3X2ZA

Crystal structure of metallo-beta-lactamase in complex with nickel from thermotoga maritima
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
227
structure length
227
Chain Sequence
GMKVTFLGHAVVLIEGKKNIIIDPFISGNPVCPVKLEGLPKIDYILVTHGHGDHLGDAVEIAKKNDATVISNYEICHYLGKKGVKTHAMHIGGSYLFDFGRVKMTPAVHGSGILDGDSMIYGGNPSGFLITIEGKKIYHAGDTGLTREMELLAEENVDVAFLPIGGNFVMDVEDAVRAAVMIKPKKVVPMHYGTWELIFADVELFKKKVEEKGVECVILEPGESLEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0173 metal-dependent hydrolase TM_1162
publication title Crystal structure of metallo-beta-lactamase in complex with nickel from Thermotoga maritima
rcsb
source organism Thermotoga maritima msb8
molecule tags Hydrolase
total genus 64
structure length 227
sequence length 227
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3x2zA00
3IOGA 3VPEA 4GYQA 4ZEJA 4CHLA 5AXOA 2GCUA 3KL7A 5HH4A 1WUOA 4P62A 5LM6A 4HL2A 3AF5A 2ZZIA 1YCHA 3IEMA 2BIBA 2Q42A 3RKKA 5HIQA 3ZR9A 1JJEA 4D1VA 4YSBA 4ZO2A 5ACVA 2YNUA 2Y8BA 3SW3A 3IELA 2M5DA 4J5HA 5LLDA 3L6NA 2OHJA 2BGAA 3A4YA 4UA4A 5ACPA 5A0VA 1SMLA 1K07A 1YCGA 2BFZA 2QJSA 2ZO4A 4RL2A 5EH9A 5AYAA 2FM6A 2P4ZA 2Y8AA 5KIKA 5EVKA 4DIKA 2A7MA 1L9YA 5EVDA 2BG2A 4EYLA 4Z6XA 1BC2A 4LE6A 3IE1A 2BFZB 4NQ6A 2WYLA 2GFKA 2HB9A 2NZEA 5B3RA 1VGNA 5ACTA 4TYFA 3X30A 5LMCA 2XF4A 4TZBA 1BVTA 4RAWA 1X8GA 2M5CA 5LS3A 5ACXA 4HL1A 4KEPA 3SRXA 4J5FA 2DKFA 2I7TA 2FK6A 3S0ZA 2ZNBA 2Q0IA 3P2UA 3IE2A 2YCBA 3X2XA 2P1EA 4D02A 3IDZA 4NQ2A 3TP9A 4TZ9A 3KNRA 1WUPA 5LSCA 3BV6A 5EWAA 5K0WA 1JT1A 4BP0A 2R2DA 1HLKA 3VQZA 1M2XA 3WXCA 5A5ZA 2E7YA 2BG8A 4D1WA 4O98A 4UWOB 4V0HA 5A0TA 4UWPB 5FQCA 2BFLA 3PY6A 2YZ3A 3IE0A 4Z67A 2VW8A 4Z7RA 1P9EA 5A87A 3R2UA 1WRAA 3DHAA 4ZNBA 5FQBA 4C1DA 4KEQA 3BC2A 4JO0A 2AZ4A 3I14A 2BG8B 1ZNBA 3FCZA 4D1UA 4AD9A 1ZKPA 4RM5A 3MD7A 3ZNBA 3DHBA 3Q6VA 4C1EA 3KNSA 4PVTA 4GCWA 5ACSA 1ZTCA 4AWYB 2P97A 4YSKA 3G1PA 4U4LA 2QEDA 4EXYA 4FR7A 3RPCA 4C09A 2BTNA 2P18A 2FU9A 1WW1A 4EXSA 3T3NA 4UWRB 3BK2A 1XM8A 1VMEA 2NXAA 5ACUA 3ZWFA 1X8HA 3I11A 5HH6A 4Z60A 5K4KA 5EV8A 4B87A 2CBNA 4DILA 2Y87A 2FU7A 4XUKA 2BC2A 4ZO3A 5LCAA 2Q0JA 4EFZA 4UAMA 3SBLA 5AEBA 3IEKA 2I7VA 2WHGA 1X8IA 3SPUA 5DPXA 4NQ4A 5AHRA 3H3EA 2OHHA 2FU8A 1DDKA 2NZFA 5EW0A 3I15A 2QINA 5AHOA 4GYUA 5FQAA 5AXRA 4TZFA 4RL0A 4BZ3A 1DD6A 5LCFA 4H0DA 3F9OA 5IQKA 4WD6A 5ACWA 4FSBA 4UBQA 2GFJA 5ACQA 4XWWA 2BG6A 2I7XA 5KILA 2OHIA 2FU6A 2UYXA 5K4NA 1A8TA 3SD9A 3PG4A 4EYFA 3AF6A 5EV6A 4TYTA 3ZQ4A 5LE1A 3T9MA 1QH3A 2GMNA 2FHXA 3IOFA 4NQ5A 4YSLA 2YNVA 1MQOA 2BFKA 5EVBA 2YNTA 4PVOA 2H6AA 4C1GA 2WRSA 2BG7A 5HH5A 3BK1A 3SFPA 4C1HA 3FAIA 4HKYA 3ADRA 3QH8A 4Z5ZA 1KO2A 4RBSA 4XWTA 5HIOA 4F6HA 2FHXB 5HIPA 2QDSA 2ZWRA 3T3OA 2YNVB 3ESHA 3DH8A 2YNTB 3I13A 4C1FA 2GKLA 2DOOA 4AX0B 3DHCA 1DXKA 2NYPA 2AIOA 4UWSB 5LCHA 1XTOA 4D1TA 1Y44A 3PY5A 5EHTA 4F6ZA 1KO3A 1BMCA 1VJNA 2BR6A 2WYMC 5ACRA 3JXPA 3RKJA 2XR1A 4FEKA 1E5DA 5K4MA 4AX1B 1QH5A 4TZEA 3X2ZA 2BMIA 2QDTA 1YCFA 3I0VA 5B15A 3LVZA 1A7TA 4EY2A 4RAMA 5B1UA 4Z5YA 4AWZA 1JJTA 5HISA 4EYBA 2WYMA 4C1CA 3AJ3A 3X2YA 1KR3A 2Q9UA 2YNWA
chains in the Genus database with same CATH superfamily
3IOGA 3VPEA 4GYQA 4ZEJA 4CHLA 5AXOA 2GCUA 3KL7A 5HH4A 1WUOA 4P62A 5LM6A 4HL2A 3AF5A 5AIJA 2ZZIA 1YCHA 3IEMA 2BIBA 2Q42A 3RKKA 5HIQA 3ZR9A 1JJEA 4D1VA 4YSBA 4ZO2A 5ACVA 2YNUA 2Y8BA 3SW3A 3IELA 2M5DA 4J5HA 5LLDA 3L6NA 2OHJA 2BGAA 3A4YA 4UA4A 5ACPA 5A0VA 1SMLA 1K07A 2CG3A 1YCGA 2BFZA 2QJSA 2ZO4A 4RL2A 5EH9A 5AYAA 2FM6A 2P4ZA 2Y8AA 5KIKA 5AJLA 5EVKA 4DIKA 2A7MA 1L9YA 5EVDA 2BG2A 4EYLA 4Z6XA 1BC2A 4LE6A 3IE1A 2BFZB 4NQ6A 2WYLA 2GFKA 2HB9A 2NZEA 5B3RA 1VGNA 5ACTA 4TYFA 3X30A 5LMCA 2XF4A 4TZBA 1BVTA 4RAWA 1X8GA 2M5CA 5LS3A 5ACXA 4HL1A 4KEPA 3SRXA 4J5FA 2DKFA 2I7TA 2FK6A 3S0ZA 2ZNBA 2Q0IA 3P2UA 3IE2A 2YCBA 3X2XA 2P1EA 4D02A 3IDZA 4NQ2A 3TP9A 4TZ9A 3KNRA 1WUPA 5LSCA 3BV6A 5EWAA 5K0WA 1JT1A 4BP0A 2R2DA 1HLKA 3VQZA 1M2XA 3WXCA 5A5ZA 2E7YA 2BG8A 4D1WA 4O98A 4UWOB 4V0HA 5A0TA 4UWPB 5FQCA 2BFLA 3PY6A 2YZ3A 3IE0A 4Z67A 2VW8A 4Z7RA 1P9EA 5A87A 3R2UA 1WRAA 3DHAA 4ZNBA 5FQBA 4C1DA 2YHEA 3BC2A 4JO0A 2AZ4A 3I14A 4KEQA 2BG8B 1ZNBA 3FCZA 4D1UA 4AD9A 1ZKPA 4RM5A 3MD7A 3ZNBA 4AXHA 3DHBA 3Q6VA 4C1EA 3KNSA 4PVTA 4GCWA 5ACSA 1ZTCA 4AWYB 2P97A 4YSKA 3G1PA 4U4LA 2QEDA 4EXYA 4FR7A 3RPCA 4C09A 2BTNA 2P18A 2FU9A 1WW1A 4EXSA 3T3NA 4UWRB 3BK2A 1XM8A 1VMEA 2NXAA 5ACUA 3ZWFA 1X8HA 3I11A 5HH6A 4Z60A 5K4KA 5EV8A 4B87A 2CBNA 4DILA 2Y87A 2FU7A 4XUKA 2BC2A 4ZO3A 2CG2A 5LCAA 2Q0JA 4EFZA 4UAMA 3SBLA 5AEBA 3IEKA 2I7VA 2WHGA 1X8IA 3SPUA 5DPXA 4NQ4A 5AHRA 3H3EA 2OHHA 2FU8A 1DDKA 2NZFA 5EW0A 3I15A 2QINA 5AHOA 4GYUA 5FQAA 5AXRA 4TZFA 4RL0A 4BZ3A 1DD6A 5LCFA 4H0DA 3F9OA 5IQKA 4WD6A 5ACWA 4FSBA 4UBQA 2GFJA 5ACQA 4XWWA 2BG6A 2I7XA 5KILA 2OHIA 2CFUA 2FU6A 2UYXA 5K4NA 1A8TA 3SD9A 3PG4A 4EYFA 3AF6A 5EV6A 4TYTA 3ZQ4A 5LE1A 3T9MA 1QH3A 2GMNA 2FHXA 3IOFA 4NQ5A 4YSLA 2YNVA 1MQOA 2BFKA 4PDXA 5EVBA 2YNTA 4PVOA 2H6AA 4C1GA 2WRSA 2BG7A 5HH5A 3BK1A 3SFPA 4C1HA 3FAIA 4HKYA 3ADRA 3QH8A 4Z5ZA 1KO2A 4RBSA 4XWTA 5HIOA 4F6HA 2FHXB 5HIPA 4AV7A 2QDSA 2ZWRA 3T3OA 2YNVB 3ESHA 3DH8A 2YNTB 3I13A 4C1FA 2GKLA 2DOOA 4AX0B 3DHCA 1DXKA 2NYPA 4NURA 2AIOA 4UWSB 5LCHA 1XTOA 4D1TA 1Y44A 3PY5A 5EHTA 4F6ZA 1KO3A 1BMCA 1VJNA 2BR6A 2WYMC 5ACRA 3JXPA 3RKJA 2XR1A 4FEKA 1E5DA 5K4MA 4AX1B 1QH5A 4TZEA 3X2ZA 2BMIA 2QDTA 1YCFA 3I0VA 5B15A 3LVZA 1A7TA 4EY2A 4RAMA 5B1UA 4Z5YA 4AWZA 2CFZA 1JJTA 5HISA 4EYBA 2WYMA 4C1CA 3AJ3A 5A23A 3X2YA 1KR3A 2Q9UA 2YNWA
chains in the Genus database with same CATH topology
3IOGA 3VPEA 4GYQA 4ZEJA 4CHLA 5AXOA 2GCUA 3KL7A 5HH4A 1WUOA 4P62A 5LM6A 4HL2A 3AF5A 2ZZIA 1YCHA 3IEMA 2BIBA 2Q42A 3RKKA 5HIQA 3ZR9A 1JJEA 4D1VA 4YSBA 4ZO2A 5ACVA 2YNUA 2Y8BA 3SW3A 3IELA 2M5DA 4J5HA 5LLDA 3L6NA 2OHJA 2BGAA 3A4YA 4UA4A 5ACPA 5A0VA 1SMLA 1K07A 1YCGA 2BFZA 2QJSA 2ZO4A 4RL2A 5EH9A 5AYAA 2FM6A 2P4ZA 2Y8AA 5KIKA 5EVKA 4DIKA 2A7MA 1L9YA 5EVDA 2BG2A 4EYLA 4Z6XA 1BC2A 4LE6A 3IE1A 2BFZB 4NQ6A 2WYLA 2GFKA 2HB9A 2NZEA 5B3RA 1VGNA 5ACTA 4TYFA 3X30A 5LMCA 2XF4A 4TZBA 1BVTA 4RAWA 1X8GA 2M5CA 5LS3A 5ACXA 4HL1A 4KEPA 3SRXA 4J5FA 2DKFA 2I7TA 2FK6A 3S0ZA 2ZNBA 2Q0IA 3P2UA 3IE2A 2YCBA 3X2XA 2P1EA 4D02A 3IDZA 4NQ2A 3TP9A 4TZ9A 3KNRA 1WUPA 5LSCA 3BV6A 5EWAA 5K0WA 1JT1A 4BP0A 2R2DA 1HLKA 3VQZA 1M2XA 3WXCA 5A5ZA 2E7YA 2BG8A 4D1WA 4O98A 4UWOB 4V0HA 5A0TA 4UWPB 5FQCA 2BFLA 3PY6A 2YZ3A 3IE0A 4Z67A 2VW8A 4Z7RA 1P9EA 5A87A 3R2UA 1WRAA 3DHAA 4ZNBA 5FQBA 4C1DA 4KEQA 3BC2A 4JO0A 2AZ4A 3I14A 2BG8B 1ZNBA 3FCZA 4D1UA 4AD9A 1ZKPA 4RM5A 3MD7A 3ZNBA 3DHBA 3Q6VA 4C1EA 3KNSA 4PVTA 4GCWA 5ACSA 1ZTCA 4AWYB 2P97A 4YSKA 3G1PA 4U4LA 2QEDA 4EXYA 4FR7A 3RPCA 4C09A 2BTNA 2P18A 2FU9A 1WW1A 4EXSA 3T3NA 4UWRB 3BK2A 1XM8A 1VMEA 2NXAA 5ACUA 3ZWFA 1X8HA 3I11A 5HH6A 4Z60A 5K4KA 5EV8A 4B87A 2CBNA 4DILA 2Y87A 2FU7A 4XUKA 2BC2A 4ZO3A 5LCAA 2Q0JA 4EFZA 4UAMA 3SBLA 5AEBA 3IEKA 2I7VA 2WHGA 1X8IA 3SPUA 5DPXA 4NQ4A 5AHRA 3H3EA 2OHHA 2FU8A 1DDKA 2NZFA 5EW0A 3I15A 2QINA 5AHOA 4GYUA 5FQAA 5AXRA 4TZFA 4RL0A 4BZ3A 1DD6A 5LCFA 4H0DA 3F9OA 5IQKA 4WD6A 5ACWA 4FSBA 4UBQA 2GFJA 5ACQA 4XWWA 2BG6A 2I7XA 5KILA 2OHIA 2FU6A 2UYXA 5K4NA 1A8TA 3SD9A 3PG4A 4EYFA 3AF6A 5EV6A 4TYTA 3ZQ4A 5LE1A 3T9MA 1QH3A 2GMNA 2FHXA 3IOFA 4NQ5A 4YSLA 2YNVA 1MQOA 2BFKA 5EVBA 2YNTA 4PVOA 2H6AA 4C1GA 2WRSA 2BG7A 5HH5A 3BK1A 3SFPA 4C1HA 3FAIA 4HKYA 3ADRA 3QH8A 4Z5ZA 1KO2A 4RBSA 4XWTA 5HIOA 4F6HA 2FHXB 5HIPA 2QDSA 2ZWRA 3T3OA 2YNVB 3ESHA 3DH8A 2YNTB 3I13A 4C1FA 2GKLA 2DOOA 4AX0B 3DHCA 1DXKA 2NYPA 2AIOA 4UWSB 5LCHA 1XTOA 4D1TA 1Y44A 3PY5A 5EHTA 4F6ZA 1KO3A 1BMCA 1VJNA 2BR6A 2WYMC 5ACRA 3JXPA 3RKJA 2XR1A 4FEKA 1E5DA 5K4MA 4AX1B 1QH5A 4TZEA 3X2ZA 2BMIA 2QDTA 1YCFA 3I0VA 5B15A 3LVZA 1A7TA 4EY2A 4RAMA 5B1UA 4Z5YA 4AWZA 1JJTA 5HISA 4EYBA 2WYMA 4C1CA 3AJ3A 3X2YA 1KR3A 2Q9UA 2YNWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IOG A;  3VPE A;  4GYQ A;  4ZEJ A;  4CHL A;  5AXO A;  2GCU A;  3KL7 A;  5HH4 A;  1WUO A;  4P62 A;  5LM6 A;  4HL2 A;  3AF5 A;  2ZZI A;  1YCH A;  3IEM A;  2BIB A;  2Q42 A;  3RKK A;  5HIQ A;  3ZR9 A;  1JJE A;  4D1V A;  4YSB A;  4ZO2 A;  5ACV A;  2YNU A;  2Y8B A;  3SW3 A;  3IEL A;  2M5D A;  4J5H A;  5LLD A;  3L6N A;  2OHJ A;  2BGA A;  3A4Y A;  4UA4 A;  5ACP A;  5A0V A;  1SML A;  1K07 A;  1YCG A;  2BFZ A;  2QJS A;  2ZO4 A;  4RL2 A;  5EH9 A;  5AYA A;  2FM6 A;  2P4Z A;  2Y8A A;  5KIK A;  5EVK A;  4DIK A;  2A7M A;  1L9Y A;  5EVD A;  2BG2 A;  4EYL A;  4Z6X A;  1BC2 A;  4LE6 A;  3IE1 A;  2BFZ B;  4NQ6 A;  2WYL A;  2GFK A;  2HB9 A;  2NZE A;  5B3R A;  1VGN A;  5ACT A;  4TYF A;  3X30 A;  5LMC A;  2XF4 A;  4TZB A;  1BVT A;  4RAW A;  1X8G A;  2M5C A;  5LS3 A;  5ACX A;  4HL1 A;  4KEP A;  3SRX A;  4J5F A;  2DKF A;  2I7T A;  2FK6 A;  3S0Z A;  2ZNB A;  2Q0I A;  3P2U A;  3IE2 A;  2YCB A;  3X2X A;  2P1E A;  4D02 A;  3IDZ A;  4NQ2 A;  3TP9 A;  4TZ9 A;  3KNR A;  1WUP A;  5LSC A;  3BV6 A;  5EWA A;  5K0W A;  1JT1 A;  4BP0 A;  2R2D A;  1HLK A;  3VQZ A;  1M2X A;  3WXC A;  5A5Z A;  2E7Y A;  2BG8 A;  4D1W A;  4O98 A;  4UWO B;  4V0H A;  5A0T A;  4UWP B;  5FQC A;  2BFL A;  3PY6 A;  2YZ3 A;  3IE0 A;  4Z67 A;  2VW8 A;  4Z7R A;  1P9E A;  5A87 A;  3R2U A;  1WRA A;  3DHA A;  4ZNB A;  5FQB A;  4C1D A;  4KEQ A;  3BC2 A;  4JO0 A;  2AZ4 A;  3I14 A;  2BG8 B;  1ZNB A;  3FCZ A;  4D1U A;  4AD9 A;  1ZKP A;  4RM5 A;  3MD7 A;  3ZNB A;  3DHB A;  3Q6V A;  4C1E A;  3KNS A;  4PVT A;  4GCW A;  5ACS A;  1ZTC A;  4AWY B;  2P97 A;  4YSK A;  3G1P A;  4U4L A;  2QED A;  4EXY A;  4FR7 A;  3RPC A;  4C09 A;  2BTN A;  2P18 A;  2FU9 A;  1WW1 A;  4EXS A;  3T3N A;  4UWR B;  3BK2 A;  1XM8 A;  1VME A;  2NXA A;  5ACU A;  3ZWF A;  1X8H A;  3I11 A;  5HH6 A;  4Z60 A;  5K4K A;  5EV8 A;  4B87 A;  2CBN A;  4DIL A;  2Y87 A;  2FU7 A;  4XUK A;  2BC2 A;  4ZO3 A;  5LCA A;  2Q0J A;  4EFZ A;  4UAM A;  3SBL A;  5AEB A;  3IEK A;  2I7V A;  2WHG A;  1X8I A;  3SPU A;  5DPX A;  4NQ4 A;  5AHR A;  3H3E A;  2OHH A;  2FU8 A;  1DDK A;  2NZF A;  5EW0 A;  3I15 A;  2QIN A;  5AHO A;  4GYU A;  5FQA A;  5AXR A;  4TZF A;  4RL0 A;  4BZ3 A;  1DD6 A;  5LCF A;  4H0D A;  3F9O A;  5IQK A;  4WD6 A;  5ACW A;  4FSB A;  4UBQ A;  2GFJ A;  5ACQ A;  4XWW A;  2BG6 A;  2I7X A;  5KIL A;  2OHI A;  2FU6 A;  2UYX A;  5K4N A;  1A8T A;  3SD9 A;  3PG4 A;  4EYF A;  3AF6 A;  5EV6 A;  4TYT A;  3ZQ4 A;  5LE1 A;  3T9M A;  1QH3 A;  2GMN A;  2FHX A;  3IOF A;  4NQ5 A;  4YSL A;  2YNV A;  1MQO A;  2BFK A;  5EVB A;  2YNT A;  4PVO A;  2H6A A;  4C1G A;  2WRS A;  2BG7 A;  5HH5 A;  3BK1 A;  3SFP A;  4C1H A;  3FAI A;  4HKY A;  3ADR A;  3QH8 A;  4Z5Z A;  1KO2 A;  4RBS A;  4XWT A;  5HIO A;  4F6H A;  2FHX B;  5HIP A;  2QDS A;  2ZWR A;  3T3O A;  2YNV B;  3ESH A;  3DH8 A;  2YNT B;  3I13 A;  4C1F A;  2GKL A;  2DOO A;  4AX0 B;  3DHC A;  1DXK A;  2NYP A;  2AIO A;  4UWS B;  5LCH A;  1XTO A;  4D1T A;  1Y44 A;  3PY5 A;  5EHT A;  4F6Z A;  1KO3 A;  1BMC A;  1VJN A;  2BR6 A;  2WYM C;  5ACR A;  3JXP A;  3RKJ A;  2XR1 A;  4FEK A;  1E5D A;  5K4M A;  4AX1 B;  1QH5 A;  4TZE A;  3X2Z A;  2BMI A;  2QDT A;  1YCF A;  3I0V A;  5B15 A;  3LVZ A;  1A7T A;  4EY2 A;  4RAM A;  5B1U A;  4Z5Y A;  4AWZ A;  1JJT A;  5HIS A;  4EYB A;  2WYM A;  4C1C A;  3AJ3 A;  3X2Y A;  1KR3 A;  2Q9U A;  2YNW A; 
#chains in the Genus database with same CATH topology
 3IOG A;  3VPE A;  4GYQ A;  4ZEJ A;  4CHL A;  5AXO A;  2GCU A;  3KL7 A;  5HH4 A;  1WUO A;  4P62 A;  5LM6 A;  4HL2 A;  3AF5 A;  5AIJ A;  2ZZI A;  1YCH A;  3IEM A;  2BIB A;  2Q42 A;  3RKK A;  5HIQ A;  3ZR9 A;  1JJE A;  4D1V A;  4YSB A;  4ZO2 A;  5ACV A;  2YNU A;  2Y8B A;  3SW3 A;  3IEL A;  2M5D A;  4J5H A;  5LLD A;  3L6N A;  2OHJ A;  2BGA A;  3A4Y A;  4UA4 A;  5ACP A;  5A0V A;  1SML A;  1K07 A;  2CG3 A;  1YCG A;  2BFZ A;  2QJS A;  2ZO4 A;  4RL2 A;  5EH9 A;  5AYA A;  2FM6 A;  2P4Z A;  2Y8A A;  5KIK A;  5AJL A;  5EVK A;  4DIK A;  2A7M A;  1L9Y A;  5EVD A;  2BG2 A;  4EYL A;  4Z6X A;  1BC2 A;  4LE6 A;  3IE1 A;  2BFZ B;  4NQ6 A;  2WYL A;  2GFK A;  2HB9 A;  2NZE A;  5B3R A;  1VGN A;  5ACT A;  4TYF A;  3X30 A;  5LMC A;  2XF4 A;  4TZB A;  1BVT A;  4RAW A;  1X8G A;  2M5C A;  5LS3 A;  5ACX A;  4HL1 A;  4KEP A;  3SRX A;  4J5F A;  2DKF A;  2I7T A;  2FK6 A;  3S0Z A;  2ZNB A;  2Q0I A;  3P2U A;  3IE2 A;  2YCB A;  3X2X A;  2P1E A;  4D02 A;  3IDZ A;  4NQ2 A;  3TP9 A;  4TZ9 A;  3KNR A;  1WUP A;  5LSC A;  3BV6 A;  5EWA A;  5K0W A;  1JT1 A;  4BP0 A;  2R2D A;  1HLK A;  3VQZ A;  1M2X A;  3WXC A;  5A5Z A;  2E7Y A;  2BG8 A;  4D1W A;  4O98 A;  4UWO B;  4V0H A;  5A0T A;  4UWP B;  5FQC A;  2BFL A;  3PY6 A;  2YZ3 A;  3IE0 A;  4Z67 A;  2VW8 A;  4Z7R A;  1P9E A;  5A87 A;  3R2U A;  1WRA A;  3DHA A;  4ZNB A;  5FQB A;  4C1D A;  2YHE A;  3BC2 A;  4JO0 A;  2AZ4 A;  3I14 A;  4KEQ A;  2BG8 B;  1ZNB A;  3FCZ A;  4D1U A;  4AD9 A;  1ZKP A;  4RM5 A;  3MD7 A;  3ZNB A;  4AXH A;  3DHB A;  3Q6V A;  4C1E A;  3KNS A;  4PVT A;  4GCW A;  5ACS A;  1ZTC A;  4AWY B;  2P97 A;  4YSK A;  3G1P A;  4U4L A;  2QED A;  4EXY A;  4FR7 A;  3RPC A;  4C09 A;  2BTN A;  2P18 A;  2FU9 A;  1WW1 A;  4EXS A;  3T3N A;  4UWR B;  3BK2 A;  1XM8 A;  1VME A;  2NXA A;  5ACU A;  3ZWF A;  1X8H A;  3I11 A;  5HH6 A;  4Z60 A;  5K4K A;  5EV8 A;  4B87 A;  2CBN A;  4DIL A;  2Y87 A;  2FU7 A;  4XUK A;  2BC2 A;  4ZO3 A;  2CG2 A;  5LCA A;  2Q0J A;  4EFZ A;  4UAM A;  3SBL A;  5AEB A;  3IEK A;  2I7V A;  2WHG A;  1X8I A;  3SPU A;  5DPX A;  4NQ4 A;  5AHR A;  3H3E A;  2OHH A;  2FU8 A;  1DDK A;  2NZF A;  5EW0 A;  3I15 A;  2QIN A;  5AHO A;  4GYU A;  5FQA A;  5AXR A;  4TZF A;  4RL0 A;  4BZ3 A;  1DD6 A;  5LCF A;  4H0D A;  3F9O A;  5IQK A;  4WD6 A;  5ACW A;  4FSB A;  4UBQ A;  2GFJ A;  5ACQ A;  4XWW A;  2BG6 A;  2I7X A;  5KIL A;  2OHI A;  2CFU A;  2FU6 A;  2UYX A;  5K4N A;  1A8T A;  3SD9 A;  3PG4 A;  4EYF A;  3AF6 A;  5EV6 A;  4TYT A;  3ZQ4 A;  5LE1 A;  3T9M A;  1QH3 A;  2GMN A;  2FHX A;  3IOF A;  4NQ5 A;  4YSL A;  2YNV A;  1MQO A;  2BFK A;  4PDX A;  5EVB A;  2YNT A;  4PVO A;  2H6A A;  4C1G A;  2WRS A;  2BG7 A;  5HH5 A;  3BK1 A;  3SFP A;  4C1H A;  3FAI A;  4HKY A;  3ADR A;  3QH8 A;  4Z5Z A;  1KO2 A;  4RBS A;  4XWT A;  5HIO A;  4F6H A;  2FHX B;  5HIP A;  4AV7 A;  2QDS A;  2ZWR A;  3T3O A;  2YNV B;  3ESH A;  3DH8 A;  2YNT B;  3I13 A;  4C1F A;  2GKL A;  2DOO A;  4AX0 B;  3DHC A;  1DXK A;  2NYP A;  4NUR A;  2AIO A;  4UWS B;  5LCH A;  1XTO A;  4D1T A;  1Y44 A;  3PY5 A;  5EHT A;  4F6Z A;  1KO3 A;  1BMC A;  1VJN A;  2BR6 A;  2WYM C;  5ACR A;  3JXP A;  3RKJ A;  2XR1 A;  4FEK A;  1E5D A;  5K4M A;  4AX1 B;  1QH5 A;  4TZE A;  3X2Z A;  2BMI A;  2QDT A;  1YCF A;  3I0V A;  5B15 A;  3LVZ A;  1A7T A;  4EY2 A;  4RAM A;  5B1U A;  4Z5Y A;  4AWZ A;  2CFZ A;  1JJT A;  5HIS A;  4EYB A;  2WYM A;  4C1C A;  3AJ3 A;  5A23 A;  3X2Y A;  1KR3 A;  2Q9U A;  2YNW A; 
#chains in the Genus database with same CATH homology
 3IOG A;  3VPE A;  4GYQ A;  4ZEJ A;  4CHL A;  5AXO A;  2GCU A;  3KL7 A;  5HH4 A;  1WUO A;  4P62 A;  5LM6 A;  4HL2 A;  3AF5 A;  2ZZI A;  1YCH A;  3IEM A;  2BIB A;  2Q42 A;  3RKK A;  5HIQ A;  3ZR9 A;  1JJE A;  4D1V A;  4YSB A;  4ZO2 A;  5ACV A;  2YNU A;  2Y8B A;  3SW3 A;  3IEL A;  2M5D A;  4J5H A;  5LLD A;  3L6N A;  2OHJ A;  2BGA A;  3A4Y A;  4UA4 A;  5ACP A;  5A0V A;  1SML A;  1K07 A;  1YCG A;  2BFZ A;  2QJS A;  2ZO4 A;  4RL2 A;  5EH9 A;  5AYA A;  2FM6 A;  2P4Z A;  2Y8A A;  5KIK A;  5EVK A;  4DIK A;  2A7M A;  1L9Y A;  5EVD A;  2BG2 A;  4EYL A;  4Z6X A;  1BC2 A;  4LE6 A;  3IE1 A;  2BFZ B;  4NQ6 A;  2WYL A;  2GFK A;  2HB9 A;  2NZE A;  5B3R A;  1VGN A;  5ACT A;  4TYF A;  3X30 A;  5LMC A;  2XF4 A;  4TZB A;  1BVT A;  4RAW A;  1X8G A;  2M5C A;  5LS3 A;  5ACX A;  4HL1 A;  4KEP A;  3SRX A;  4J5F A;  2DKF A;  2I7T A;  2FK6 A;  3S0Z A;  2ZNB A;  2Q0I A;  3P2U A;  3IE2 A;  2YCB A;  3X2X A;  2P1E A;  4D02 A;  3IDZ A;  4NQ2 A;  3TP9 A;  4TZ9 A;  3KNR A;  1WUP A;  5LSC A;  3BV6 A;  5EWA A;  5K0W A;  1JT1 A;  4BP0 A;  2R2D A;  1HLK A;  3VQZ A;  1M2X A;  3WXC A;  5A5Z A;  2E7Y A;  2BG8 A;  4D1W A;  4O98 A;  4UWO B;  4V0H A;  5A0T A;  4UWP B;  5FQC A;  2BFL A;  3PY6 A;  2YZ3 A;  3IE0 A;  4Z67 A;  2VW8 A;  4Z7R A;  1P9E A;  5A87 A;  3R2U A;  1WRA A;  3DHA A;  4ZNB A;  5FQB A;  4C1D A;  4KEQ A;  3BC2 A;  4JO0 A;  2AZ4 A;  3I14 A;  2BG8 B;  1ZNB A;  3FCZ A;  4D1U A;  4AD9 A;  1ZKP A;  4RM5 A;  3MD7 A;  3ZNB A;  3DHB A;  3Q6V A;  4C1E A;  3KNS A;  4PVT A;  4GCW A;  5ACS A;  1ZTC A;  4AWY B;  2P97 A;  4YSK A;  3G1P A;  4U4L A;  2QED A;  4EXY A;  4FR7 A;  3RPC A;  4C09 A;  2BTN A;  2P18 A;  2FU9 A;  1WW1 A;  4EXS A;  3T3N A;  4UWR B;  3BK2 A;  1XM8 A;  1VME A;  2NXA A;  5ACU A;  3ZWF A;  1X8H A;  3I11 A;  5HH6 A;  4Z60 A;  5K4K A;  5EV8 A;  4B87 A;  2CBN A;  4DIL A;  2Y87 A;  2FU7 A;  4XUK A;  2BC2 A;  4ZO3 A;  5LCA A;  2Q0J A;  4EFZ A;  4UAM A;  3SBL A;  5AEB A;  3IEK A;  2I7V A;  2WHG A;  1X8I A;  3SPU A;  5DPX A;  4NQ4 A;  5AHR A;  3H3E A;  2OHH A;  2FU8 A;  1DDK A;  2NZF A;  5EW0 A;  3I15 A;  2QIN A;  5AHO A;  4GYU A;  5FQA A;  5AXR A;  4TZF A;  4RL0 A;  4BZ3 A;  1DD6 A;  5LCF A;  4H0D A;  3F9O A;  5IQK A;  4WD6 A;  5ACW A;  4FSB A;  4UBQ A;  2GFJ A;  5ACQ A;  4XWW A;  2BG6 A;  2I7X A;  5KIL A;  2OHI A;  2FU6 A;  2UYX A;  5K4N A;  1A8T A;  3SD9 A;  3PG4 A;  4EYF A;  3AF6 A;  5EV6 A;  4TYT A;  3ZQ4 A;  5LE1 A;  3T9M A;  1QH3 A;  2GMN A;  2FHX A;  3IOF A;  4NQ5 A;  4YSL A;  2YNV A;  1MQO A;  2BFK A;  5EVB A;  2YNT A;  4PVO A;  2H6A A;  4C1G A;  2WRS A;  2BG7 A;  5HH5 A;  3BK1 A;  3SFP A;  4C1H A;  3FAI A;  4HKY A;  3ADR A;  3QH8 A;  4Z5Z A;  1KO2 A;  4RBS A;  4XWT A;  5HIO A;  4F6H A;  2FHX B;  5HIP A;  2QDS A;  2ZWR A;  3T3O A;  2YNV B;  3ESH A;  3DH8 A;  2YNT B;  3I13 A;  4C1F A;  2GKL A;  2DOO A;  4AX0 B;  3DHC A;  1DXK A;  2NYP A;  2AIO A;  4UWS B;  5LCH A;  1XTO A;  4D1T A;  1Y44 A;  3PY5 A;  5EHT A;  4F6Z A;  1KO3 A;  1BMC A;  1VJN A;  2BR6 A;  2WYM C;  5ACR A;  3JXP A;  3RKJ A;  2XR1 A;  4FEK A;  1E5D A;  5K4M A;  4AX1 B;  1QH5 A;  4TZE A;  3X2Z A;  2BMI A;  2QDT A;  1YCF A;  3I0V A;  5B15 A;  3LVZ A;  1A7T A;  4EY2 A;  4RAM A;  5B1U A;  4Z5Y A;  4AWZ A;  1JJT A;  5HIS A;  4EYB A;  2WYM A;  4C1C A;  3AJ3 A;  3X2Y A;  1KR3 A;  2Q9U A;  2YNW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...