1JJTA

Imp-1 metallo beta-lactamase from pseudomonas aeruginosa in complex with a biaryl succinic acid inhibitor (1)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
220
structure length
220
Chain Sequence
SLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords IMP-1 METALLO BETA-LACTAMASE
publication title Succinic acids as potent inhibitors of plasmid-borne IMP-1 metallo-beta-lactamase.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 67
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1jjtA00
3SBLA 1DDKA 2E7YA 5ACQA 1JT1A 2YNVB 5AHRA 2Y8AA 5A87A 3ZQ4A 3I14A 5A0TA 2NZFA 4AX1B 2FHXB 3IOGA 3PY6A 2YNTA 3Q6VA 1JJTA 2Q0JA 3BK1A 4UWPB 5EH9A 1KO3A 4GYQA 4Z7RA 3IEKA 3SFPA 1Y44A 4AWZA 5EW0A 2BG8A 4TZFA 2XF4A 2BFZB 4TZ9A 4EYLA 5HISA 3AJ3A 3TP9A 1XTOA 4AWYB 3T9MA 4JO0A 5ACXA 1DXKA 4HL2A 4DILA 2BG7A 5LCFA 4EXSA 5LS3A 3A4YA 4F6HA 5FQBA 4PVTA 4D1UA 2WHGA 4NQ4A 4D1TA 2BMIA 5AXRA 3BC2A 4LE6A 2Q0IA 4BZ3A 3L6NA 5LM6A 2BTNA 4HL1A 1MQOA 1L9YA 5FQCA 4D1VA 3IDZA 4EXYA 4AX0B 5EHTA 5LE1A 4KEQA 4F6ZA 5AXOA 4WD6A 4Z67A 4C1EA 2P1EA 2P97A 2CBNA 4C1FA 5ACTA 5KILA 4NQ6A 3VQZA 4EYFA 2WYLA 2BGAA 3FCZA 3X2ZA 2BG2A 1WUOA 2P18A 2YNVA 3IEMA 2H6AA 3QH8A 3I13A 2YNUA 2FHXA 3VPEA 5LLDA 3DHAA 1ZNBA 3DH8A 3RPCA 4Z5ZA 3ADRA 2M5CA 4UAMA 2BR6A 5K0WA 4RL2A 2BIBA 4YSBA 2BFZA 4B87A 5EV8A 4PVOA 2BFKA 5IQKA 2R2DA 1ZTCA 2I7XA 4YSLA 4H0DA 4Z60A 4UWOB 5B15A 3KNRA 2BFLA 5K4NA 4YSKA 4UWSB 2XR1A 4O98A 2HB9A 3JXPA 1ZKPA 2OHJA 1SMLA 3S0ZA 2GCUA 1A7TA 2ZWRA 4C1DA 4TZEA 2BG6A 3X2YA 5EV6A 3AF6A 2DKFA 1QH5A 1P9EA 4C1GA 3H3EA 5EVBA 3LVZA 1X8HA 4RL0A 3F9OA 1M2XA 4EY2A 1K07A 5ACRA 3T3OA 4GYUA 1KR3A 2OHHA 2FM6A 1QH3A 2GFKA 3IE0A 5HH6A 3RKJA 1WUPA 4XWTA 4RBSA 5EWAA 1BC2A 2VW8A 2FU8A 4DIKA 3BV6A 4UA4A 3P2UA 5LMCA 4HKYA 1BVTA 3WXCA 2ZNBA 2M5DA 2GMNA 2FU9A 4ZNBA 4V0HA 4XWWA 1XM8A 3X2XA 4UBQA 5ACSA 2YZ3A 4KEPA 3IE1A 3I15A 1KO2A 4D02A 5K4KA 4D1WA 5HIPA 4TYTA 5HIQA 2OHIA 4NQ5A 3BK2A 2QEDA 3SD9A 2FU6A 5AHOA 2DOOA 5ACVA 4Z5YA 3RKKA 3SPUA 2Q42A 4XUKA 2I7TA 5A0VA 3KNSA 2GKLA 4J5FA 4RAWA 3ZWFA 4NQ2A 2WRSA 2FK6A 3G1PA 3ZR9A 3ZNBA 2Y8BA 4ZO2A 1HLKA 4C09A 1VJNA 1JJEA 4C1HA 3KL7A 3IOFA 2NZEA 2A7MA 4BP0A 5HH4A 2NXAA 3I11A 2YCBA 1WW1A 3IE2A 2UYXA 5AYAA 4P62A 2QJSA 2Y87A 2YNWA 5B1UA 1X8GA 4EYBA 3DHBA 4ZEJA 2ZZIA 3R2UA 3PY5A 3SW3A 5A5ZA 2QDTA 1YCHA 4CHLA 2AZ4A 3FAIA 3I0VA 5EVKA 5AEBA 4RAMA 3PG4A 5HH5A 1BMCA 2Q9UA 2YNTB 4FR7A 5LCAA 2NYPA 4U4LA 4EFZA 5KIKA 4FSBA 1E5DA 2BG8B 5HIOA 4TZBA 2WYMC 4ZO3A 2GFJA 2AIOA 1WRAA 5LSCA 2QDSA 2WYMA 2ZO4A 5DPXA 2FU7A 5ACUA 4RM5A 5FQAA 4GCWA 2P4ZA 3X30A 2I7VA 4J5HA 4FEKA 3SRXA 1A8TA 4Z6XA 3ESHA 4TYFA 5B3RA 2QINA 5LCHA 1YCFA 3MD7A 1X8IA 5EVDA 4AD9A 3DHCA 1DD6A 5ACPA 2BC2A 5K4MA 4UWRB 4C1CA 5ACWA 1VMEA 1VGNA 3AF5A 1YCGA 3T3NA 3IELA
chains in the Genus database with same CATH superfamily
3SBLA 1DDKA 2E7YA 5ACQA 1JT1A 2YNVB 5AHRA 2Y8AA 5A87A 3ZQ4A 3I14A 5A0TA 2NZFA 4AX1B 2FHXB 3IOGA 3PY6A 2YNTA 3Q6VA 1JJTA 2Q0JA 3BK1A 4UWPB 5EH9A 1KO3A 4GYQA 4Z7RA 3IEKA 3SFPA 1Y44A 4AWZA 5EW0A 2BG8A 4TZFA 2XF4A 2BFZB 4TZ9A 4EYLA 5HISA 3AJ3A 3TP9A 2CG3A 1XTOA 4AWYB 3T9MA 4JO0A 5ACXA 1DXKA 4HL2A 4DILA 2BG7A 5LCFA 4EXSA 5LS3A 3A4YA 4F6HA 5FQBA 4PVTA 4D1UA 2WHGA 4NQ4A 4D1TA 2BMIA 5AXRA 3BC2A 4LE6A 2Q0IA 4BZ3A 3L6NA 5LM6A 2BTNA 2CFUA 4HL1A 1MQOA 1L9YA 5FQCA 4D1VA 3IDZA 4EXYA 4AX0B 5EHTA 5LE1A 4KEQA 4F6ZA 5AXOA 4WD6A 4Z67A 4C1EA 2P1EA 2P97A 2CBNA 4C1FA 5ACTA 5KILA 4NQ6A 3VQZA 4EYFA 2WYLA 2BGAA 3FCZA 3X2ZA 2BG2A 1WUOA 2P18A 2YNVA 3IEMA 2H6AA 3QH8A 3I13A 5AIJA 2YNUA 2FHXA 3VPEA 5LLDA 3DHAA 1ZNBA 3DH8A 3RPCA 4Z5ZA 3ADRA 2M5CA 4UAMA 2BR6A 5K0WA 4RL2A 2BIBA 4YSBA 2BFZA 4B87A 5EV8A 4PVOA 2BFKA 5IQKA 2R2DA 1ZTCA 2I7XA 4YSLA 4H0DA 4Z60A 4UWOB 5B15A 5AJLA 3KNRA 2BFLA 5K4NA 4YSKA 4UWSB 2XR1A 4O98A 2HB9A 3JXPA 1ZKPA 2OHJA 1SMLA 3S0ZA 2GCUA 1A7TA 2ZWRA 4C1DA 4TZEA 2BG6A 3X2YA 5EV6A 3AF6A 2DKFA 1QH5A 1P9EA 4C1GA 3H3EA 5EVBA 3LVZA 1X8HA 4RL0A 3F9OA 1M2XA 4EY2A 1K07A 5ACRA 3T3OA 4GYUA 1KR3A 2OHHA 2FM6A 1QH3A 2GFKA 3IE0A 5HH6A 3RKJA 1WUPA 4XWTA 4RBSA 5EWAA 1BC2A 2VW8A 2FU8A 4DIKA 3BV6A 4UA4A 3P2UA 5LMCA 4HKYA 1BVTA 3WXCA 2ZNBA 2M5DA 2GMNA 2YHEA 2FU9A 4ZNBA 4V0HA 4XWWA 1XM8A 3X2XA 4UBQA 5ACSA 2YZ3A 4KEPA 3IE1A 3I15A 1KO2A 5A23A 4D02A 5K4KA 4D1WA 5HIPA 4TYTA 5HIQA 2OHIA 4NQ5A 3BK2A 2QEDA 3SD9A 2FU6A 5AHOA 2DOOA 5ACVA 4Z5YA 3RKKA 3SPUA 2Q42A 4XUKA 2I7TA 5A0VA 3KNSA 2GKLA 4J5FA 4RAWA 3ZWFA 4NQ2A 2WRSA 2FK6A 3G1PA 3ZR9A 3ZNBA 2Y8BA 4ZO2A 1HLKA 4C09A 1VJNA 4AV7A 1JJEA 4C1HA 3KL7A 3IOFA 2NZEA 2A7MA 4BP0A 5HH4A 2NXAA 3I11A 2YCBA 1WW1A 3IE2A 4PDXA 2UYXA 2CG2A 5AYAA 4P62A 2QJSA 2Y87A 2YNWA 5B1UA 1X8GA 4EYBA 3DHBA 4ZEJA 2ZZIA 3R2UA 3PY5A 3SW3A 5A5ZA 2QDTA 1YCHA 4CHLA 2AZ4A 3FAIA 3I0VA 5EVKA 5AEBA 4RAMA 3PG4A 5HH5A 1BMCA 2Q9UA 2YNTB 4FR7A 5LCAA 4AXHA 2NYPA 4U4LA 4EFZA 5KIKA 4FSBA 1E5DA 2BG8B 5HIOA 4TZBA 2WYMC 4ZO3A 2GFJA 2AIOA 1WRAA 5LSCA 2CFZA 2QDSA 2WYMA 2ZO4A 5DPXA 2FU7A 5ACUA 4RM5A 5FQAA 4GCWA 2P4ZA 3X30A 2I7VA 4J5HA 4FEKA 3SRXA 1A8TA 4Z6XA 3ESHA 4TYFA 5B3RA 2QINA 5LCHA 1YCFA 3MD7A 1X8IA 5EVDA 4AD9A 3DHCA 1DD6A 5ACPA 2BC2A 5K4MA 4UWRB 4C1CA 4NURA 5ACWA 1VMEA 1VGNA 3AF5A 1YCGA 3T3NA 3IELA
chains in the Genus database with same CATH topology
3SBLA 1DDKA 2E7YA 5ACQA 1JT1A 2YNVB 5AHRA 2Y8AA 5A87A 3ZQ4A 3I14A 5A0TA 2NZFA 4AX1B 2FHXB 3IOGA 3PY6A 2YNTA 3Q6VA 1JJTA 2Q0JA 3BK1A 4UWPB 5EH9A 1KO3A 4GYQA 4Z7RA 3IEKA 3SFPA 1Y44A 4AWZA 5EW0A 2BG8A 4TZFA 2XF4A 2BFZB 4TZ9A 4EYLA 5HISA 3AJ3A 3TP9A 1XTOA 4AWYB 3T9MA 4JO0A 5ACXA 1DXKA 4HL2A 4DILA 2BG7A 5LCFA 4EXSA 5LS3A 3A4YA 4F6HA 5FQBA 4PVTA 4D1UA 2WHGA 4NQ4A 4D1TA 2BMIA 5AXRA 3BC2A 4LE6A 2Q0IA 4BZ3A 3L6NA 5LM6A 2BTNA 4HL1A 1MQOA 1L9YA 5FQCA 4D1VA 3IDZA 4EXYA 4AX0B 5EHTA 5LE1A 4KEQA 4F6ZA 5AXOA 4WD6A 4Z67A 4C1EA 2P1EA 2P97A 2CBNA 4C1FA 5ACTA 5KILA 4NQ6A 3VQZA 4EYFA 2WYLA 2BGAA 3FCZA 3X2ZA 2BG2A 1WUOA 2P18A 2YNVA 3IEMA 2H6AA 3QH8A 3I13A 2YNUA 2FHXA 3VPEA 5LLDA 3DHAA 1ZNBA 3DH8A 3RPCA 4Z5ZA 3ADRA 2M5CA 4UAMA 2BR6A 5K0WA 4RL2A 2BIBA 4YSBA 2BFZA 4B87A 5EV8A 4PVOA 2BFKA 5IQKA 2R2DA 1ZTCA 2I7XA 4YSLA 4H0DA 4Z60A 4UWOB 5B15A 3KNRA 2BFLA 5K4NA 4YSKA 4UWSB 2XR1A 4O98A 2HB9A 3JXPA 1ZKPA 2OHJA 1SMLA 3S0ZA 2GCUA 1A7TA 2ZWRA 4C1DA 4TZEA 2BG6A 3X2YA 5EV6A 3AF6A 2DKFA 1QH5A 1P9EA 4C1GA 3H3EA 5EVBA 3LVZA 1X8HA 4RL0A 3F9OA 1M2XA 4EY2A 1K07A 5ACRA 3T3OA 4GYUA 1KR3A 2OHHA 2FM6A 1QH3A 2GFKA 3IE0A 5HH6A 3RKJA 1WUPA 4XWTA 4RBSA 5EWAA 1BC2A 2VW8A 2FU8A 4DIKA 3BV6A 4UA4A 3P2UA 5LMCA 4HKYA 1BVTA 3WXCA 2ZNBA 2M5DA 2GMNA 2FU9A 4ZNBA 4V0HA 4XWWA 1XM8A 3X2XA 4UBQA 5ACSA 2YZ3A 4KEPA 3IE1A 3I15A 1KO2A 4D02A 5K4KA 4D1WA 5HIPA 4TYTA 5HIQA 2OHIA 4NQ5A 3BK2A 2QEDA 3SD9A 2FU6A 5AHOA 2DOOA 5ACVA 4Z5YA 3RKKA 3SPUA 2Q42A 4XUKA 2I7TA 5A0VA 3KNSA 2GKLA 4J5FA 4RAWA 3ZWFA 4NQ2A 2WRSA 2FK6A 3G1PA 3ZR9A 3ZNBA 2Y8BA 4ZO2A 1HLKA 4C09A 1VJNA 1JJEA 4C1HA 3KL7A 3IOFA 2NZEA 2A7MA 4BP0A 5HH4A 2NXAA 3I11A 2YCBA 1WW1A 3IE2A 2UYXA 5AYAA 4P62A 2QJSA 2Y87A 2YNWA 5B1UA 1X8GA 4EYBA 3DHBA 4ZEJA 2ZZIA 3R2UA 3PY5A 3SW3A 5A5ZA 2QDTA 1YCHA 4CHLA 2AZ4A 3FAIA 3I0VA 5EVKA 5AEBA 4RAMA 3PG4A 5HH5A 1BMCA 2Q9UA 2YNTB 4FR7A 5LCAA 2NYPA 4U4LA 4EFZA 5KIKA 4FSBA 1E5DA 2BG8B 5HIOA 4TZBA 2WYMC 4ZO3A 2GFJA 2AIOA 1WRAA 5LSCA 2QDSA 2WYMA 2ZO4A 5DPXA 2FU7A 5ACUA 4RM5A 5FQAA 4GCWA 2P4ZA 3X30A 2I7VA 4J5HA 4FEKA 3SRXA 1A8TA 4Z6XA 3ESHA 4TYFA 5B3RA 2QINA 5LCHA 1YCFA 3MD7A 1X8IA 5EVDA 4AD9A 3DHCA 1DD6A 5ACPA 2BC2A 5K4MA 4UWRB 4C1CA 5ACWA 1VMEA 1VGNA 3AF5A 1YCGA 3T3NA 3IELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SBL A;  1DDK A;  2E7Y A;  5ACQ A;  1JT1 A;  2YNV B;  5AHR A;  2Y8A A;  5A87 A;  3ZQ4 A;  3I14 A;  5A0T A;  2NZF A;  4AX1 B;  2FHX B;  3IOG A;  3PY6 A;  2YNT A;  3Q6V A;  1JJT A;  2Q0J A;  3BK1 A;  4UWP B;  5EH9 A;  1KO3 A;  4GYQ A;  4Z7R A;  3IEK A;  3SFP A;  1Y44 A;  4AWZ A;  5EW0 A;  2BG8 A;  4TZF A;  2XF4 A;  2BFZ B;  4TZ9 A;  4EYL A;  5HIS A;  3AJ3 A;  3TP9 A;  1XTO A;  4AWY B;  3T9M A;  4JO0 A;  5ACX A;  1DXK A;  4HL2 A;  4DIL A;  2BG7 A;  5LCF A;  4EXS A;  5LS3 A;  3A4Y A;  4F6H A;  5FQB A;  4PVT A;  4D1U A;  2WHG A;  4NQ4 A;  4D1T A;  2BMI A;  5AXR A;  3BC2 A;  4LE6 A;  2Q0I A;  4BZ3 A;  3L6N A;  5LM6 A;  2BTN A;  4HL1 A;  1MQO A;  1L9Y A;  5FQC A;  4D1V A;  3IDZ A;  4EXY A;  4AX0 B;  5EHT A;  5LE1 A;  4KEQ A;  4F6Z A;  5AXO A;  4WD6 A;  4Z67 A;  4C1E A;  2P1E A;  2P97 A;  2CBN A;  4C1F A;  5ACT A;  5KIL A;  4NQ6 A;  3VQZ A;  4EYF A;  2WYL A;  2BGA A;  3FCZ A;  3X2Z A;  2BG2 A;  1WUO A;  2P18 A;  2YNV A;  3IEM A;  2H6A A;  3QH8 A;  3I13 A;  2YNU A;  2FHX A;  3VPE A;  5LLD A;  3DHA A;  1ZNB A;  3DH8 A;  3RPC A;  4Z5Z A;  3ADR A;  2M5C A;  4UAM A;  2BR6 A;  5K0W A;  4RL2 A;  2BIB A;  4YSB A;  2BFZ A;  4B87 A;  5EV8 A;  4PVO A;  2BFK A;  5IQK A;  2R2D A;  1ZTC A;  2I7X A;  4YSL A;  4H0D A;  4Z60 A;  4UWO B;  5B15 A;  3KNR A;  2BFL A;  5K4N A;  4YSK A;  4UWS B;  2XR1 A;  4O98 A;  2HB9 A;  3JXP A;  1ZKP A;  2OHJ A;  1SML A;  3S0Z A;  2GCU A;  1A7T A;  2ZWR A;  4C1D A;  4TZE A;  2BG6 A;  3X2Y A;  5EV6 A;  3AF6 A;  2DKF A;  1QH5 A;  1P9E A;  4C1G A;  3H3E A;  5EVB A;  3LVZ A;  1X8H A;  4RL0 A;  3F9O A;  1M2X A;  4EY2 A;  1K07 A;  5ACR A;  3T3O A;  4GYU A;  1KR3 A;  2OHH A;  2FM6 A;  1QH3 A;  2GFK A;  3IE0 A;  5HH6 A;  3RKJ A;  1WUP A;  4XWT A;  4RBS A;  5EWA A;  1BC2 A;  2VW8 A;  2FU8 A;  4DIK A;  3BV6 A;  4UA4 A;  3P2U A;  5LMC A;  4HKY A;  1BVT A;  3WXC A;  2ZNB A;  2M5D A;  2GMN A;  2FU9 A;  4ZNB A;  4V0H A;  4XWW A;  1XM8 A;  3X2X A;  4UBQ A;  5ACS A;  2YZ3 A;  4KEP A;  3IE1 A;  3I15 A;  1KO2 A;  4D02 A;  5K4K A;  4D1W A;  5HIP A;  4TYT A;  5HIQ A;  2OHI A;  4NQ5 A;  3BK2 A;  2QED A;  3SD9 A;  2FU6 A;  5AHO A;  2DOO A;  5ACV A;  4Z5Y A;  3RKK A;  3SPU A;  2Q42 A;  4XUK A;  2I7T A;  5A0V A;  3KNS A;  2GKL A;  4J5F A;  4RAW A;  3ZWF A;  4NQ2 A;  2WRS A;  2FK6 A;  3G1P A;  3ZR9 A;  3ZNB A;  2Y8B A;  4ZO2 A;  1HLK A;  4C09 A;  1VJN A;  1JJE A;  4C1H A;  3KL7 A;  3IOF A;  2NZE A;  2A7M A;  4BP0 A;  5HH4 A;  2NXA A;  3I11 A;  2YCB A;  1WW1 A;  3IE2 A;  2UYX A;  5AYA A;  4P62 A;  2QJS A;  2Y87 A;  2YNW A;  5B1U A;  1X8G A;  4EYB A;  3DHB A;  4ZEJ A;  2ZZI A;  3R2U A;  3PY5 A;  3SW3 A;  5A5Z A;  2QDT A;  1YCH A;  4CHL A;  2AZ4 A;  3FAI A;  3I0V A;  5EVK A;  5AEB A;  4RAM A;  3PG4 A;  5HH5 A;  1BMC A;  2Q9U A;  2YNT B;  4FR7 A;  5LCA A;  2NYP A;  4U4L A;  4EFZ A;  5KIK A;  4FSB A;  1E5D A;  2BG8 B;  5HIO A;  4TZB A;  2WYM C;  4ZO3 A;  2GFJ A;  2AIO A;  1WRA A;  5LSC A;  2QDS A;  2WYM A;  2ZO4 A;  5DPX A;  2FU7 A;  5ACU A;  4RM5 A;  5FQA A;  4GCW A;  2P4Z A;  3X30 A;  2I7V A;  4J5H A;  4FEK A;  3SRX A;  1A8T A;  4Z6X A;  3ESH A;  4TYF A;  5B3R A;  2QIN A;  5LCH A;  1YCF A;  3MD7 A;  1X8I A;  5EVD A;  4AD9 A;  3DHC A;  1DD6 A;  5ACP A;  2BC2 A;  5K4M A;  4UWR B;  4C1C A;  5ACW A;  1VME A;  1VGN A;  3AF5 A;  1YCG A;  3T3N A;  3IEL A; 
#chains in the Genus database with same CATH topology
 3SBL A;  1DDK A;  2E7Y A;  5ACQ A;  1JT1 A;  2YNV B;  5AHR A;  2Y8A A;  5A87 A;  3ZQ4 A;  3I14 A;  5A0T A;  2NZF A;  4AX1 B;  2FHX B;  3IOG A;  3PY6 A;  2YNT A;  3Q6V A;  1JJT A;  2Q0J A;  3BK1 A;  4UWP B;  5EH9 A;  1KO3 A;  4GYQ A;  4Z7R A;  3IEK A;  3SFP A;  1Y44 A;  4AWZ A;  5EW0 A;  2BG8 A;  4TZF A;  2XF4 A;  2BFZ B;  4TZ9 A;  4EYL A;  5HIS A;  3AJ3 A;  3TP9 A;  2CG3 A;  1XTO A;  4AWY B;  3T9M A;  4JO0 A;  5ACX A;  1DXK A;  4HL2 A;  4DIL A;  2BG7 A;  5LCF A;  4EXS A;  5LS3 A;  3A4Y A;  4F6H A;  5FQB A;  4PVT A;  4D1U A;  2WHG A;  4NQ4 A;  4D1T A;  2BMI A;  5AXR A;  3BC2 A;  4LE6 A;  2Q0I A;  4BZ3 A;  3L6N A;  5LM6 A;  2BTN A;  2CFU A;  4HL1 A;  1MQO A;  1L9Y A;  5FQC A;  4D1V A;  3IDZ A;  4EXY A;  4AX0 B;  5EHT A;  5LE1 A;  4KEQ A;  4F6Z A;  5AXO A;  4WD6 A;  4Z67 A;  4C1E A;  2P1E A;  2P97 A;  2CBN A;  4C1F A;  5ACT A;  5KIL A;  4NQ6 A;  3VQZ A;  4EYF A;  2WYL A;  2BGA A;  3FCZ A;  3X2Z A;  2BG2 A;  1WUO A;  2P18 A;  2YNV A;  3IEM A;  2H6A A;  3QH8 A;  3I13 A;  5AIJ A;  2YNU A;  2FHX A;  3VPE A;  5LLD A;  3DHA A;  1ZNB A;  3DH8 A;  3RPC A;  4Z5Z A;  3ADR A;  2M5C A;  4UAM A;  2BR6 A;  5K0W A;  4RL2 A;  2BIB A;  4YSB A;  2BFZ A;  4B87 A;  5EV8 A;  4PVO A;  2BFK A;  5IQK A;  2R2D A;  1ZTC A;  2I7X A;  4YSL A;  4H0D A;  4Z60 A;  4UWO B;  5B15 A;  5AJL A;  3KNR A;  2BFL A;  5K4N A;  4YSK A;  4UWS B;  2XR1 A;  4O98 A;  2HB9 A;  3JXP A;  1ZKP A;  2OHJ A;  1SML A;  3S0Z A;  2GCU A;  1A7T A;  2ZWR A;  4C1D A;  4TZE A;  2BG6 A;  3X2Y A;  5EV6 A;  3AF6 A;  2DKF A;  1QH5 A;  1P9E A;  4C1G A;  3H3E A;  5EVB A;  3LVZ A;  1X8H A;  4RL0 A;  3F9O A;  1M2X A;  4EY2 A;  1K07 A;  5ACR A;  3T3O A;  4GYU A;  1KR3 A;  2OHH A;  2FM6 A;  1QH3 A;  2GFK A;  3IE0 A;  5HH6 A;  3RKJ A;  1WUP A;  4XWT A;  4RBS A;  5EWA A;  1BC2 A;  2VW8 A;  2FU8 A;  4DIK A;  3BV6 A;  4UA4 A;  3P2U A;  5LMC A;  4HKY A;  1BVT A;  3WXC A;  2ZNB A;  2M5D A;  2GMN A;  2YHE A;  2FU9 A;  4ZNB A;  4V0H A;  4XWW A;  1XM8 A;  3X2X A;  4UBQ A;  5ACS A;  2YZ3 A;  4KEP A;  3IE1 A;  3I15 A;  1KO2 A;  5A23 A;  4D02 A;  5K4K A;  4D1W A;  5HIP A;  4TYT A;  5HIQ A;  2OHI A;  4NQ5 A;  3BK2 A;  2QED A;  3SD9 A;  2FU6 A;  5AHO A;  2DOO A;  5ACV A;  4Z5Y A;  3RKK A;  3SPU A;  2Q42 A;  4XUK A;  2I7T A;  5A0V A;  3KNS A;  2GKL A;  4J5F A;  4RAW A;  3ZWF A;  4NQ2 A;  2WRS A;  2FK6 A;  3G1P A;  3ZR9 A;  3ZNB A;  2Y8B A;  4ZO2 A;  1HLK A;  4C09 A;  1VJN A;  4AV7 A;  1JJE A;  4C1H A;  3KL7 A;  3IOF A;  2NZE A;  2A7M A;  4BP0 A;  5HH4 A;  2NXA A;  3I11 A;  2YCB A;  1WW1 A;  3IE2 A;  4PDX A;  2UYX A;  2CG2 A;  5AYA A;  4P62 A;  2QJS A;  2Y87 A;  2YNW A;  5B1U A;  1X8G A;  4EYB A;  3DHB A;  4ZEJ A;  2ZZI A;  3R2U A;  3PY5 A;  3SW3 A;  5A5Z A;  2QDT A;  1YCH A;  4CHL A;  2AZ4 A;  3FAI A;  3I0V A;  5EVK A;  5AEB A;  4RAM A;  3PG4 A;  5HH5 A;  1BMC A;  2Q9U A;  2YNT B;  4FR7 A;  5LCA A;  4AXH A;  2NYP A;  4U4L A;  4EFZ A;  5KIK A;  4FSB A;  1E5D A;  2BG8 B;  5HIO A;  4TZB A;  2WYM C;  4ZO3 A;  2GFJ A;  2AIO A;  1WRA A;  5LSC A;  2CFZ A;  2QDS A;  2WYM A;  2ZO4 A;  5DPX A;  2FU7 A;  5ACU A;  4RM5 A;  5FQA A;  4GCW A;  2P4Z A;  3X30 A;  2I7V A;  4J5H A;  4FEK A;  3SRX A;  1A8T A;  4Z6X A;  3ESH A;  4TYF A;  5B3R A;  2QIN A;  5LCH A;  1YCF A;  3MD7 A;  1X8I A;  5EVD A;  4AD9 A;  3DHC A;  1DD6 A;  5ACP A;  2BC2 A;  5K4M A;  4UWR B;  4C1C A;  4NUR A;  5ACW A;  1VME A;  1VGN A;  3AF5 A;  1YCG A;  3T3N A;  3IEL A; 
#chains in the Genus database with same CATH homology
 3SBL A;  1DDK A;  2E7Y A;  5ACQ A;  1JT1 A;  2YNV B;  5AHR A;  2Y8A A;  5A87 A;  3ZQ4 A;  3I14 A;  5A0T A;  2NZF A;  4AX1 B;  2FHX B;  3IOG A;  3PY6 A;  2YNT A;  3Q6V A;  1JJT A;  2Q0J A;  3BK1 A;  4UWP B;  5EH9 A;  1KO3 A;  4GYQ A;  4Z7R A;  3IEK A;  3SFP A;  1Y44 A;  4AWZ A;  5EW0 A;  2BG8 A;  4TZF A;  2XF4 A;  2BFZ B;  4TZ9 A;  4EYL A;  5HIS A;  3AJ3 A;  3TP9 A;  1XTO A;  4AWY B;  3T9M A;  4JO0 A;  5ACX A;  1DXK A;  4HL2 A;  4DIL A;  2BG7 A;  5LCF A;  4EXS A;  5LS3 A;  3A4Y A;  4F6H A;  5FQB A;  4PVT A;  4D1U A;  2WHG A;  4NQ4 A;  4D1T A;  2BMI A;  5AXR A;  3BC2 A;  4LE6 A;  2Q0I A;  4BZ3 A;  3L6N A;  5LM6 A;  2BTN A;  4HL1 A;  1MQO A;  1L9Y A;  5FQC A;  4D1V A;  3IDZ A;  4EXY A;  4AX0 B;  5EHT A;  5LE1 A;  4KEQ A;  4F6Z A;  5AXO A;  4WD6 A;  4Z67 A;  4C1E A;  2P1E A;  2P97 A;  2CBN A;  4C1F A;  5ACT A;  5KIL A;  4NQ6 A;  3VQZ A;  4EYF A;  2WYL A;  2BGA A;  3FCZ A;  3X2Z A;  2BG2 A;  1WUO A;  2P18 A;  2YNV A;  3IEM A;  2H6A A;  3QH8 A;  3I13 A;  2YNU A;  2FHX A;  3VPE A;  5LLD A;  3DHA A;  1ZNB A;  3DH8 A;  3RPC A;  4Z5Z A;  3ADR A;  2M5C A;  4UAM A;  2BR6 A;  5K0W A;  4RL2 A;  2BIB A;  4YSB A;  2BFZ A;  4B87 A;  5EV8 A;  4PVO A;  2BFK A;  5IQK A;  2R2D A;  1ZTC A;  2I7X A;  4YSL A;  4H0D A;  4Z60 A;  4UWO B;  5B15 A;  3KNR A;  2BFL A;  5K4N A;  4YSK A;  4UWS B;  2XR1 A;  4O98 A;  2HB9 A;  3JXP A;  1ZKP A;  2OHJ A;  1SML A;  3S0Z A;  2GCU A;  1A7T A;  2ZWR A;  4C1D A;  4TZE A;  2BG6 A;  3X2Y A;  5EV6 A;  3AF6 A;  2DKF A;  1QH5 A;  1P9E A;  4C1G A;  3H3E A;  5EVB A;  3LVZ A;  1X8H A;  4RL0 A;  3F9O A;  1M2X A;  4EY2 A;  1K07 A;  5ACR A;  3T3O A;  4GYU A;  1KR3 A;  2OHH A;  2FM6 A;  1QH3 A;  2GFK A;  3IE0 A;  5HH6 A;  3RKJ A;  1WUP A;  4XWT A;  4RBS A;  5EWA A;  1BC2 A;  2VW8 A;  2FU8 A;  4DIK A;  3BV6 A;  4UA4 A;  3P2U A;  5LMC A;  4HKY A;  1BVT A;  3WXC A;  2ZNB A;  2M5D A;  2GMN A;  2FU9 A;  4ZNB A;  4V0H A;  4XWW A;  1XM8 A;  3X2X A;  4UBQ A;  5ACS A;  2YZ3 A;  4KEP A;  3IE1 A;  3I15 A;  1KO2 A;  4D02 A;  5K4K A;  4D1W A;  5HIP A;  4TYT A;  5HIQ A;  2OHI A;  4NQ5 A;  3BK2 A;  2QED A;  3SD9 A;  2FU6 A;  5AHO A;  2DOO A;  5ACV A;  4Z5Y A;  3RKK A;  3SPU A;  2Q42 A;  4XUK A;  2I7T A;  5A0V A;  3KNS A;  2GKL A;  4J5F A;  4RAW A;  3ZWF A;  4NQ2 A;  2WRS A;  2FK6 A;  3G1P A;  3ZR9 A;  3ZNB A;  2Y8B A;  4ZO2 A;  1HLK A;  4C09 A;  1VJN A;  1JJE A;  4C1H A;  3KL7 A;  3IOF A;  2NZE A;  2A7M A;  4BP0 A;  5HH4 A;  2NXA A;  3I11 A;  2YCB A;  1WW1 A;  3IE2 A;  2UYX A;  5AYA A;  4P62 A;  2QJS A;  2Y87 A;  2YNW A;  5B1U A;  1X8G A;  4EYB A;  3DHB A;  4ZEJ A;  2ZZI A;  3R2U A;  3PY5 A;  3SW3 A;  5A5Z A;  2QDT A;  1YCH A;  4CHL A;  2AZ4 A;  3FAI A;  3I0V A;  5EVK A;  5AEB A;  4RAM A;  3PG4 A;  5HH5 A;  1BMC A;  2Q9U A;  2YNT B;  4FR7 A;  5LCA A;  2NYP A;  4U4L A;  4EFZ A;  5KIK A;  4FSB A;  1E5D A;  2BG8 B;  5HIO A;  4TZB A;  2WYM C;  4ZO3 A;  2GFJ A;  2AIO A;  1WRA A;  5LSC A;  2QDS A;  2WYM A;  2ZO4 A;  5DPX A;  2FU7 A;  5ACU A;  4RM5 A;  5FQA A;  4GCW A;  2P4Z A;  3X30 A;  2I7V A;  4J5H A;  4FEK A;  3SRX A;  1A8T A;  4Z6X A;  3ESH A;  4TYF A;  5B3R A;  2QIN A;  5LCH A;  1YCF A;  3MD7 A;  1X8I A;  5EVD A;  4AD9 A;  3DHC A;  1DD6 A;  5ACP A;  2BC2 A;  5K4M A;  4UWR B;  4C1C A;  5ACW A;  1VME A;  1VGN A;  3AF5 A;  1YCG A;  3T3N A;  3IEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...