3X2ZA

Crystal structure of metallo-beta-lactamase in complex with nickel from thermotoga maritima
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
227
structure length
227
Chain Sequence
GMKVTFLGHAVVLIEGKKNIIIDPFISGNPVCPVKLEGLPKIDYILVTHGHGDHLGDAVEIAKKNDATVISNYEICHYLGKKGVKTHAMHIGGSYLFDFGRVKMTPAVHGSGILDGDSMIYGGNPSGFLITIEGKKIYHAGDTGLTREMELLAEENVDVAFLPIGGNFVMDVEDAVRAAVMIKPKKVVPMHYGTWELIFADVELFKKKVEEKGVECVILEPGESLEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords UPF0173 metal-dependent hydrolase TM_1162
publication title Crystal structure of metallo-beta-lactamase in complex with nickel from Thermotoga maritima
rcsb
source organism Thermotoga maritima msb8
total genus 64
structure length 227
sequence length 227
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3x2zA00
4EYLA 1DD6A 2YCBA 4TZ9A 2WRSA 5ACSA 2A7MA 4D02A 1WW1A 5ACWA 2Q9UA 5K4KA 3ZQ4A 4C1CA 1A7TA 2QDSA 3IE0A 2QDTA 4BP0A 1A8TA 1YCHA 4EY2A 1X8IA 2BG2A 2BG8B 4NQ6A 4J5HA 5HIPA 5FQCA 3AF5A 3BK1A 3VQZA 1VGNA 1ZTCA 2GKLA 4RL2A 5KILA 4TYTA 2FU9A 5LCFA 4XWTA 2M5CA 5EVBA 1M2XA 4AX0B 2XF4A 3P2UA 4RBSA 2GFJA 3F9OA 4Z5ZA 4YSLA 3I15A 2DKFA 5HIQA 3S0ZA 4D1TA 5EH9A 2YNTB 4PVOA 5AXRA 5DPXA 4DIKA 2ZZIA 4UWSB 1X8HA 4HL1A 1XM8A 3A4YA 5LMCA 5HH5A 5B1UA 2BR6A 2CBNA 2GCUA 3X2XA 4DILA 5A87A 3IE1A 5HH6A 2ZWRA 4HKYA 3I14A 5AHOA 4UWPB 2FM6A 1WUPA 1QH3A 2M5DA 5EW0A 2VW8A 4AX1B 5LE1A 2QINA 5HIOA 4O98A 4FEKA 1XTOA 3RPCA 5ACPA 5ACVA 3JXPA 2FU8A 3IEKA 5LCHA 5K0WA 4GCWA 3H3EA 5HISA 5FQBA 5EV8A 3T3NA 4Z7RA 2P1EA 2GFKA 5B3RA 2P97A 5B15A 4Z6XA 4ZNBA 4C1GA 3IOFA 5LLDA 2QEDA 4NQ2A 2FU7A 3DH8A 4RL0A 2R2DA 2I7TA 5LM6A 1X8GA 5ACUA 2FU6A 1KO3A 3SFPA 2WHGA 3FCZA 4FSBA 1K07A 5K4MA 1BC2A 1ZNBA 5AYAA 4TYFA 5A0TA 5LS3A 1KO2A 2Q0JA 4Z67A 4H0DA 4V0HA 2DOOA 3T9MA 4UWRB 4EYBA 2NZFA 4D1WA 3DHBA 2E7YA 5HH4A 4AD9A 3T3OA 4UAMA 4U4LA 4ZEJA 3VPEA 2BIBA 5AHRA 4UWOB 2BGAA 5FQAA 2FK6A 1DXKA 4XUKA 4LE6A 4D1UA 2P4ZA 3X30A 3DHAA 2YNUA 1VJNA 2NZEA 4C1EA 3AF6A 4WD6A 4Z60A 3DHCA 4B87A 5EHTA 3RKKA 3ZR9A 3SRXA 3ADRA 4P62A 3KNSA 2YZ3A 3IEMA 3LVZA 4Z5YA 4NQ5A 2Q0IA 1JJTA 3L6NA 2Y87A 1WUOA 2AIOA 2AZ4A 2BC2A 5AXOA 2YNVA 4AWZA 4ZO2A 2UYXA 4EFZA 4JO0A 2ZNBA 4GYQA 4GYUA 5K4NA 5KIKA 3KL7A 5A0VA 3KNRA 3WXCA 1YCFA 4XWWA 1P9EA 2Y8BA 4EXSA 2YNWA 4C09A 2OHJA 1HLKA 2P18A 1E5DA 2Y8AA 1BVTA 2HB9A 2BTNA 5EVKA 1YCGA 1Y44A 2I7XA 2BG7A 2H6AA 3QH8A 2BMIA 2GMNA 2XR1A 4PVTA 4BZ3A 3ZWFA 3BV6A 4D1VA 4RAMA 5AEBA 2WYMA 4C1FA 2YNVB 3IE2A 1JJEA 4F6ZA 5ACRA 1DDKA 2YNTA 3SD9A 1VMEA 1JT1A 1KR3A 3ZNBA 4J5FA 5EV6A 5EWAA 3X2ZA 3IDZA 1WRAA 3BK2A 4CHLA 5LSCA 3SW3A 4C1DA 3Q6VA 4EYFA 4ZO3A 1SMLA 2NXAA 1QH5A 2WYLA 4KEQA 4TZEA 5EVDA 1L9YA 5ACXA 3IELA 3MD7A 5A5ZA 3PG4A 2BFZA 4RM5A 5IQKA 5ACTA 2BFKA 4YSBA 3I11A 3PY5A 4FR7A 3RKJA 2ZO4A 3FAIA 1BMCA 3TP9A 2NYPA 2WYMC 3X2YA 3IOGA 2FHXA 3SBLA 2BG6A 5LCAA 3G1PA 4RAWA 5ACQA 3ESHA 4TZFA 4UBQA 2Q42A 3I13A 4YSKA 3BC2A 2OHIA 4UA4A 2I7VA 2BFZB 2OHHA 4KEPA 2QJSA 1MQOA 1ZKPA 4TZBA 2BFLA 2BG8A 4EXYA 3SPUA 4HL2A 3AJ3A 4C1HA 4AWYB 4NQ4A 2FHXB 3I0VA 3R2UA 4F6HA 3PY6A
chains in the Genus database with same CATH superfamily
4EYLA 1DD6A 2YCBA 4TZ9A 2WRSA 5ACSA 2A7MA 4D02A 1WW1A 5ACWA 2Q9UA 5K4KA 3ZQ4A 4C1CA 1A7TA 2QDSA 3IE0A 2QDTA 4BP0A 1A8TA 1YCHA 4EY2A 1X8IA 2BG2A 2BG8B 4NQ6A 4J5HA 5HIPA 5FQCA 3AF5A 3BK1A 3VQZA 1VGNA 1ZTCA 2GKLA 4RL2A 5KILA 4TYTA 2FU9A 4XWTA 5LCFA 2M5CA 5EVBA 1M2XA 4AX0B 2XF4A 3P2UA 4RBSA 2GFJA 4PDXA 3F9OA 4Z5ZA 4YSLA 3I15A 2DKFA 5HIQA 3S0ZA 4D1TA 5EH9A 2YNTB 4PVOA 5AXRA 5DPXA 4DIKA 2ZZIA 4UWSB 1X8HA 4HL1A 1XM8A 3A4YA 5LMCA 5HH5A 5B1UA 2BR6A 2CBNA 2GCUA 3X2XA 4DILA 5A87A 3IE1A 5HH6A 2ZWRA 4HKYA 3I14A 5AHOA 4UWPB 2FM6A 4NURA 1WUPA 1QH3A 2M5DA 5EW0A 2VW8A 4AX1B 5LE1A 2QINA 5HIOA 4O98A 4FEKA 1XTOA 3RPCA 2YHEA 5ACPA 5ACVA 3JXPA 2CG3A 2FU8A 3IEKA 5LCHA 5K0WA 4GCWA 3H3EA 5HISA 5FQBA 5EV8A 2CFUA 3T3NA 4Z7RA 2P1EA 2GFKA 5B3RA 2P97A 5A23A 5B15A 4Z6XA 4ZNBA 4C1GA 3IOFA 5AJLA 5LLDA 2QEDA 4NQ2A 2FU7A 3DH8A 4RL0A 2R2DA 2I7TA 5LM6A 1X8GA 5ACUA 2FU6A 1KO3A 3SFPA 2WHGA 3FCZA 4FSBA 1K07A 5K4MA 1BC2A 1ZNBA 5AYAA 4TYFA 5A0TA 5LS3A 1KO2A 2Q0JA 4Z67A 4H0DA 4V0HA 2DOOA 3T9MA 4UWRB 4EYBA 2NZFA 4D1WA 3DHBA 2E7YA 5HH4A 4AD9A 3T3OA 4UAMA 4U4LA 4ZEJA 3VPEA 2BIBA 5AHRA 4UWOB 2BGAA 5FQAA 2FK6A 1DXKA 4XUKA 4LE6A 4D1UA 2P4ZA 3X30A 3DHAA 2YNUA 1VJNA 2NZEA 4C1EA 3AF6A 4WD6A 4Z60A 3DHCA 4B87A 5EHTA 3RKKA 3ZR9A 3SRXA 3ADRA 4P62A 3KNSA 2YZ3A 3IEMA 3LVZA 4Z5YA 4NQ5A 2Q0IA 1JJTA 3L6NA 2Y87A 1WUOA 2AIOA 2AZ4A 2BC2A 2CG2A 5AXOA 4AV7A 2YNVA 4AWZA 4ZO2A 2UYXA 4EFZA 4JO0A 2ZNBA 4GYQA 4GYUA 5K4NA 5KIKA 3KL7A 5A0VA 3KNRA 3WXCA 1YCFA 4XWWA 5AIJA 1P9EA 2Y8BA 4EXSA 2YNWA 4C09A 2OHJA 1HLKA 2P18A 1E5DA 2Y8AA 1BVTA 2HB9A 2BTNA 5EVKA 1YCGA 1Y44A 2I7XA 2BG7A 2H6AA 3QH8A 2BMIA 2GMNA 2XR1A 4PVTA 4BZ3A 3ZWFA 3BV6A 4D1VA 4RAMA 5AEBA 2WYMA 4C1FA 2YNVB 3IE2A 1JJEA 4F6ZA 5ACRA 1DDKA 2YNTA 3SD9A 1VMEA 1JT1A 1KR3A 3ZNBA 4J5FA 5EV6A 5EWAA 3X2ZA 3IDZA 1WRAA 3BK2A 4CHLA 5LSCA 3SW3A 4C1DA 3Q6VA 4EYFA 4ZO3A 1SMLA 2NXAA 1QH5A 2WYLA 4KEQA 4TZEA 5EVDA 1L9YA 5ACXA 3IELA 3MD7A 5A5ZA 3PG4A 2BFZA 4RM5A 5IQKA 5ACTA 2BFKA 4YSBA 3I11A 3PY5A 4FR7A 3RKJA 2ZO4A 3FAIA 1BMCA 3TP9A 2NYPA 2WYMC 3X2YA 3IOGA 2FHXA 3SBLA 2BG6A 5LCAA 3G1PA 4RAWA 5ACQA 3ESHA 4TZFA 4UBQA 2Q42A 3I13A 4YSKA 3BC2A 2CFZA 2OHIA 4UA4A 2I7VA 2BFZB 2OHHA 4KEPA 2QJSA 1MQOA 1ZKPA 4TZBA 2BFLA 2BG8A 4EXYA 3SPUA 4HL2A 3AJ3A 4C1HA 4AWYB 4AXHA 4NQ4A 2FHXB 3I0VA 3R2UA 4F6HA 3PY6A
chains in the Genus database with same CATH topology
4EYLA 1DD6A 2YCBA 4TZ9A 2WRSA 5ACSA 2A7MA 4D02A 1WW1A 5ACWA 2Q9UA 5K4KA 3ZQ4A 4C1CA 1A7TA 2QDSA 3IE0A 2QDTA 4BP0A 1A8TA 1YCHA 4EY2A 1X8IA 2BG2A 2BG8B 4NQ6A 4J5HA 5HIPA 5FQCA 3AF5A 3BK1A 3VQZA 1VGNA 1ZTCA 2GKLA 4RL2A 5KILA 4TYTA 2FU9A 5LCFA 4XWTA 2M5CA 5EVBA 1M2XA 4AX0B 2XF4A 3P2UA 4RBSA 2GFJA 3F9OA 4Z5ZA 4YSLA 3I15A 2DKFA 5HIQA 3S0ZA 4D1TA 5EH9A 2YNTB 4PVOA 5AXRA 5DPXA 4DIKA 2ZZIA 4UWSB 1X8HA 4HL1A 1XM8A 3A4YA 5LMCA 5HH5A 5B1UA 2BR6A 2CBNA 2GCUA 3X2XA 4DILA 5A87A 3IE1A 5HH6A 2ZWRA 4HKYA 3I14A 5AHOA 4UWPB 2FM6A 1WUPA 1QH3A 2M5DA 5EW0A 2VW8A 4AX1B 5LE1A 2QINA 5HIOA 4O98A 4FEKA 1XTOA 3RPCA 5ACPA 5ACVA 3JXPA 2FU8A 3IEKA 5LCHA 5K0WA 4GCWA 3H3EA 5HISA 5FQBA 5EV8A 3T3NA 4Z7RA 2P1EA 2GFKA 5B3RA 2P97A 5B15A 4Z6XA 4ZNBA 4C1GA 3IOFA 5LLDA 2QEDA 4NQ2A 2FU7A 3DH8A 4RL0A 2R2DA 2I7TA 5LM6A 1X8GA 5ACUA 2FU6A 1KO3A 3SFPA 2WHGA 3FCZA 4FSBA 1K07A 5K4MA 1BC2A 1ZNBA 5AYAA 4TYFA 5A0TA 5LS3A 1KO2A 2Q0JA 4Z67A 4H0DA 4V0HA 2DOOA 3T9MA 4UWRB 4EYBA 2NZFA 4D1WA 3DHBA 2E7YA 5HH4A 4AD9A 3T3OA 4UAMA 4U4LA 4ZEJA 3VPEA 2BIBA 5AHRA 4UWOB 2BGAA 5FQAA 2FK6A 1DXKA 4XUKA 4LE6A 4D1UA 2P4ZA 3X30A 3DHAA 2YNUA 1VJNA 2NZEA 4C1EA 3AF6A 4WD6A 4Z60A 3DHCA 4B87A 5EHTA 3RKKA 3ZR9A 3SRXA 3ADRA 4P62A 3KNSA 2YZ3A 3IEMA 3LVZA 4Z5YA 4NQ5A 2Q0IA 1JJTA 3L6NA 2Y87A 1WUOA 2AIOA 2AZ4A 2BC2A 5AXOA 2YNVA 4AWZA 4ZO2A 2UYXA 4EFZA 4JO0A 2ZNBA 4GYQA 4GYUA 5K4NA 5KIKA 3KL7A 5A0VA 3KNRA 3WXCA 1YCFA 4XWWA 1P9EA 2Y8BA 4EXSA 2YNWA 4C09A 2OHJA 1HLKA 2P18A 1E5DA 2Y8AA 1BVTA 2HB9A 2BTNA 5EVKA 1YCGA 1Y44A 2I7XA 2BG7A 2H6AA 3QH8A 2BMIA 2GMNA 2XR1A 4PVTA 4BZ3A 3ZWFA 3BV6A 4D1VA 4RAMA 5AEBA 2WYMA 4C1FA 2YNVB 3IE2A 1JJEA 4F6ZA 5ACRA 1DDKA 2YNTA 3SD9A 1VMEA 1JT1A 1KR3A 3ZNBA 4J5FA 5EV6A 5EWAA 3X2ZA 3IDZA 1WRAA 3BK2A 4CHLA 5LSCA 3SW3A 4C1DA 3Q6VA 4EYFA 4ZO3A 1SMLA 2NXAA 1QH5A 2WYLA 4KEQA 4TZEA 5EVDA 1L9YA 5ACXA 3IELA 3MD7A 5A5ZA 3PG4A 2BFZA 4RM5A 5IQKA 5ACTA 2BFKA 4YSBA 3I11A 3PY5A 4FR7A 3RKJA 2ZO4A 3FAIA 1BMCA 3TP9A 2NYPA 2WYMC 3X2YA 3IOGA 2FHXA 3SBLA 2BG6A 5LCAA 3G1PA 4RAWA 5ACQA 3ESHA 4TZFA 4UBQA 2Q42A 3I13A 4YSKA 3BC2A 2OHIA 4UA4A 2I7VA 2BFZB 2OHHA 4KEPA 2QJSA 1MQOA 1ZKPA 4TZBA 2BFLA 2BG8A 4EXYA 3SPUA 4HL2A 3AJ3A 4C1HA 4AWYB 4NQ4A 2FHXB 3I0VA 3R2UA 4F6HA 3PY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EYL A;  1DD6 A;  2YCB A;  4TZ9 A;  2WRS A;  5ACS A;  2A7M A;  4D02 A;  1WW1 A;  5ACW A;  2Q9U A;  5K4K A;  3ZQ4 A;  4C1C A;  1A7T A;  2QDS A;  3IE0 A;  2QDT A;  4BP0 A;  1A8T A;  1YCH A;  4EY2 A;  1X8I A;  2BG2 A;  2BG8 B;  4NQ6 A;  4J5H A;  5HIP A;  5FQC A;  3AF5 A;  3BK1 A;  3VQZ A;  1VGN A;  1ZTC A;  2GKL A;  4RL2 A;  5KIL A;  4TYT A;  2FU9 A;  5LCF A;  4XWT A;  2M5C A;  5EVB A;  1M2X A;  4AX0 B;  2XF4 A;  3P2U A;  4RBS A;  2GFJ A;  3F9O A;  4Z5Z A;  4YSL A;  3I15 A;  2DKF A;  5HIQ A;  3S0Z A;  4D1T A;  5EH9 A;  2YNT B;  4PVO A;  5AXR A;  5DPX A;  4DIK A;  2ZZI A;  4UWS B;  1X8H A;  4HL1 A;  1XM8 A;  3A4Y A;  5LMC A;  5HH5 A;  5B1U A;  2BR6 A;  2CBN A;  2GCU A;  3X2X A;  4DIL A;  5A87 A;  3IE1 A;  5HH6 A;  2ZWR A;  4HKY A;  3I14 A;  5AHO A;  4UWP B;  2FM6 A;  1WUP A;  1QH3 A;  2M5D A;  5EW0 A;  2VW8 A;  4AX1 B;  5LE1 A;  2QIN A;  5HIO A;  4O98 A;  4FEK A;  1XTO A;  3RPC A;  5ACP A;  5ACV A;  3JXP A;  2FU8 A;  3IEK A;  5LCH A;  5K0W A;  4GCW A;  3H3E A;  5HIS A;  5FQB A;  5EV8 A;  3T3N A;  4Z7R A;  2P1E A;  2GFK A;  5B3R A;  2P97 A;  5B15 A;  4Z6X A;  4ZNB A;  4C1G A;  3IOF A;  5LLD A;  2QED A;  4NQ2 A;  2FU7 A;  3DH8 A;  4RL0 A;  2R2D A;  2I7T A;  5LM6 A;  1X8G A;  5ACU A;  2FU6 A;  1KO3 A;  3SFP A;  2WHG A;  3FCZ A;  4FSB A;  1K07 A;  5K4M A;  1BC2 A;  1ZNB A;  5AYA A;  4TYF A;  5A0T A;  5LS3 A;  1KO2 A;  2Q0J A;  4Z67 A;  4H0D A;  4V0H A;  2DOO A;  3T9M A;  4UWR B;  4EYB A;  2NZF A;  4D1W A;  3DHB A;  2E7Y A;  5HH4 A;  4AD9 A;  3T3O A;  4UAM A;  4U4L A;  4ZEJ A;  3VPE A;  2BIB A;  5AHR A;  4UWO B;  2BGA A;  5FQA A;  2FK6 A;  1DXK A;  4XUK A;  4LE6 A;  4D1U A;  2P4Z A;  3X30 A;  3DHA A;  2YNU A;  1VJN A;  2NZE A;  4C1E A;  3AF6 A;  4WD6 A;  4Z60 A;  3DHC A;  4B87 A;  5EHT A;  3RKK A;  3ZR9 A;  3SRX A;  3ADR A;  4P62 A;  3KNS A;  2YZ3 A;  3IEM A;  3LVZ A;  4Z5Y A;  4NQ5 A;  2Q0I A;  1JJT A;  3L6N A;  2Y87 A;  1WUO A;  2AIO A;  2AZ4 A;  2BC2 A;  5AXO A;  2YNV A;  4AWZ A;  4ZO2 A;  2UYX A;  4EFZ A;  4JO0 A;  2ZNB A;  4GYQ A;  4GYU A;  5K4N A;  5KIK A;  3KL7 A;  5A0V A;  3KNR A;  3WXC A;  1YCF A;  4XWW A;  1P9E A;  2Y8B A;  4EXS A;  2YNW A;  4C09 A;  2OHJ A;  1HLK A;  2P18 A;  1E5D A;  2Y8A A;  1BVT A;  2HB9 A;  2BTN A;  5EVK A;  1YCG A;  1Y44 A;  2I7X A;  2BG7 A;  2H6A A;  3QH8 A;  2BMI A;  2GMN A;  2XR1 A;  4PVT A;  4BZ3 A;  3ZWF A;  3BV6 A;  4D1V A;  4RAM A;  5AEB A;  2WYM A;  4C1F A;  2YNV B;  3IE2 A;  1JJE A;  4F6Z A;  5ACR A;  1DDK A;  2YNT A;  3SD9 A;  1VME A;  1JT1 A;  1KR3 A;  3ZNB A;  4J5F A;  5EV6 A;  5EWA A;  3X2Z A;  3IDZ A;  1WRA A;  3BK2 A;  4CHL A;  5LSC A;  3SW3 A;  4C1D A;  3Q6V A;  4EYF A;  4ZO3 A;  1SML A;  2NXA A;  1QH5 A;  2WYL A;  4KEQ A;  4TZE A;  5EVD A;  1L9Y A;  5ACX A;  3IEL A;  3MD7 A;  5A5Z A;  3PG4 A;  2BFZ A;  4RM5 A;  5IQK A;  5ACT A;  2BFK A;  4YSB A;  3I11 A;  3PY5 A;  4FR7 A;  3RKJ A;  2ZO4 A;  3FAI A;  1BMC A;  3TP9 A;  2NYP A;  2WYM C;  3X2Y A;  3IOG A;  2FHX A;  3SBL A;  2BG6 A;  5LCA A;  3G1P A;  4RAW A;  5ACQ A;  3ESH A;  4TZF A;  4UBQ A;  2Q42 A;  3I13 A;  4YSK A;  3BC2 A;  2OHI A;  4UA4 A;  2I7V A;  2BFZ B;  2OHH A;  4KEP A;  2QJS A;  1MQO A;  1ZKP A;  4TZB A;  2BFL A;  2BG8 A;  4EXY A;  3SPU A;  4HL2 A;  3AJ3 A;  4C1H A;  4AWY B;  4NQ4 A;  2FHX B;  3I0V A;  3R2U A;  4F6H A;  3PY6 A; 
#chains in the Genus database with same CATH topology
 4EYL A;  1DD6 A;  2YCB A;  4TZ9 A;  2WRS A;  5ACS A;  2A7M A;  4D02 A;  1WW1 A;  5ACW A;  2Q9U A;  5K4K A;  3ZQ4 A;  4C1C A;  1A7T A;  2QDS A;  3IE0 A;  2QDT A;  4BP0 A;  1A8T A;  1YCH A;  4EY2 A;  1X8I A;  2BG2 A;  2BG8 B;  4NQ6 A;  4J5H A;  5HIP A;  5FQC A;  3AF5 A;  3BK1 A;  3VQZ A;  1VGN A;  1ZTC A;  2GKL A;  4RL2 A;  5KIL A;  4TYT A;  2FU9 A;  4XWT A;  5LCF A;  2M5C A;  5EVB A;  1M2X A;  4AX0 B;  2XF4 A;  3P2U A;  4RBS A;  2GFJ A;  4PDX A;  3F9O A;  4Z5Z A;  4YSL A;  3I15 A;  2DKF A;  5HIQ A;  3S0Z A;  4D1T A;  5EH9 A;  2YNT B;  4PVO A;  5AXR A;  5DPX A;  4DIK A;  2ZZI A;  4UWS B;  1X8H A;  4HL1 A;  1XM8 A;  3A4Y A;  5LMC A;  5HH5 A;  5B1U A;  2BR6 A;  2CBN A;  2GCU A;  3X2X A;  4DIL A;  5A87 A;  3IE1 A;  5HH6 A;  2ZWR A;  4HKY A;  3I14 A;  5AHO A;  4UWP B;  2FM6 A;  4NUR A;  1WUP A;  1QH3 A;  2M5D A;  5EW0 A;  2VW8 A;  4AX1 B;  5LE1 A;  2QIN A;  5HIO A;  4O98 A;  4FEK A;  1XTO A;  3RPC A;  2YHE A;  5ACP A;  5ACV A;  3JXP A;  2CG3 A;  2FU8 A;  3IEK A;  5LCH A;  5K0W A;  4GCW A;  3H3E A;  5HIS A;  5FQB A;  5EV8 A;  2CFU A;  3T3N A;  4Z7R A;  2P1E A;  2GFK A;  5B3R A;  2P97 A;  5A23 A;  5B15 A;  4Z6X A;  4ZNB A;  4C1G A;  3IOF A;  5AJL A;  5LLD A;  2QED A;  4NQ2 A;  2FU7 A;  3DH8 A;  4RL0 A;  2R2D A;  2I7T A;  5LM6 A;  1X8G A;  5ACU A;  2FU6 A;  1KO3 A;  3SFP A;  2WHG A;  3FCZ A;  4FSB A;  1K07 A;  5K4M A;  1BC2 A;  1ZNB A;  5AYA A;  4TYF A;  5A0T A;  5LS3 A;  1KO2 A;  2Q0J A;  4Z67 A;  4H0D A;  4V0H A;  2DOO A;  3T9M A;  4UWR B;  4EYB A;  2NZF A;  4D1W A;  3DHB A;  2E7Y A;  5HH4 A;  4AD9 A;  3T3O A;  4UAM A;  4U4L A;  4ZEJ A;  3VPE A;  2BIB A;  5AHR A;  4UWO B;  2BGA A;  5FQA A;  2FK6 A;  1DXK A;  4XUK A;  4LE6 A;  4D1U A;  2P4Z A;  3X30 A;  3DHA A;  2YNU A;  1VJN A;  2NZE A;  4C1E A;  3AF6 A;  4WD6 A;  4Z60 A;  3DHC A;  4B87 A;  5EHT A;  3RKK A;  3ZR9 A;  3SRX A;  3ADR A;  4P62 A;  3KNS A;  2YZ3 A;  3IEM A;  3LVZ A;  4Z5Y A;  4NQ5 A;  2Q0I A;  1JJT A;  3L6N A;  2Y87 A;  1WUO A;  2AIO A;  2AZ4 A;  2BC2 A;  2CG2 A;  5AXO A;  4AV7 A;  2YNV A;  4AWZ A;  4ZO2 A;  2UYX A;  4EFZ A;  4JO0 A;  2ZNB A;  4GYQ A;  4GYU A;  5K4N A;  5KIK A;  3KL7 A;  5A0V A;  3KNR A;  3WXC A;  1YCF A;  4XWW A;  5AIJ A;  1P9E A;  2Y8B A;  4EXS A;  2YNW A;  4C09 A;  2OHJ A;  1HLK A;  2P18 A;  1E5D A;  2Y8A A;  1BVT A;  2HB9 A;  2BTN A;  5EVK A;  1YCG A;  1Y44 A;  2I7X A;  2BG7 A;  2H6A A;  3QH8 A;  2BMI A;  2GMN A;  2XR1 A;  4PVT A;  4BZ3 A;  3ZWF A;  3BV6 A;  4D1V A;  4RAM A;  5AEB A;  2WYM A;  4C1F A;  2YNV B;  3IE2 A;  1JJE A;  4F6Z A;  5ACR A;  1DDK A;  2YNT A;  3SD9 A;  1VME A;  1JT1 A;  1KR3 A;  3ZNB A;  4J5F A;  5EV6 A;  5EWA A;  3X2Z A;  3IDZ A;  1WRA A;  3BK2 A;  4CHL A;  5LSC A;  3SW3 A;  4C1D A;  3Q6V A;  4EYF A;  4ZO3 A;  1SML A;  2NXA A;  1QH5 A;  2WYL A;  4KEQ A;  4TZE A;  5EVD A;  1L9Y A;  5ACX A;  3IEL A;  3MD7 A;  5A5Z A;  3PG4 A;  2BFZ A;  4RM5 A;  5IQK A;  5ACT A;  2BFK A;  4YSB A;  3I11 A;  3PY5 A;  4FR7 A;  3RKJ A;  2ZO4 A;  3FAI A;  1BMC A;  3TP9 A;  2NYP A;  2WYM C;  3X2Y A;  3IOG A;  2FHX A;  3SBL A;  2BG6 A;  5LCA A;  3G1P A;  4RAW A;  5ACQ A;  3ESH A;  4TZF A;  4UBQ A;  2Q42 A;  3I13 A;  4YSK A;  3BC2 A;  2CFZ A;  2OHI A;  4UA4 A;  2I7V A;  2BFZ B;  2OHH A;  4KEP A;  2QJS A;  1MQO A;  1ZKP A;  4TZB A;  2BFL A;  2BG8 A;  4EXY A;  3SPU A;  4HL2 A;  3AJ3 A;  4C1H A;  4AWY B;  4AXH A;  4NQ4 A;  2FHX B;  3I0V A;  3R2U A;  4F6H A;  3PY6 A; 
#chains in the Genus database with same CATH homology
 4EYL A;  1DD6 A;  2YCB A;  4TZ9 A;  2WRS A;  5ACS A;  2A7M A;  4D02 A;  1WW1 A;  5ACW A;  2Q9U A;  5K4K A;  3ZQ4 A;  4C1C A;  1A7T A;  2QDS A;  3IE0 A;  2QDT A;  4BP0 A;  1A8T A;  1YCH A;  4EY2 A;  1X8I A;  2BG2 A;  2BG8 B;  4NQ6 A;  4J5H A;  5HIP A;  5FQC A;  3AF5 A;  3BK1 A;  3VQZ A;  1VGN A;  1ZTC A;  2GKL A;  4RL2 A;  5KIL A;  4TYT A;  2FU9 A;  5LCF A;  4XWT A;  2M5C A;  5EVB A;  1M2X A;  4AX0 B;  2XF4 A;  3P2U A;  4RBS A;  2GFJ A;  3F9O A;  4Z5Z A;  4YSL A;  3I15 A;  2DKF A;  5HIQ A;  3S0Z A;  4D1T A;  5EH9 A;  2YNT B;  4PVO A;  5AXR A;  5DPX A;  4DIK A;  2ZZI A;  4UWS B;  1X8H A;  4HL1 A;  1XM8 A;  3A4Y A;  5LMC A;  5HH5 A;  5B1U A;  2BR6 A;  2CBN A;  2GCU A;  3X2X A;  4DIL A;  5A87 A;  3IE1 A;  5HH6 A;  2ZWR A;  4HKY A;  3I14 A;  5AHO A;  4UWP B;  2FM6 A;  1WUP A;  1QH3 A;  2M5D A;  5EW0 A;  2VW8 A;  4AX1 B;  5LE1 A;  2QIN A;  5HIO A;  4O98 A;  4FEK A;  1XTO A;  3RPC A;  5ACP A;  5ACV A;  3JXP A;  2FU8 A;  3IEK A;  5LCH A;  5K0W A;  4GCW A;  3H3E A;  5HIS A;  5FQB A;  5EV8 A;  3T3N A;  4Z7R A;  2P1E A;  2GFK A;  5B3R A;  2P97 A;  5B15 A;  4Z6X A;  4ZNB A;  4C1G A;  3IOF A;  5LLD A;  2QED A;  4NQ2 A;  2FU7 A;  3DH8 A;  4RL0 A;  2R2D A;  2I7T A;  5LM6 A;  1X8G A;  5ACU A;  2FU6 A;  1KO3 A;  3SFP A;  2WHG A;  3FCZ A;  4FSB A;  1K07 A;  5K4M A;  1BC2 A;  1ZNB A;  5AYA A;  4TYF A;  5A0T A;  5LS3 A;  1KO2 A;  2Q0J A;  4Z67 A;  4H0D A;  4V0H A;  2DOO A;  3T9M A;  4UWR B;  4EYB A;  2NZF A;  4D1W A;  3DHB A;  2E7Y A;  5HH4 A;  4AD9 A;  3T3O A;  4UAM A;  4U4L A;  4ZEJ A;  3VPE A;  2BIB A;  5AHR A;  4UWO B;  2BGA A;  5FQA A;  2FK6 A;  1DXK A;  4XUK A;  4LE6 A;  4D1U A;  2P4Z A;  3X30 A;  3DHA A;  2YNU A;  1VJN A;  2NZE A;  4C1E A;  3AF6 A;  4WD6 A;  4Z60 A;  3DHC A;  4B87 A;  5EHT A;  3RKK A;  3ZR9 A;  3SRX A;  3ADR A;  4P62 A;  3KNS A;  2YZ3 A;  3IEM A;  3LVZ A;  4Z5Y A;  4NQ5 A;  2Q0I A;  1JJT A;  3L6N A;  2Y87 A;  1WUO A;  2AIO A;  2AZ4 A;  2BC2 A;  5AXO A;  2YNV A;  4AWZ A;  4ZO2 A;  2UYX A;  4EFZ A;  4JO0 A;  2ZNB A;  4GYQ A;  4GYU A;  5K4N A;  5KIK A;  3KL7 A;  5A0V A;  3KNR A;  3WXC A;  1YCF A;  4XWW A;  1P9E A;  2Y8B A;  4EXS A;  2YNW A;  4C09 A;  2OHJ A;  1HLK A;  2P18 A;  1E5D A;  2Y8A A;  1BVT A;  2HB9 A;  2BTN A;  5EVK A;  1YCG A;  1Y44 A;  2I7X A;  2BG7 A;  2H6A A;  3QH8 A;  2BMI A;  2GMN A;  2XR1 A;  4PVT A;  4BZ3 A;  3ZWF A;  3BV6 A;  4D1V A;  4RAM A;  5AEB A;  2WYM A;  4C1F A;  2YNV B;  3IE2 A;  1JJE A;  4F6Z A;  5ACR A;  1DDK A;  2YNT A;  3SD9 A;  1VME A;  1JT1 A;  1KR3 A;  3ZNB A;  4J5F A;  5EV6 A;  5EWA A;  3X2Z A;  3IDZ A;  1WRA A;  3BK2 A;  4CHL A;  5LSC A;  3SW3 A;  4C1D A;  3Q6V A;  4EYF A;  4ZO3 A;  1SML A;  2NXA A;  1QH5 A;  2WYL A;  4KEQ A;  4TZE A;  5EVD A;  1L9Y A;  5ACX A;  3IEL A;  3MD7 A;  5A5Z A;  3PG4 A;  2BFZ A;  4RM5 A;  5IQK A;  5ACT A;  2BFK A;  4YSB A;  3I11 A;  3PY5 A;  4FR7 A;  3RKJ A;  2ZO4 A;  3FAI A;  1BMC A;  3TP9 A;  2NYP A;  2WYM C;  3X2Y A;  3IOG A;  2FHX A;  3SBL A;  2BG6 A;  5LCA A;  3G1P A;  4RAW A;  5ACQ A;  3ESH A;  4TZF A;  4UBQ A;  2Q42 A;  3I13 A;  4YSK A;  3BC2 A;  2OHI A;  4UA4 A;  2I7V A;  2BFZ B;  2OHH A;  4KEP A;  2QJS A;  1MQO A;  1ZKP A;  4TZB A;  2BFL A;  2BG8 A;  4EXY A;  3SPU A;  4HL2 A;  3AJ3 A;  4C1H A;  4AWY B;  4NQ4 A;  2FHX B;  3I0V A;  3R2U A;  4F6H A;  3PY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...