;  2Q9U A;  4HKY A;  5LCF A;  1HLK A;  4FR7 A;  1A8T A;  5HIS A;  2BG8 B;  4C1D A;  2BG6 A;  2M5C A;  5ACU A;  3IEK A;  5AHR A;  2YZ3 A;  1KO2 A;  4U4L A;  5HIO A;  5A5Z A;  4UWO B;  4YSK A;  4NQ5 A;  5EHT A;  5K4N A;  3X2Z A;  4TZE A;  4D1U A;  5HIQ A;  2BG7 A;  4DIL A;  2BMI A;  1DXK A;  1DDK A;  2AIO A;  2YNV A;  2XF4 A;  2FU9 A;  3P2U A;  1P9E A;  3VQZ A;  4TZB A;  2GFK A;  3BK2 A;  3LVZ A;  4RAM A;  1X8H A;  5HH5 A;  2Q0J A;  4FEK A;  2P18 A;  2WYM A;  3BV6 A;  4BZ3 A;  4EXY A;  1JJT A;  2FU7 A;  2NXA A;  4XWW A;  5EVD A;  1X8I A;  2FU6 A;  4CHL A;  5LE1 A;  3IEM A;  5AXR A;  2Y8A A;  5A0V A;  2YNU A;  2FHX A;  2OHH A;  5ACX A;  4F6H A;  4ZEJ A;  2FM6 A;  4J5H A;  2BR6 A;  1WRA A;  4TZ9 A;  5ACR A;  5EVK A;  3I11 A;  3ADR A;  5K4M A;  4C09 A;  2GKL A;  3RKK A;  2A7M A;  3KNS A;  2ZO4 A;  5EVB A;  1L9Y A;  2BG8 A;  4GCW A;  3JXP A;  1KO3 A;  3SFP A;  3IOF A;  2BIB A;  3A4Y A;  4HL2 A;  4AWZ A;  4TZF A;  5ACQ A;  4D1T A;  3H3E A;  4UA4 A;  4YSL A;  2QIN A;  4EYB A;  3Q6V A;  3AF6 A;  5EV6 A;  5FQB A;  3PY6 A;  5FQA A;  3ESH A;  2H6A A;  4P62 A;  2P4Z A;  2YNW A;  4AX0 B;  2XR1 A;  2UYX A;  2P97 A;  2DKF A;  4GYU A;  5LLD A;  4C1G A;  3BK1 A;  2BTN A;  3G1P A;  4AD9 A;  3RPC A;  2R2D A;  2QED A;  4NQ6 A;  4LE6 A;  1QH3 A;  1XM8 A;  4UWR B;  1E5D A;  5LMC A;  4C1C A;  4DIK A;  1QH5 A;  2BFZ B;  2Q0I A;  3T3O A;  5B1U A;  1XTO A;  1YCH A;  1DD6 A;  4PVO A;  1VGN A;  4RM5 A;  5LCH A;  2CBN A;  5HH6 A;  3TP9 A;  4TYT A;  3ZWF A;  2WRS A;  5FQC A;  2GFJ A;  4Z60 A;  2YCB A;  4RAW A;  5ACS A;  2P1E A;  2OHI A;  3QH8 A;  3DH8 A;  5ACW A;  5EH9 A;  1WUO A;  4V0H A;  4WD6 A;  2HB9 A;  5ACT A;  1Y44 A;  5ACV A;  3I13 A;  1A7T A;  4NQ2 A;  4Z6X A;  4F6Z A;  3IE1 A;  4ZNB A;  5A87 A;  4GYQ A;  5DPX A;  1JJE A;  5K4K A;  2I7T A;  4J5F A;  2YNT B;  1YCG A;  5EW0 A;  4JO0 A;  3KNR A;  2WHG A;  4D1V A;  2M5D A;  3FCZ A;  1VJN A;  4O98 A;  2WYM C;  2WYL A;  1KR3 A;  2ZWR A;  3SW3 A;  3T3N A;  2I7X A;  4ZO3 A;  4ZO2 A;  4KEQ A;  5ACP A;  2I7V A;  5LCA A;  4RL2 A;  3T9M A;  5AYA A;  2FK6 A;  3SPU A;  2BFZ A;  3AF5 A;  5A0T A;  3MD7 A;  5LM6 A;  4EYL A;  1ZTC A;  2ZZI A;  3IDZ A;  3IOG A;  3ZR9 A;  2Q42 A;  1M2X A;  1BC2 A;  5EWA A;  2BC2 A;  4AWY B;  5KIL A;  3FAI A;  3DHA A;  3X2Y A;  2E7Y A;  5KIK A;  4C1E A;  1SML A;  4HL1 A;  2GCU A;  2AZ4 A;  3AJ3 A;  2BG2 A;  2FU8 A;  1WUP A;  1X8G A;  4UAM A;  3I15 A;  4RL0 A;  1K07 A;  4D02 A;  4Z5Z A;  2VW8 A;  2NYP A;  2GMN A;  4TYF A;  3X2X A;  4C1H A;  2BFL A;  3DHB A;  1WW1 A;  3KL7 A;  3R2U A;  3S0Z A;  3F9O A;  3ZNB A;  2YNT A;  5IQK A;  2QDT A;  4KEP A;  5K0W A;  5HIP A;  4AX1 B;  2NZE A;  2ZNB A;  1BVT A;  3PG4 A;  2BGA A;  2Y8B A;  5AEB A;  4YSB A;  5HH4 A;  3RKJ A;  4EFZ A;  1ZKP A;  4EYF A;  4BP0 A;  5LSC A;  2NZF A;  3VPE A;  2OHJ A;  3BC2 A;  4Z67 A;  4PVT A;  4C1F A;  4Z7R A;  4B87 A;  2QJS A;  1ZNB A;  4FSB A;  3IE0 A; 
#chains in the Genus database with same CATH topology
 3IEL A;  4D1W A;  5EV8 A;  3PY5 A;  4UBQ A;  1VME A;  1BMC A;  3WXC A;  5A23 A;  3I0V A;  2YNV B;  3L6N A;  4H0D A;  2QDS A;  1JT1 A;  4Z5Y A;  4NQ4 A;  2Y87 A;  3SRX A;  5B3R A;  2CG3 A;  4PDX A;  3SBL A;  2DOO A;  1MQO A;  5LS3 A;  4UWP B;  3SD9 A;  3IE2 A;  5AXO A;  2BFK A;  2FHX B;  3DHC A;  2CFU A;  5B15 A;  4RBS A;  1YCF A;  5AHO A;  4EY2 A;  3ZQ4 A;  3X30 A;  4UWS B;  3I14 A;  4XUK A;  4EXS A;  4XWT A;  2Q9U A;  4HKY A;  2CFZ A;  5LCF A;  1HLK A;  4FR7 A;  1A8T A;  5HIS A;  2BG8 B;  4C1D A;  2BG6 A;  2M5C A;  5ACU A;  3IEK A;  5AHR A;  2YZ3 A;  1KO2 A;  4U4L A;  5HIO A;  5A5Z A;  4UWO B;  4YSK A;  4NQ5 A;  5EHT A;  5K4N A;  3X2Z A;  4TZE A;  4D1U A;  5HIQ A;  2BG7 A;  4DIL A;  2BMI A;  1DXK A;  1DDK A;  2AIO A;  2YNV A;  2XF4 A;  2FU9 A;  3P2U A;  1P9E A;  3VQZ A;  4TZB A;  2GFK A;  3BK2 A;  3LVZ A;  4RAM A;  1X8H A;  5HH5 A;  2Q0J A;  4FEK A;  2P18 A;  2WYM A;  3BV6 A;  4BZ3 A;  4EXY A;  1JJT A;  2FU7 A;  2NXA A;  4XWW A;  5EVD A;  5AJL A;  1X8I A;  2FU6 A;  4CHL A;  5LE1 A;  3IEM A;  5AXR A;  2Y8A A;  5A0V A;  2YNU A;  2FHX A;  2OHH A;  5ACX A;  2YHE A;  4F6H A;  4ZEJ A;  2FM6 A;  4J5H A;  2BR6 A;  1WRA A;  4TZ9 A;  5ACR A;  5EVK A;  3I11 A;  3ADR A;  5K4M A;  4C09 A;  2GKL A;  3RKK A;  2A7M A;  3KNS A;  2ZO4 A;  5EVB A;  1L9Y A;  2BG8 A;  4GCW A;  3JXP A;  1KO3 A;  3SFP A;  3IOF A;  2BIB A;  3A4Y A;  4HL2 A;  4AWZ A;  4TZF A;  5ACQ A;  4D1T A;  3H3E A;  4UA4 A;  4YSL A;  2QIN A;  4EYB A;  3Q6V A;  3AF6 A;  5EV6 A;  5FQB A;  3PY6 A;  5FQA A;  3ESH A;  2H6A A;  4P62 A;  2P4Z A;  2YNW A;  4AX0 B;  2XR1 A;  2UYX A;  2P97 A;  2DKF A;  4GYU A;  5LLD A;  4C1G A;  3BK1 A;  2BTN A;  3G1P A;  4AD9 A;  3RPC A;  2R2D A;  2QED A;  4NQ6 A;  4LE6 A;  1QH3 A;  1XM8 A;  4UWR B;  1E5D A;  5LMC A;  4C1C A;  4DIK A;  1QH5 A;  2BFZ B;  2Q0I A;  3T3O A;  5B1U A;  1XTO A;  1YCH A;  1DD6 A;  4PVO A;  1VGN A;  4RM5 A;  5LCH A;  2CBN A;  5HH6 A;  3TP9 A;  4TYT A;  3ZWF A;  2WRS A;  5FQC A;  2GFJ A;  4Z60 A;  2YCB A;  4RAW A;  5ACS A;  2P1E A;  2OHI A;  3QH8 A;  3DH8 A;  5ACW A;  5EH9 A;  1WUO A;  4V0H A;  4WD6 A;  2HB9 A;  5ACT A;  1Y44 A;  5ACV A;  3I13 A;  1A7T A;  4NQ2 A;  4Z6X A;  4F6Z A;  3IE1 A;  4ZNB A;  5A87 A;  4GYQ A;  5DPX A;  4NUR A;  1JJE A;  5K4K A;  2I7T A;  4J5F A;  2YNT B;  1YCG A;  5EW0 A;  4JO0 A;  3KNR A;  2WHG A;  2CG2 A;  4D1V A;  2M5D A;  3FCZ A;  1VJN A;  4O98 A;  2WYM C;  2WYL A;  1KR3 A;  2ZWR A;  3SW3 A;  3T3N A;  2I7X A;  4ZO3 A;  4ZO2 A;  4KEQ A;  5ACP A;  2I7V A;  5LCA A;  4RL2 A;  3T9M A;  5AYA A;  2FK6 A;  4AXH A;  3SPU A;  2BFZ A;  3AF5 A;  5A0T A;  3MD7 A;  5LM6 A;  4EYL A;  1ZTC A;  2ZZI A;  3IDZ A;  3IOG A;  3ZR9 A;  2Q42 A;  1M2X A;  1BC2 A;  5EWA A;  2BC2 A;  4AWY B;  5KIL A;  3FAI A;  3DHA A;  3X2Y A;  2E7Y A;  5KIK A;  4C1E A;  1SML A;  4HL1 A;  2GCU A;  2AZ4 A;  3AJ3 A;  2BG2 A;  2FU8 A;  1WUP A;  1X8G A;  4UAM A;  3I15 A;  4RL0 A;  1K07 A;  4D02 A;  4Z5Z A;  5AIJ A;  2VW8 A;  2NYP A;  2GMN A;  4TYF A;  3X2X A;  4C1H A;  2BFL A;  3DHB A;  1WW1 A;  3KL7 A;  3R2U A;  3S0Z A;  3F9O A;  3ZNB A;  4AV7 A;  2YNT A;  5IQK A;  2QDT A;  4KEP A;  5K0W A;  5HIP A;  4AX1 B;  2NZE A;  2ZNB A;  1BVT A;  3PG4 A;  2BGA A;  2Y8B A;  5AEB A;  4YSB A;  5HH4 A;  3RKJ A;  4EFZ A;  1ZKP A;  4EYF A;  4BP0 A;  5LSC A;  2NZF A;  3VPE A;  2OHJ A;  3BC2 A;  4Z67 A;  4PVT A;  4C1F A;  4Z7R A;  4B87 A;  2QJS A;  1ZNB A;  4FSB A;  3IE0 A; 
#chains in the Genus database with same CATH homology
 3IEL A;  4D1W A;  5EV8 A;  3PY5 A;  4UBQ A;  1VME A;  1BMC A;  3WXC A;  3I0V A;  2YNV B;  3L6N A;  4H0D A;  2QDS A;  1JT1 A;  4Z5Y A;  4NQ4 A;  2Y87 A;  3SRX A;  5B3R A;  3SBL A;  2DOO A;  1MQO A;  5LS3 A;  4UWP B;  3SD9 A;  3IE2 A;  5AXO A;  2BFK A;  2FHX B;  3DHC A;  5B15 A;  4EY2 A;  4RBS A;  1YCF A;  5AHO A;  3ZQ4 A;  3X30 A;  4UWS B;  3I14 A;  4XUK A;  4EXS A;  4XWT A;  2Q9U A;  4HKY A;  5LCF A;  1HLK A;  4FR7 A;  1A8T A;  5HIS A;  2BG8 B;  4C1D A;  2BG6 A;  2M5C A;  5ACU A;  3IEK A;  5AHR A;  2YZ3 A;  1KO2 A;  4U4L A;  5HIO A;  5A5Z A;  4UWO B;  4YSK A;  4NQ5 A;  5EHT A;  5K4N A;  3X2Z A;  4TZE A;  4D1U A;  5HIQ A;  2BG7 A;  4DIL A;  2BMI A;  1DXK A;  1DDK A;  2AIO A;  2YNV A;  2XF4 A;  2FU9 A;  3P2U A;  1P9E A;  3VQZ A;  4TZB A;  2GFK A;  3BK2 A;  3LVZ A;  4RAM A;  1X8H A;  5HH5 A;  2Q0J A;  4FEK A;  2P18 A;  2WYM A;  3BV6 A;  4BZ3 A;  4EXY A;  1JJT A;  2FU7 A;  2NXA A;  4XWW A;  5EVD A;  1X8I A;  2FU6 A;  4CHL A;  5LE1 A;  3IEM A;  5AXR A;  2Y8A A;  5A0V A;  2YNU A;  2FHX A;  2OHH A;  5ACX A;  4F6H A;  4ZEJ A;  2FM6 A;  4J5H A;  2BR6 A;  1WRA A;  4TZ9 A;  5ACR A;  5EVK A;  3I11 A;  3ADR A;  5K4M A;  4C09 A;  2GKL A;  3RKK A;  2A7M A;  3KNS A;  2ZO4 A;  5EVB A;  1L9Y A;  2BG8 A;  4GCW A;  3JXP A;  1KO3 A;  3SFP A;  3IOF A;  2BIB A;  3A4Y A;  4HL2 A;  4AWZ A;  4TZF A;  5ACQ A;  4D1T A;  3H3E A;  4UA4 A;  4YSL A;  2QIN A;  4EYB A;  3Q6V A;  3AF6 A;  5EV6 A;  5FQB A;  3PY6 A;  5FQA A;  3ESH A;  2H6A A;  4P62 A;  2P4Z A;  2YNW A;  4AX0 B;  2XR1 A;  2UYX A;  2P97 A;  2DKF A;  4GYU A;  5LLD A;  4C1G A;  3BK1 A;  2BTN A;  3G1P A;  4AD9 A;  3RPC A;  2R2D A;  2QED A;  4NQ6 A;  4LE6 A;  1QH3 A;  1XM8 A;  4UWR B;  1E5D A;  5LMC A;  4C1C A;  4DIK A;  1QH5 A;  2BFZ B;  2Q0I A;  3T3O A;  5B1U A;  1XTO A;  1YCH A;  1DD6 A;  4PVO A;  1VGN A;  4RM5 A;  5LCH A;  2CBN A;  5HH6 A;  3TP9 A;  4TYT A;  3ZWF A;  2WRS A;  5FQC A;  2GFJ A;  4Z60 A;  2YCB A;  4RAW A;  5ACS A;  2P1E A;  2OHI A;  3QH8 A;  3DH8 A;  5ACW A;  5EH9 A;  1WUO A;  4V0H A;  4WD6 A;  2HB9 A;  5ACT A;  1Y44 A;  5ACV A;  3I13 A;  1A7T A;  4NQ2 A;  4Z6X A;  4F6Z A;  3IE1 A;  4ZNB A;  5A87 A;  4GYQ A;  5DPX A;  1JJE A;  5K4K A;  2I7T A;  4J5F A;  2YNT B;  1YCG A;  5EW0 A;  4JO0 A;  3KNR A;  2WHG A;  4D1V A;  2M5D A;  3FCZ A;  1VJN A;  4O98 A;  2WYM C;  2WYL A;  1KR3 A;  2ZWR A;  3SW3 A;  3T3N A;  2I7X A;  4ZO3 A;  4ZO2 A;  4KEQ A;  5ACP A;  2I7V A;  5LCA A;  4RL2 A;  3T9M A;  5AYA A;  2FK6 A;  3SPU A;  2BFZ A;  3AF5 A;  5A0T A;  3MD7 A;  5LM6 A;  4EYL A;  1ZTC A;  2ZZI A;  3IDZ A;  3IOG A;  3ZR9 A;  2Q42 A;  1M2X A;  1BC2 A;  5EWA A;  2BC2 A;  4AWY B;  5KIL A;  3FAI A;  3DHA A;  3X2Y A;  2E7Y A;  5KIK A;  4C1E A;  1SML A;  4HL1 A;  2GCU A;  2AZ4 A;  3AJ3 A;  2BG2 A;  2FU8 A;  1WUP A;  1X8G A;  4UAM A;  3I15 A;  4RL0 A;  1K07 A;  4D02 A;  4Z5Z A;  2VW8 A;  2NYP A;  2GMN A;  4TYF A;  3X2X A;  4C1H A;  2BFL A;  3DHB A;  1WW1 A;  3KL7 A;  3R2U A;  3S0Z A;  3F9O A;  3ZNB A;  2YNT A;  5IQK A;  2QDT A;  4KEP A;  5K0W A;  5HIP A;  4AX1 B;  2NZE A;  2ZNB A;  1BVT A;  3PG4 A;  2BGA A;  2Y8B A;  5AEB A;  4YSB A;  5HH4 A;  3RKJ A;  4EFZ A;  1ZKP A;  4EYF A;  4BP0 A;  5LSC A;  2NZF A;  3VPE A;  2OHJ A;  3BC2 A;  4Z67 A;  4PVT A;  4C1F A;  4Z7R A;  4B87 A;  2QJS A;  1ZNB A;  4FSB A;  3IE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...