3X2ZA

Crystal structure of metallo-beta-lactamase in complex with nickel from thermotoga maritima
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
227
structure length
227
Chain Sequence
GMKVTFLGHAVVLIEGKKNIIIDPFISGNPVCPVKLEGLPKIDYILVTHGHGDHLGDAVEIAKKNDATVISNYEICHYLGKKGVKTHAMHIGGSYLFDFGRVKMTPAVHGSGILDGDSMIYGGNPSGFLITIEGKKIYHAGDTGLTREMELLAEENVDVAFLPIGGNFVMDVEDAVRAAVMIKPKKVVPMHYGTWELIFADVELFKKKVEEKGVECVILEPGESLEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0173 metal-dependent hydrolase TM_1162
publication title Crystal structure of metallo-beta-lactamase in complex with nickel from Thermotoga maritima
rcsb
source organism Thermotoga maritima msb8
molecule tags Hydrolase
total genus 64
structure length 227
sequence length 227
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3x2zA00
3TP9A 1WUPA 1ZTCA 1VJNA 5LS3A 3LVZA 1X8GA 4C1FA 3AF5A 1YCHA 4XWTA 1Y44A 4EY2A 2FM6A 5LCHA 3ADRA 1QH3A 1DXKA 3IOGA 4KEQA 5EV8A 4RL2A 2QDSA 4NQ2A 4D1WA 4NQ4A 2YNTB 2WYLA 5EWAA 3SFPA 2I7TA 2DOOA 4YSBA 4DIKA 1A8TA 2ZNBA 3DHCA 2Q9UA 4WD6A 2DKFA 5KIKA 2BG8B 5HH6A 3JXPA 5B3RA 2VW8A 2YNTA 5ACTA 3KNSA 4CHLA 2GFKA 3X30A 3I13A 1WW1A 2FU7A 1VGNA 5ACVA 5ACWA 4AWYB 3I14A 1ZNBA 5ACUA 3X2ZA 2ZWRA 1YCGA 2WHGA 3RKJA 5LCFA 1M2XA 2YNUA 4FR7A 3DH8A 4HL2A 1E5DA 4GYUA 2P18A 2CBNA 4FEKA 5AHOA 4LE6A 5HH5A 4FSBA 1QH5A 3WXCA 1K07A 2AIOA 2Q42A 5ACXA 2P97A 3T3NA 2XR1A 3T3OA 5K4NA 4D1VA 4UWPB 3IEKA 4V0HA 1A7TA 4B87A 5IQKA 3I11A 4BZ3A 2P1EA 4EFZA 5HISA 2Q0JA 5FQAA 2HB9A 2GFJA 3QH8A 5KILA 4C1GA 3BC2A 4TZ9A 3F9OA 4XWWA 4EYBA 4RAMA 1MQOA 4UAMA 2FK6A 2FU9A 3IE1A 4J5HA 2BC2A 1YCFA 2QINA 2I7VA 4Z60A 2YNVB 4F6ZA 3X2XA 4AD9A 2YCBA 5FQBA 2P4ZA 3AJ3A 3AF6A 4P62A 4D1UA 4TZBA 3RKKA 5AXRA 4YSLA 4C1EA 3PG4A 4GCWA 2FU8A 4U4LA 1DDKA 4C1HA 1JT1A 4Z7RA 1BMCA 2QJSA 1SMLA 5B1UA 3S0ZA 2WYMC 5AYAA 5HIOA 4C09A 2UYXA 3IDZA 4GYQA 3IOFA 5K0WA 2R2DA 4Z5YA 2WRSA 5HIPA 4RAWA 3RPCA 4ZO3A 3ESHA 3P2UA 2BFKA 3PY5A 2BGAA 2QDTA 4UA4A 2BG8A 4KEPA 1X8HA 2FU6A 3R2UA 2BFZB 2FHXB 3G1PA 2OHHA 2ZZIA 3SRXA 2OHIA 4HKYA 3IE2A 5LLDA 2NZEA 3I0VA 3MD7A 5DPXA 3T9MA 2GCUA 5EVDA 5K4MA 4Z6XA 5LM6A 1JJTA 4C1CA 5ACPA 3KNRA 5EVBA 5EW0A 5EVKA 1XTOA 2BFZA 4NQ5A 4DILA 2BG7A 4AWZA 5A0TA 3H3EA 5EH9A 4EXSA 3FAIA 4UWSB 5EHTA 5ACQA 3ZQ4A 1L9YA 3IE0A 4PVTA 2M5CA 3X2YA 1DD6A 2BG2A 4Z5ZA 4EYLA 5LE1A 3VQZA 5A0VA 3ZR9A 5HIQA 4RBSA 4D02A 4O98A 1WUOA 5A87A 2NXAA 2AZ4A 4C1DA 3PY6A 5ACSA 3FCZA 3DHBA 4TZEA 2ZO4A 5AHRA 1KR3A 3DHAA 2YNVA 2Y8BA 1WRAA 4JO0A 4ZO2A 3IELA 5LCAA 5B15A 2YNWA 5LMCA 2Y8AA 3A4YA 4UWOB 1ZKPA 4ZNBA 4UWRB 4EXYA 1BVTA 5AXOA 4Z67A 2BFLA 4YSKA 2E7YA 5AEBA 3IEMA 5HH4A 1X8IA 2YZ3A 2BG6A 5K4KA 1BC2A 4BP0A 4D1TA 3KL7A 4AX1B 1P9EA 2QEDA 3SD9A 2BTNA 2H6AA 2BIBA 5LSCA 3ZWFA 4F6HA 2Q0IA 2WYMA 2OHJA 2I7XA 2BR6A 2XF4A 3Q6VA 2GKLA 3BK2A 2NZFA 4RL0A 5FQCA 4ZEJA 2M5DA 1XM8A 3SW3A 4J5FA 3BK1A 2A7MA 5EV6A 4XUKA 3I15A 3L6NA 4H0DA 3VPEA 2Y87A 3SBLA 2FHXA 2GMNA 5A5ZA 1KO2A 4UBQA 1JJEA 3ZNBA 4HL1A 2BMIA 3SPUA 3BV6A 4RM5A 4TYTA 1HLKA 2NYPA 1KO3A 4PVOA 1VMEA 4EYFA 4TZFA 4NQ6A 5ACRA 4TYFA 4AX0B
chains in the Genus database with same CATH superfamily
3TP9A 1WUPA 1ZTCA 1VJNA 5LS3A 4AXHA 3LVZA 1X8GA 4C1FA 3AF5A 1YCHA 4XWTA 1Y44A 4EY2A 2FM6A 5LCHA 3ADRA 1QH3A 1DXKA 3IOGA 4KEQA 5EV8A 4RL2A 2QDSA 4NQ2A 4D1WA 4NQ4A 2YNTB 2WYLA 5EWAA 3SFPA 2I7TA 2DOOA 4YSBA 4DIKA 1A8TA 2ZNBA 3DHCA 2Q9UA 4WD6A 2DKFA 5KIKA 2BG8B 5HH6A 3JXPA 5B3RA 2VW8A 2YNTA 5ACTA 3KNSA 4CHLA 2GFKA 3X30A 3I13A 1WW1A 2FU7A 1VGNA 4PDXA 5ACVA 4AWYB 5ACWA 3I14A 1ZNBA 5ACUA 3X2ZA 2ZWRA 1YCGA 2WHGA 3RKJA 5LCFA 1M2XA 2YNUA 4FR7A 3DH8A 4AV7A 4HL2A 1E5DA 4GYUA 2P18A 2CBNA 4FEKA 5AHOA 5AIJA 4LE6A 5HH5A 4FSBA 1QH5A 3WXCA 1K07A 2AIOA 2Q42A 5ACXA 2P97A 3T3NA 2XR1A 3T3OA 5K4NA 4D1VA 4UWPB 3IEKA 2CG3A 4V0HA 1A7TA 4B87A 5IQKA 3I11A 4BZ3A 2P1EA 4EFZA 5HISA 2Q0JA 5FQAA 2HB9A 2GFJA 3QH8A 5KILA 4C1GA 3BC2A 4TZ9A 5AJLA 3F9OA 4XWWA 4EYBA 4RAMA 1MQOA 4UAMA 2FK6A 2FU9A 3IE1A 4J5HA 2BC2A 1YCFA 2QINA 2I7VA 4Z60A 2YNVB 4F6ZA 3X2XA 4AD9A 2YCBA 5FQBA 2P4ZA 3AJ3A 3AF6A 4P62A 4D1UA 4TZBA 3RKKA 5AXRA 4YSLA 4C1EA 3PG4A 4GCWA 2FU8A 4U4LA 1DDKA 4C1HA 1JT1A 4Z7RA 1BMCA 2QJSA 1SMLA 5B1UA 3S0ZA 2WYMC 5AYAA 5HIOA 4C09A 2UYXA 3IDZA 4GYQA 2CFUA 3IOFA 5K0WA 2R2DA 4Z5YA 2WRSA 5HIPA 4RAWA 3RPCA 2CFZA 2YHEA 4ZO3A 3ESHA 3P2UA 2BFKA 3PY5A 2BGAA 2QDTA 4UA4A 2BG8A 4KEPA 1X8HA 2FU6A 3R2UA 2BFZB 2FHXB 3G1PA 2OHHA 2ZZIA 3SRXA 2OHIA 4HKYA 3IE2A 5LLDA 2NZEA 3I0VA 3MD7A 5DPXA 3T9MA 2GCUA 5EVDA 5K4MA 4Z6XA 5LM6A 1JJTA 4C1CA 5ACPA 3KNRA 5EVBA 5EW0A 5EVKA 1XTOA 2BFZA 4NQ5A 4DILA 2BG7A 4AWZA 5A0TA 3H3EA 5EH9A 4EXSA 3FAIA 4UWSB 5EHTA 5ACQA 3ZQ4A 1L9YA 3IE0A 4PVTA 2M5CA 3X2YA 1DD6A 2BG2A 4Z5ZA 4EYLA 5LE1A 3VQZA 5A0VA 3ZR9A 5HIQA 4RBSA 4D02A 5A23A 4O98A 1WUOA 5A87A 2NXAA 2AZ4A 4C1DA 3PY6A 5ACSA 3FCZA 3DHBA 4TZEA 2ZO4A 5AHRA 1KR3A 3DHAA 2YNVA 2Y8BA 1WRAA 4JO0A 4ZO2A 3IELA 5LCAA 5B15A 2YNWA 5LMCA 2Y8AA 3A4YA 4UWOB 1ZKPA 4ZNBA 4UWRB 4EXYA 1BVTA 5AXOA 4Z67A 2BFLA 4YSKA 2E7YA 5AEBA 3IEMA 4NURA 5HH4A 1X8IA 2YZ3A 2BG6A 5K4KA 1BC2A 4BP0A 4D1TA 3KL7A 4AX1B 1P9EA 2QEDA 3SD9A 2BTNA 2H6AA 2BIBA 5LSCA 3ZWFA 4F6HA 2Q0IA 2WYMA 2OHJA 2I7XA 2BR6A 2CG2A 2XF4A 3Q6VA 2GKLA 3BK2A 2NZFA 4RL0A 5FQCA 4ZEJA 2M5DA 1XM8A 3SW3A 4J5FA 3BK1A 2A7MA 5EV6A 4XUKA 3I15A 3L6NA 4H0DA 3VPEA 2Y87A 3SBLA 2FHXA 2GMNA 5A5ZA 1KO2A 4UBQA 1JJEA 3ZNBA 4HL1A 2BMIA 3SPUA 3BV6A 4RM5A 4TYTA 1HLKA 2NYPA 1KO3A 4PVOA 1VMEA 4EYFA 4TZFA 4NQ6A 5ACRA 4TYFA 4AX0B
chains in the Genus database with same CATH topology
3TP9A 1WUPA 1ZTCA 1VJNA 5LS3A 3LVZA 1X8GA 4C1FA 3AF5A 1YCHA 4XWTA 1Y44A 4EY2A 2FM6A 5LCHA 3ADRA 1QH3A 1DXKA 3IOGA 4KEQA 5EV8A 4RL2A 2QDSA 4NQ2A 4D1WA 4NQ4A 2YNTB 2WYLA 5EWAA 3SFPA 2I7TA 2DOOA 4YSBA 4DIKA 1A8TA 2ZNBA 3DHCA 2Q9UA 4WD6A 2DKFA 5KIKA 2BG8B 5HH6A 3JXPA 5B3RA 2VW8A 2YNTA 5ACTA 3KNSA 4CHLA 2GFKA 3X30A 3I13A 1WW1A 2FU7A 1VGNA 5ACVA 5ACWA 4AWYB 3I14A 1ZNBA 5ACUA 3X2ZA 2ZWRA 1YCGA 2WHGA 3RKJA 5LCFA 1M2XA 2YNUA 4FR7A 3DH8A 4HL2A 1E5DA 4GYUA 2P18A 2CBNA 4FEKA 5AHOA 4LE6A 5HH5A 4FSBA 1QH5A 3WXCA 1K07A 2AIOA 2Q42A 5ACXA 2P97A 3T3NA 2XR1A 3T3OA 5K4NA 4D1VA 4UWPB 3IEKA 4V0HA 1A7TA 4B87A 5IQKA 3I11A 4BZ3A 2P1EA 4EFZA 5HISA 2Q0JA 5FQAA 2HB9A 2GFJA 3QH8A 5KILA 4C1GA 3BC2A 4TZ9A 3F9OA 4XWWA 4EYBA 4RAMA 1MQOA 4UAMA 2FK6A 2FU9A 3IE1A 4J5HA 2BC2A 1YCFA 2QINA 2I7VA 4Z60A 2YNVB 4F6ZA 3X2XA 4AD9A 2YCBA 5FQBA 2P4ZA 3AJ3A 3AF6A 4P62A 4D1UA 4TZBA 3RKKA 5AXRA 4YSLA 4C1EA 3PG4A 4GCWA 2FU8A 4U4LA 1DDKA 4C1HA 1JT1A 4Z7RA 1BMCA 2QJSA 1SMLA 5B1UA 3S0ZA 2WYMC 5AYAA 5HIOA 4C09A 2UYXA 3IDZA 4GYQA 3IOFA 5K0WA 2R2DA 4Z5YA 2WRSA 5HIPA 4RAWA 3RPCA 4ZO3A 3ESHA 3P2UA 2BFKA 3PY5A 2BGAA 2QDTA 4UA4A 2BG8A 4KEPA 1X8HA 2FU6A 3R2UA 2BFZB 2FHXB 3G1PA 2OHHA 2ZZIA 3SRXA 2OHIA 4HKYA 3IE2A 5LLDA 2NZEA 3I0VA 3MD7A 5DPXA 3T9MA 2GCUA 5EVDA 5K4MA 4Z6XA 5LM6A 1JJTA 4C1CA 5ACPA 3KNRA 5EVBA 5EW0A 5EVKA 1XTOA 2BFZA 4NQ5A 4DILA 2BG7A 4AWZA 5A0TA 3H3EA 5EH9A 4EXSA 3FAIA 4UWSB 5EHTA 5ACQA 3ZQ4A 1L9YA 3IE0A 4PVTA 2M5CA 3X2YA 1DD6A 2BG2A 4Z5ZA 4EYLA 5LE1A 3VQZA 5A0VA 3ZR9A 5HIQA 4RBSA 4D02A 4O98A 1WUOA 5A87A 2NXAA 2AZ4A 4C1DA 3PY6A 5ACSA 3FCZA 3DHBA 4TZEA 2ZO4A 5AHRA 1KR3A 3DHAA 2YNVA 2Y8BA 1WRAA 4JO0A 4ZO2A 3IELA 5LCAA 5B15A 2YNWA 5LMCA 2Y8AA 3A4YA 4UWOB 1ZKPA 4ZNBA 4UWRB 4EXYA 1BVTA 5AXOA 4Z67A 2BFLA 4YSKA 2E7YA 5AEBA 3IEMA 5HH4A 1X8IA 2YZ3A 2BG6A 5K4KA 1BC2A 4BP0A 4D1TA 3KL7A 4AX1B 1P9EA 2QEDA 3SD9A 2BTNA 2H6AA 2BIBA 5LSCA 3ZWFA 4F6HA 2Q0IA 2WYMA 2OHJA 2I7XA 2BR6A 2XF4A 3Q6VA 2GKLA 3BK2A 2NZFA 4RL0A 5FQCA 4ZEJA 2M5DA 1XM8A 3SW3A 4J5FA 3BK1A 2A7MA 5EV6A 4XUKA 3I15A 3L6NA 4H0DA 3VPEA 2Y87A 3SBLA 2FHXA 2GMNA 5A5ZA 1KO2A 4UBQA 1JJEA 3ZNBA 4HL1A 2BMIA 3SPUA 3BV6A 4RM5A 4TYTA 1HLKA 2NYPA 1KO3A 4PVOA 1VMEA 4EYFA 4TZFA 4NQ6A 5ACRA 4TYFA 4AX0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TP9 A;  1WUP A;  1ZTC A;  1VJN A;  5LS3 A;  3LVZ A;  1X8G A;  4C1F A;  3AF5 A;  1YCH A;  4XWT A;  1Y44 A;  4EY2 A;  2FM6 A;  5LCH A;  3ADR A;  1QH3 A;  1DXK A;  3IOG A;  4KEQ A;  5EV8 A;  4RL2 A;  2QDS A;  4NQ2 A;  4D1W A;  4NQ4 A;  2YNT B;  2WYL A;  5EWA A;  3SFP A;  2I7T A;  2DOO A;  4YSB A;  4DIK A;  1A8T A;  2ZNB A;  3DHC A;  2Q9U A;  4WD6 A;  2DKF A;  5KIK A;  2BG8 B;  5HH6 A;  3JXP A;  5B3R A;  2VW8 A;  2YNT A;  5ACT A;  3KNS A;  4CHL A;  2GFK A;  3X30 A;  3I13 A;  1WW1 A;  2FU7 A;  1VGN A;  5ACV A;  5ACW A;  4AWY B;  3I14 A;  1ZNB A;  5ACU A;  3X2Z A;  2ZWR A;  1YCG A;  2WHG A;  3RKJ A;  5LCF A;  1M2X A;  2YNU A;  4FR7 A;  3DH8 A;  4HL2 A;  1E5D A;  4GYU A;  2P18 A;  2CBN A;  4FEK A;  5AHO A;  4LE6 A;  5HH5 A;  4FSB A;  1QH5 A;  3WXC A;  1K07 A;  2AIO A;  2Q42 A;  5ACX A;  2P97 A;  3T3N A;  2XR1 A;  3T3O A;  5K4N A;  4D1V A;  4UWP B;  3IEK A;  4V0H A;  1A7T A;  4B87 A;  5IQK A;  3I11 A;  4BZ3 A;  2P1E A;  4EFZ A;  5HIS A;  2Q0J A;  5FQA A;  2HB9 A;  2GFJ A;  3QH8 A;  5KIL A;  4C1G A;  3BC2 A;  4TZ9 A;  3F9O A;  4XWW A;  4EYB A;  4RAM A;  1MQO A;  4UAM A;  2FK6 A;  2FU9 A;  3IE1 A;  4J5H A;  2BC2 A;  1YCF A;  2QIN A;  2I7V A;  4Z60 A;  2YNV B;  4F6Z A;  3X2X A;  4AD9 A;  2YCB A;  5FQB A;  2P4Z A;  3AJ3 A;  3AF6 A;  4P62 A;  4D1U A;  4TZB A;  3RKK A;  5AXR A;  4YSL A;  4C1E A;  3PG4 A;  4GCW A;  2FU8 A;  4U4L A;  1DDK A;  4C1H A;  1JT1 A;  4Z7R A;  1BMC A;  2QJS A;  1SML A;  5B1U A;  3S0Z A;  2WYM C;  5AYA A;  5HIO A;  4C09 A;  2UYX A;  3IDZ A;  4GYQ A;  3IOF A;  5K0W A;  2R2D A;  4Z5Y A;  2WRS A;  5HIP A;  4RAW A;  3RPC A;  4ZO3 A;  3ESH A;  3P2U A;  2BFK A;  3PY5 A;  2BGA A;  2QDT A;  4UA4 A;  2BG8 A;  4KEP A;  1X8H A;  2FU6 A;  3R2U A;  2BFZ B;  2FHX B;  3G1P A;  2OHH A;  2ZZI A;  3SRX A;  2OHI A;  4HKY A;  3IE2 A;  5LLD A;  2NZE A;  3I0V A;  3MD7 A;  5DPX A;  3T9M A;  2GCU A;  5EVD A;  5K4M A;  4Z6X A;  5LM6 A;  1JJT A;  4C1C A;  5ACP A;  3KNR A;  5EVB A;  5EW0 A;  5EVK A;  1XTO A;  2BFZ A;  4NQ5 A;  4DIL A;  2BG7 A;  4AWZ A;  5A0T A;  3H3E A;  5EH9 A;  4EXS A;  3FAI A;  4UWS B;  5EHT A;  5ACQ A;  3ZQ4 A;  1L9Y A;  3IE0 A;  4PVT A;  2M5C A;  3X2Y A;  1DD6 A;  2BG2 A;  4Z5Z A;  4EYL A;  5LE1 A;  3VQZ A;  5A0V A;  3ZR9 A;  5HIQ A;  4RBS A;  4D02 A;  4O98 A;  1WUO A;  5A87 A;  2NXA A;  2AZ4 A;  4C1D A;  3PY6 A;  5ACS A;  3FCZ A;  3DHB A;  4TZE A;  2ZO4 A;  5AHR A;  1KR3 A;  3DHA A;  2YNV A;  2Y8B A;  1WRA A;  4JO0 A;  4ZO2 A;  3IEL A;  5LCA A;  5B15 A;  2YNW A;  5LMC A;  2Y8A A;  3A4Y A;  4UWO B;  1ZKP A;  4ZNB A;  4UWR B;  4EXY A;  1BVT A;  5AXO A;  4Z67 A;  2BFL A;  4YSK A;  2E7Y A;  5AEB A;  3IEM A;  5HH4 A;  1X8I A;  2YZ3 A;  2BG6 A;  5K4K A;  1BC2 A;  4BP0 A;  4D1T A;  3KL7 A;  4AX1 B;  1P9E A;  2QED A;  3SD9 A;  2BTN A;  2H6A A;  2BIB A;  5LSC A;  3ZWF A;  4F6H A;  2Q0I A;  2WYM A;  2OHJ A;  2I7X A;  2BR6 A;  2XF4 A;  3Q6V A;  2GKL A;  3BK2 A;  2NZF A;  4RL0 A;  5FQC A;  4ZEJ A;  2M5D A;  1XM8 A;  3SW3 A;  4J5F A;  3BK1 A;  2A7M A;  5EV6 A;  4XUK A;  3I15 A;  3L6N A;  4H0D A;  3VPE A;  2Y87 A;  3SBL A;  2FHX A;  2GMN A;  5A5Z A;  1KO2 A;  4UBQ A;  1JJE A;  3ZNB A;  4HL1 A;  2BMI A;  3SPU A;  3BV6 A;  4RM5 A;  4TYT A;  1HLK A;  2NYP A;  1KO3 A;  4PVO A;  1VME A;  4EYF A;  4TZF A;  4NQ6 A;  5ACR A;  4TYF A;  4AX0 B; 
#chains in the Genus database with same CATH topology
 3TP9 A;  1WUP A;  1ZTC A;  1VJN A;  5LS3 A;  4AXH A;  3LVZ A;  1X8G A;  4C1F A;  3AF5 A;  1YCH A;  4XWT A;  1Y44 A;  4EY2 A;  2FM6 A;  5LCH A;  3ADR A;  1QH3 A;  1DXK A;  3IOG A;  4KEQ A;  5EV8 A;  4RL2 A;  2QDS A;  4NQ2 A;  4D1W A;  4NQ4 A;  2YNT B;  2WYL A;  5EWA A;  3SFP A;  2I7T A;  2DOO A;  4YSB A;  4DIK A;  1A8T A;  2ZNB A;  3DHC A;  2Q9U A;  4WD6 A;  2DKF A;  5KIK A;  2BG8 B;  5HH6 A;  3JXP A;  5B3R A;  2VW8 A;  2YNT A;  5ACT A;  3KNS A;  4CHL A;  2GFK A;  3X30 A;  3I13 A;  1WW1 A;  2FU7 A;  1VGN A;  4PDX A;  5ACV A;  4AWY B;  5ACW A;  3I14 A;  1ZNB A;  5ACU A;  3X2Z A;  2ZWR A;  1YCG A;  2WHG A;  3RKJ A;  5LCF A;  1M2X A;  2YNU A;  4FR7 A;  3DH8 A;  4AV7 A;  4HL2 A;  1E5D A;  4GYU A;  2P18 A;  2CBN A;  4FEK A;  5AHO A;  5AIJ A;  4LE6 A;  5HH5 A;  4FSB A;  1QH5 A;  3WXC A;  1K07 A;  2AIO A;  2Q42 A;  5ACX A;  2P97 A;  3T3N A;  2XR1 A;  3T3O A;  5K4N A;  4D1V A;  4UWP B;  3IEK A;  2CG3 A;  4V0H A;  1A7T A;  4B87 A;  5IQK A;  3I11 A;  4BZ3 A;  2P1E A;  4EFZ A;  5HIS A;  2Q0J A;  5FQA A;  2HB9 A;  2GFJ A;  3QH8 A;  5KIL A;  4C1G A;  3BC2 A;  4TZ9 A;  5AJL A;  3F9O A;  4XWW A;  4EYB A;  4RAM A;  1MQO A;  4UAM A;  2FK6 A;  2FU9 A;  3IE1 A;  4J5H A;  2BC2 A;  1YCF A;  2QIN A;  2I7V A;  4Z60 A;  2YNV B;  4F6Z A;  3X2X A;  4AD9 A;  2YCB A;  5FQB A;  2P4Z A;  3AJ3 A;  3AF6 A;  4P62 A;  4D1U A;  4TZB A;  3RKK A;  5AXR A;  4YSL A;  4C1E A;  3PG4 A;  4GCW A;  2FU8 A;  4U4L A;  1DDK A;  4C1H A;  1JT1 A;  4Z7R A;  1BMC A;  2QJS A;  1SML A;  5B1U A;  3S0Z A;  2WYM C;  5AYA A;  5HIO A;  4C09 A;  2UYX A;  3IDZ A;  4GYQ A;  2CFU A;  3IOF A;  5K0W A;  2R2D A;  4Z5Y A;  2WRS A;  5HIP A;  4RAW A;  3RPC A;  2CFZ A;  2YHE A;  4ZO3 A;  3ESH A;  3P2U A;  2BFK A;  3PY5 A;  2BGA A;  2QDT A;  4UA4 A;  2BG8 A;  4KEP A;  1X8H A;  2FU6 A;  3R2U A;  2BFZ B;  2FHX B;  3G1P A;  2OHH A;  2ZZI A;  3SRX A;  2OHI A;  4HKY A;  3IE2 A;  5LLD A;  2NZE A;  3I0V A;  3MD7 A;  5DPX A;  3T9M A;  2GCU A;  5EVD A;  5K4M A;  4Z6X A;  5LM6 A;  1JJT A;  4C1C A;  5ACP A;  3KNR A;  5EVB A;  5EW0 A;  5EVK A;  1XTO A;  2BFZ A;  4NQ5 A;  4DIL A;  2BG7 A;  4AWZ A;  5A0T A;  3H3E A;  5EH9 A;  4EXS A;  3FAI A;  4UWS B;  5EHT A;  5ACQ A;  3ZQ4 A;  1L9Y A;  3IE0 A;  4PVT A;  2M5C A;  3X2Y A;  1DD6 A;  2BG2 A;  4Z5Z A;  4EYL A;  5LE1 A;  3VQZ A;  5A0V A;  3ZR9 A;  5HIQ A;  4RBS A;  4D02 A;  5A23 A;  4O98 A;  1WUO A;  5A87 A;  2NXA A;  2AZ4 A;  4C1D A;  3PY6 A;  5ACS A;  3FCZ A;  3DHB A;  4TZE A;  2ZO4 A;  5AHR A;  1KR3 A;  3DHA A;  2YNV A;  2Y8B A;  1WRA A;  4JO0 A;  4ZO2 A;  3IEL A;  5LCA A;  5B15 A;  2YNW A;  5LMC A;  2Y8A A;  3A4Y A;  4UWO B;  1ZKP A;  4ZNB A;  4UWR B;  4EXY A;  1BVT A;  5AXO A;  4Z67 A;  2BFL A;  4YSK A;  2E7Y A;  5AEB A;  3IEM A;  4NUR A;  5HH4 A;  1X8I A;  2YZ3 A;  2BG6 A;  5K4K A;  1BC2 A;  4BP0 A;  4D1T A;  3KL7 A;  4AX1 B;  1P9E A;  2QED A;  3SD9 A;  2BTN A;  2H6A A;  2BIB A;  5LSC A;  3ZWF A;  4F6H A;  2Q0I A;  2WYM A;  2OHJ A;  2I7X A;  2BR6 A;  2CG2 A;  2XF4 A;  3Q6V A;  2GKL A;  3BK2 A;  2NZF A;  4RL0 A;  5FQC A;  4ZEJ A;  2M5D A;  1XM8 A;  3SW3 A;  4J5F A;  3BK1 A;  2A7M A;  5EV6 A;  4XUK A;  3I15 A;  3L6N A;  4H0D A;  3VPE A;  2Y87 A;  3SBL A;  2FHX A;  2GMN A;  5A5Z A;  1KO2 A;  4UBQ A;  1JJE A;  3ZNB A;  4HL1 A;  2BMI A;  3SPU A;  3BV6 A;  4RM5 A;  4TYT A;  1HLK A;  2NYP A;  1KO3 A;  4PVO A;  1VME A;  4EYF A;  4TZF A;  4NQ6 A;  5ACR A;  4TYF A;  4AX0 B; 
#chains in the Genus database with same CATH homology
 3TP9 A;  1WUP A;  1ZTC A;  1VJN A;  5LS3 A;  3LVZ A;  1X8G A;  4C1F A;  3AF5 A;  1YCH A;  4XWT A;  1Y44 A;  4EY2 A;  2FM6 A;  5LCH A;  3ADR A;  1QH3 A;  1DXK A;  3IOG A;  4KEQ A;  5EV8 A;  4RL2 A;  2QDS A;  4NQ2 A;  4D1W A;  4NQ4 A;  2YNT B;  2WYL A;  5EWA A;  3SFP A;  2I7T A;  2DOO A;  4YSB A;  4DIK A;  1A8T A;  2ZNB A;  3DHC A;  2Q9U A;  4WD6 A;  2DKF A;  5KIK A;  2BG8 B;  5HH6 A;  3JXP A;  5B3R A;  2VW8 A;  2YNT A;  5ACT A;  3KNS A;  4CHL A;  2GFK A;  3X30 A;  3I13 A;  1WW1 A;  2FU7 A;  1VGN A;  5ACV A;  5ACW A;  4AWY B;  3I14 A;  1ZNB A;  5ACU A;  3X2Z A;  2ZWR A;  1YCG A;  2WHG A;  3RKJ A;  5LCF A;  1M2X A;  2YNU A;  4FR7 A;  3DH8 A;  4HL2 A;  1E5D A;  4GYU A;  2P18 A;  2CBN A;  4FEK A;  5AHO A;  4LE6 A;  5HH5 A;  4FSB A;  1QH5 A;  3WXC A;  1K07 A;  2AIO A;  2Q42 A;  5ACX A;  2P97 A;  3T3N A;  2XR1 A;  3T3O A;  5K4N A;  4D1V A;  4UWP B;  3IEK A;  4V0H A;  1A7T A;  4B87 A;  5IQK A;  3I11 A;  4BZ3 A;  2P1E A;  4EFZ A;  5HIS A;  2Q0J A;  5FQA A;  2HB9 A;  2GFJ A;  3QH8 A;  5KIL A;  4C1G A;  3BC2 A;  4TZ9 A;  3F9O A;  4XWW A;  4EYB A;  4RAM A;  1MQO A;  4UAM A;  2FK6 A;  2FU9 A;  3IE1 A;  4J5H A;  2BC2 A;  1YCF A;  2QIN A;  2I7V A;  4Z60 A;  2YNV B;  4F6Z A;  3X2X A;  4AD9 A;  2YCB A;  5FQB A;  2P4Z A;  3AJ3 A;  3AF6 A;  4P62 A;  4D1U A;  4TZB A;  3RKK A;  5AXR A;  4YSL A;  4C1E A;  3PG4 A;  4GCW A;  2FU8 A;  4U4L A;  1DDK A;  4C1H A;  1JT1 A;  4Z7R A;  1BMC A;  2QJS A;  1SML A;  5B1U A;  3S0Z A;  2WYM C;  5AYA A;  5HIO A;  4C09 A;  2UYX A;  3IDZ A;  4GYQ A;  3IOF A;  5K0W A;  2R2D A;  4Z5Y A;  2WRS A;  5HIP A;  4RAW A;  3RPC A;  4ZO3 A;  3ESH A;  3P2U A;  2BFK A;  3PY5 A;  2BGA A;  2QDT A;  4UA4 A;  2BG8 A;  4KEP A;  1X8H A;  2FU6 A;  3R2U A;  2BFZ B;  2FHX B;  3G1P A;  2OHH A;  2ZZI A;  3SRX A;  2OHI A;  4HKY A;  3IE2 A;  5LLD A;  2NZE A;  3I0V A;  3MD7 A;  5DPX A;  3T9M A;  2GCU A;  5EVD A;  5K4M A;  4Z6X A;  5LM6 A;  1JJT A;  4C1C A;  5ACP A;  3KNR A;  5EVB A;  5EW0 A;  5EVK A;  1XTO A;  2BFZ A;  4NQ5 A;  4DIL A;  2BG7 A;  4AWZ A;  5A0T A;  3H3E A;  5EH9 A;  4EXS A;  3FAI A;  4UWS B;  5EHT A;  5ACQ A;  3ZQ4 A;  1L9Y A;  3IE0 A;  4PVT A;  2M5C A;  3X2Y A;  1DD6 A;  2BG2 A;  4Z5Z A;  4EYL A;  5LE1 A;  3VQZ A;  5A0V A;  3ZR9 A;  5HIQ A;  4RBS A;  4D02 A;  4O98 A;  1WUO A;  5A87 A;  2NXA A;  2AZ4 A;  4C1D A;  3PY6 A;  5ACS A;  3FCZ A;  3DHB A;  4TZE A;  2ZO4 A;  5AHR A;  1KR3 A;  3DHA A;  2YNV A;  2Y8B A;  1WRA A;  4JO0 A;  4ZO2 A;  3IEL A;  5LCA A;  5B15 A;  2YNW A;  5LMC A;  2Y8A A;  3A4Y A;  4UWO B;  1ZKP A;  4ZNB A;  4UWR B;  4EXY A;  1BVT A;  5AXO A;  4Z67 A;  2BFL A;  4YSK A;  2E7Y A;  5AEB A;  3IEM A;  5HH4 A;  1X8I A;  2YZ3 A;  2BG6 A;  5K4K A;  1BC2 A;  4BP0 A;  4D1T A;  3KL7 A;  4AX1 B;  1P9E A;  2QED A;  3SD9 A;  2BTN A;  2H6A A;  2BIB A;  5LSC A;  3ZWF A;  4F6H A;  2Q0I A;  2WYM A;  2OHJ A;  2I7X A;  2BR6 A;  2XF4 A;  3Q6V A;  2GKL A;  3BK2 A;  2NZF A;  4RL0 A;  5FQC A;  4ZEJ A;  2M5D A;  1XM8 A;  3SW3 A;  4J5F A;  3BK1 A;  2A7M A;  5EV6 A;  4XUK A;  3I15 A;  3L6N A;  4H0D A;  3VPE A;  2Y87 A;  3SBL A;  2FHX A;  2GMN A;  5A5Z A;  1KO2 A;  4UBQ A;  1JJE A;  3ZNB A;  4HL1 A;  2BMI A;  3SPU A;  3BV6 A;  4RM5 A;  4TYT A;  1HLK A;  2NYP A;  1KO3 A;  4PVO A;  1VME A;  4EYF A;  4TZF A;  4NQ6 A;  5ACR A;  4TYF A;  4AX0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...