5AEBA

Crystal structure of the class b3 di-zinc metallo-beta-lactamase lra- 12 from an alaskan soil metagenome.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
264
structure length
264
Chain Sequence
b'VKEPTVSNADWSKPYRPFRIAGNLYYIGTYDLACYLITTKQGNIIVNTGLAASALQIKNNIKALGFKLTDTKILLTTQAHYDHLGAMAEIKKITGAKLMADEGDATVMADGGSSDYAFGGHGSMFEPIIADRLLHDKDTIQLGDTKLVMLHHPGHTKGSCSFLFDTKDEQRSYRILIANMPTIVIEKKFSEVSSYPGIAKDYAYTLQAMKNLSFDIWVASHASQFSMHSKHKPGDGYNPKSFMDRKGYDESLDKLQKEYEKHLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LRA-12
publication title Crystal structure and kinetic analysis of the class B3 di-zinc metallo-beta-lactamase LRA-12 from an Alaskan soil metagenome.
pubmed doi rcsb
molecule tags Hydrolase
total genus 85
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5aebA00
4EYBA 4PVTA 3PG4A 5AXRA 2M5DA 3LVZA 5LCAA 5B15A 3WXCA 2I7VA 4EXYA 3H3EA 3IELA 5FQCA 1YCFA 2BTNA 4KEPA 3X2YA 4AWZA 4D1TA 1A8TA 2ZWRA 4RAWA 4FEKA 5LCFA 4AWYB 4UAMA 1VMEA 4RM5A 3BV6A 2BFZA 5HIQA 3MD7A 2FU9A 2WYLA 4AD9A 4FR7A 1P9EA 4D1VA 3T3NA 5B3RA 2Y8AA 4HL1A 4DILA 4TYTA 3PY5A 3T3OA 4D02A 4GYUA 1KR3A 4YSBA 3BC2A 2OHIA 5AYAA 3DHAA 3X30A 2BG8A 1KO3A 5EV8A 5EVDA 2YNWA 4UWSB 2Q42A 5LS3A 3SW3A 4TYFA 2OHHA 4BZ3A 3IEKA 1K07A 1ZNBA 2WHGA 1VGNA 2GFJA 2NXAA 1XTOA 1DXKA 3SFPA 1VJNA 3X2XA 3SD9A 2H6AA 5ACRA 5A0VA 5ACPA 4P62A 4ZO2A 2BMIA 2WYMC 4C1HA 5A0TA 2ZNBA 1JJEA 2YNVB 3I14A 1QH3A 2XF4A 3FCZA 3KNRA 4UA4A 4WD6A 4D1UA 3AF6A 4NQ5A 3SRXA 2YCBA 5EHTA 4F6HA 1QH5A 5HH6A 4C1DA 5LCHA 1Y44A 4EY2A 1E5DA 2GCUA 4TZEA 2OHJA 2A7MA 2FHXA 5K0WA 2NZFA 2BR6A 2BFKA 4ZO3A 4J5HA 5HIOA 2FM6A 4ZEJA 3PY6A 5AHRA 1L9YA 1ZTCA 4RL2A 1X8HA 4NQ2A 4C09A 2YNUA 5ACUA 2DOOA 1WRAA 5K4KA 1DD6A 1HLKA 5K4MA 3IE2A 2ZZIA 4H0DA 2AIOA 5K4NA 3JXPA 4TZ9A 2Q0IA 2BG2A 4UWPB 3AJ3A 4YSKA 2BIBA 3A4YA 2QDTA 1A7TA 3BK1A 3TP9A 4RAMA 2NZEA 5A87A 4XWWA 4UWRB 4Z5ZA 5ACQA 4DIKA 3VQZA 2Y8BA 3ZNBA 1BVTA 2R2DA 3QH8A 3IEMA 1JT1A 3I0VA 1JJTA 3IOGA 2YNTB 2BC2A 2P4ZA 2P18A 1WUPA 2E7YA 1KO2A 3I13A 2WRSA 4LE6A 2GKLA 2QDSA 5KIKA 2ZO4A 2Q0JA 5LM6A 4EXSA 2FK6A 4Z67A 4HL2A 2HB9A 4Z7RA 1BMCA 4UWOB 2FU6A 3IE1A 5LLDA 4B87A 2GFKA 3DH8A 3KNSA 4Z60A 2CBNA 2YNVA 4AX1B 5EVKA 3R2UA 3AF5A 2QEDA 5ACVA 4TZFA 2Q9UA 2FU8A 2QJSA 2BGAA 3S0ZA 2BG6A 1WUOA 4XUKA 5EV6A 5EW0A 5ACWA 2GMNA 4CHLA 2WYMA 3FAIA 4V0HA 3RPCA 5ACXA 5ACSA 3P2UA 1WW1A 4NQ6A 5ACTA 1YCGA 5HH4A 4YSLA 5EH9A 2BFZB 4O98A 2BG7A 3Q6VA 1SMLA 1M2XA 4ZNBA 3DHCA 3IE0A 3ZR9A 4GYQA 3ZQ4A 4RL0A 4Z6XA 4EYFA 3F9OA 2DKFA 5LMCA 3L6NA 4Z5YA 5HIPA 3SPUA 3I15A 2YZ3A 3ZWFA 4C1GA 5IQKA 2M5CA 2BG8B 3X2ZA 4F6ZA 3G1PA 3SBLA 5EVBA 5A5ZA 3KL7A 1YCHA 3DHBA 4C1CA 3I11A 4EFZA 5AHOA 4KEQA 4UBQA 5HH5A 5HISA 3T9MA 3ADRA 5LSCA 2VW8A 3RKKA 1ZKPA 4D1WA 4XWTA 2YNTA 2Y87A 2QINA 2I7XA 5AXOA 3VPEA 4BP0A 4U4LA 5EWAA 4NQ4A 4TZBA 2XR1A 1X8IA 1XM8A 3BK2A 2BFLA 4RBSA 4HKYA 3IDZA 2FU7A 2UYXA 5FQBA 4AX0B 4JO0A 2P97A 4PVOA 3IOFA 2FHXB 4GCWA 5KILA 4C1FA 5DPXA 5LE1A 5AEBA 3RKJA 2NYPA 5FQAA 2AZ4A 4EYLA 1DDKA 4C1EA 2I7TA 1MQOA 4J5FA 5B1UA 3ESHA 1X8GA 1BC2A 2P1EA 4FSBA
chains in the Genus database with same CATH superfamily
4EYBA 4PVTA 3PG4A 5AXRA 2M5DA 3LVZA 5LCAA 5B15A 3WXCA 2I7VA 2CG3A 4EXYA 3H3EA 3IELA 5FQCA 1YCFA 2BTNA 4KEPA 3X2YA 4AWZA 4D1TA 1A8TA 2ZWRA 5A23A 4RAWA 4FEKA 5LCFA 4AWYB 4UAMA 1VMEA 4RM5A 3BV6A 2BFZA 5HIQA 3MD7A 2FU9A 2WYLA 4AD9A 4FR7A 1P9EA 4D1VA 3T3NA 5B3RA 2Y8AA 4HL1A 4DILA 4AV7A 4TYTA 3PY5A 3T3OA 4D02A 4GYUA 1KR3A 4YSBA 3BC2A 2OHIA 5AYAA 3DHAA 3X30A 2BG8A 1KO3A 5EV8A 5EVDA 2YNWA 4UWSB 2Q42A 5LS3A 3SW3A 4TYFA 2OHHA 4BZ3A 3IEKA 1K07A 1ZNBA 2WHGA 1VGNA 2GFJA 2NXAA 2CFUA 1XTOA 1DXKA 3SFPA 1VJNA 3X2XA 3SD9A 2H6AA 5ACRA 5A0VA 5ACPA 4P62A 4ZO2A 2BMIA 2WYMC 4C1HA 5A0TA 2ZNBA 1JJEA 2YNVB 3I14A 1QH3A 2XF4A 3FCZA 3KNRA 4UA4A 4WD6A 4D1UA 3AF6A 4NQ5A 3SRXA 2CG2A 2YCBA 5EHTA 4F6HA 1QH5A 5HH6A 4C1DA 5LCHA 1Y44A 4EY2A 1E5DA 2GCUA 4TZEA 2OHJA 2A7MA 2FHXA 5K0WA 2NZFA 2BR6A 2BFKA 4ZO3A 4J5HA 2CFZA 5HIOA 2FM6A 4ZEJA 3PY6A 5AHRA 1L9YA 1ZTCA 4RL2A 1X8HA 4NQ2A 4C09A 4NURA 2YNUA 5ACUA 2DOOA 1WRAA 5K4KA 1DD6A 1HLKA 5K4MA 3IE2A 2ZZIA 4H0DA 2AIOA 5K4NA 3JXPA 4TZ9A 2Q0IA 2BG2A 4UWPB 3AJ3A 4YSKA 2BIBA 3A4YA 2QDTA 1A7TA 3BK1A 3TP9A 4RAMA 2NZEA 5A87A 4XWWA 4UWRB 4Z5ZA 5ACQA 4DIKA 3VQZA 2Y8BA 3ZNBA 1BVTA 2R2DA 3QH8A 3IEMA 1JT1A 3I0VA 1JJTA 3IOGA 2YNTB 2BC2A 2P4ZA 2P18A 1WUPA 2E7YA 1KO2A 3I13A 2WRSA 4LE6A 2GKLA 2QDSA 5KIKA 2ZO4A 2Q0JA 5LM6A 4EXSA 2FK6A 4Z67A 4HL2A 2HB9A 4Z7RA 1BMCA 4UWOB 2FU6A 3IE1A 5LLDA 4B87A 2GFKA 3DH8A 3KNSA 4Z60A 2CBNA 2YNVA 4AX1B 5EVKA 3R2UA 3AF5A 2QEDA 5ACVA 4TZFA 2Q9UA 2FU8A 2QJSA 2BGAA 3S0ZA 2BG6A 1WUOA 4XUKA 5EV6A 5EW0A 5ACWA 2GMNA 4CHLA 2WYMA 3FAIA 4V0HA 3RPCA 5ACXA 5ACSA 3P2UA 1WW1A 4NQ6A 5ACTA 1YCGA 5HH4A 4YSLA 5EH9A 2BFZB 4O98A 2BG7A 3Q6VA 1SMLA 1M2XA 4ZNBA 3DHCA 3IE0A 3ZR9A 4GYQA 3ZQ4A 4RL0A 4Z6XA 4EYFA 3F9OA 2DKFA 5LMCA 3L6NA 4Z5YA 5HIPA 3SPUA 3I15A 2YZ3A 3ZWFA 4C1GA 5IQKA 2M5CA 2BG8B 3X2ZA 4F6ZA 3G1PA 3SBLA 5EVBA 5A5ZA 3KL7A 1YCHA 5AIJA 3DHBA 4C1CA 3I11A 4EFZA 5AJLA 5AHOA 4KEQA 4UBQA 5HH5A 5HISA 3T9MA 3ADRA 5LSCA 2VW8A 3RKKA 1ZKPA 4D1WA 4XWTA 2YNTA 2Y87A 2QINA 2I7XA 5AXOA 3VPEA 4BP0A 4U4LA 5EWAA 4NQ4A 2YHEA 4TZBA 4AXHA 2XR1A 1X8IA 1XM8A 3BK2A 2BFLA 4RBSA 4HKYA 3IDZA 2FU7A 2UYXA 5FQBA 4AX0B 4JO0A 2P97A 4PVOA 3IOFA 2FHXB 4GCWA 5KILA 4C1FA 4PDXA 5DPXA 5LE1A 5AEBA 3RKJA 2NYPA 5FQAA 2AZ4A 4EYLA 1DDKA 4C1EA 2I7TA 1MQOA 4J5FA 5B1UA 3ESHA 1X8GA 1BC2A 2P1EA 4FSBA
chains in the Genus database with same CATH topology
4EYBA 4PVTA 3PG4A 5AXRA 2M5DA 3LVZA 5LCAA 5B15A 3WXCA 2I7VA 4EXYA 3H3EA 3IELA 5FQCA 1YCFA 2BTNA 4KEPA 3X2YA 4AWZA 4D1TA 1A8TA 2ZWRA 4RAWA 4FEKA 5LCFA 4AWYB 4UAMA 1VMEA 4RM5A 3BV6A 2BFZA 5HIQA 3MD7A 2FU9A 2WYLA 4AD9A 4FR7A 1P9EA 4D1VA 3T3NA 5B3RA 2Y8AA 4HL1A 4DILA 4TYTA 3PY5A 3T3OA 4D02A 4GYUA 1KR3A 4YSBA 3BC2A 2OHIA 5AYAA 3DHAA 3X30A 2BG8A 1KO3A 5EV8A 5EVDA 2YNWA 4UWSB 2Q42A 5LS3A 3SW3A 4TYFA 2OHHA 4BZ3A 3IEKA 1K07A 1ZNBA 2WHGA 1VGNA 2GFJA 2NXAA 1XTOA 1DXKA 3SFPA 1VJNA 3X2XA 3SD9A 2H6AA 5ACRA 5A0VA 5ACPA 4P62A 4ZO2A 2BMIA 2WYMC 4C1HA 5A0TA 2ZNBA 1JJEA 2YNVB 3I14A 1QH3A 2XF4A 3FCZA 3KNRA 4UA4A 4WD6A 4D1UA 3AF6A 4NQ5A 3SRXA 2YCBA 5EHTA 4F6HA 1QH5A 5HH6A 4C1DA 5LCHA 1Y44A 4EY2A 1E5DA 2GCUA 4TZEA 2OHJA 2A7MA 2FHXA 5K0WA 2NZFA 2BR6A 2BFKA 4ZO3A 4J5HA 5HIOA 2FM6A 4ZEJA 3PY6A 5AHRA 1L9YA 1ZTCA 4RL2A 1X8HA 4NQ2A 4C09A 2YNUA 5ACUA 2DOOA 1WRAA 5K4KA 1DD6A 1HLKA 5K4MA 3IE2A 2ZZIA 4H0DA 2AIOA 5K4NA 3JXPA 4TZ9A 2Q0IA 2BG2A 4UWPB 3AJ3A 4YSKA 2BIBA 3A4YA 2QDTA 1A7TA 3BK1A 3TP9A 4RAMA 2NZEA 5A87A 4XWWA 4UWRB 4Z5ZA 5ACQA 4DIKA 3VQZA 2Y8BA 3ZNBA 1BVTA 2R2DA 3QH8A 3IEMA 1JT1A 3I0VA 1JJTA 3IOGA 2YNTB 2BC2A 2P4ZA 2P18A 1WUPA 2E7YA 1KO2A 3I13A 2WRSA 4LE6A 2GKLA 2QDSA 5KIKA 2ZO4A 2Q0JA 5LM6A 4EXSA 2FK6A 4Z67A 4HL2A 2HB9A 4Z7RA 1BMCA 4UWOB 2FU6A 3IE1A 5LLDA 4B87A 2GFKA 3DH8A 3KNSA 4Z60A 2CBNA 2YNVA 4AX1B 5EVKA 3R2UA 3AF5A 2QEDA 5ACVA 4TZFA 2Q9UA 2FU8A 2QJSA 2BGAA 3S0ZA 2BG6A 1WUOA 4XUKA 5EV6A 5EW0A 5ACWA 2GMNA 4CHLA 2WYMA 3FAIA 4V0HA 3RPCA 5ACXA 5ACSA 3P2UA 1WW1A 4NQ6A 5ACTA 1YCGA 5HH4A 4YSLA 5EH9A 2BFZB 4O98A 2BG7A 3Q6VA 1SMLA 1M2XA 4ZNBA 3DHCA 3IE0A 3ZR9A 4GYQA 3ZQ4A 4RL0A 4Z6XA 4EYFA 3F9OA 2DKFA 5LMCA 3L6NA 4Z5YA 5HIPA 3SPUA 3I15A 2YZ3A 3ZWFA 4C1GA 5IQKA 2M5CA 2BG8B 3X2ZA 4F6ZA 3G1PA 3SBLA 5EVBA 5A5ZA 3KL7A 1YCHA 3DHBA 4C1CA 3I11A 4EFZA 5AHOA 4KEQA 4UBQA 5HH5A 5HISA 3T9MA 3ADRA 5LSCA 2VW8A 3RKKA 1ZKPA 4D1WA 4XWTA 2YNTA 2Y87A 2QINA 2I7XA 5AXOA 3VPEA 4BP0A 4U4LA 5EWAA 4NQ4A 4TZBA 2XR1A 1X8IA 1XM8A 3BK2A 2BFLA 4RBSA 4HKYA 3IDZA 2FU7A 2UYXA 5FQBA 4AX0B 4JO0A 2P97A 4PVOA 3IOFA 2FHXB 4GCWA 5KILA 4C1FA 5DPXA 5LE1A 5AEBA 3RKJA 2NYPA 5FQAA 2AZ4A 4EYLA 1DDKA 4C1EA 2I7TA 1MQOA 4J5FA 5B1UA 3ESHA 1X8GA 1BC2A 2P1EA 4FSBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EYB A;  4PVT A;  3PG4 A;  5AXR A;  2M5D A;  3LVZ A;  5LCA A;  5B15 A;  3WXC A;  2I7V A;  4EXY A;  3H3E A;  3IEL A;  5FQC A;  1YCF A;  2BTN A;  4KEP A;  3X2Y A;  4AWZ A;  4D1T A;  1A8T A;  2ZWR A;  4RAW A;  4FEK A;  5LCF A;  4AWY B;  4UAM A;  1VME A;  4RM5 A;  3BV6 A;  2BFZ A;  5HIQ A;  3MD7 A;  2FU9 A;  2WYL A;  4AD9 A;  4FR7 A;  1P9E A;  4D1V A;  3T3N A;  5B3R A;  2Y8A A;  4HL1 A;  4DIL A;  4TYT A;  3PY5 A;  3T3O A;  4D02 A;  4GYU A;  1KR3 A;  4YSB A;  3BC2 A;  2OHI A;  5AYA A;  3DHA A;  3X30 A;  2BG8 A;  1KO3 A;  5EV8 A;  5EVD A;  2YNW A;  4UWS B;  2Q42 A;  5LS3 A;  3SW3 A;  4TYF A;  2OHH A;  4BZ3 A;  3IEK A;  1K07 A;  1ZNB A;  2WHG A;  1VGN A;  2GFJ A;  2NXA A;  1XTO A;  1DXK A;  3SFP A;  1VJN A;  3X2X A;  3SD9 A;  2H6A A;  5ACR A;  5A0V A;  5ACP A;  4P62 A;  4ZO2 A;  2BMI A;  2WYM C;  4C1H A;  5A0T A;  2ZNB A;  1JJE A;  2YNV B;  3I14 A;  1QH3 A;  2XF4 A;  3FCZ A;  3KNR A;  4UA4 A;  4WD6 A;  4D1U A;  3AF6 A;  4NQ5 A;  3SRX A;  2YCB A;  5EHT A;  4F6H A;  1QH5 A;  5HH6 A;  4C1D A;  5LCH A;  1Y44 A;  4EY2 A;  1E5D A;  2GCU A;  4TZE A;  2OHJ A;  2A7M A;  2FHX A;  5K0W A;  2NZF A;  2BR6 A;  2BFK A;  4ZO3 A;  4J5H A;  5HIO A;  2FM6 A;  4ZEJ A;  3PY6 A;  5AHR A;  1L9Y A;  1ZTC A;  4RL2 A;  1X8H A;  4NQ2 A;  4C09 A;  2YNU A;  5ACU A;  2DOO A;  1WRA A;  5K4K A;  1DD6 A;  1HLK A;  5K4M A;  3IE2 A;  2ZZI A;  4H0D A;  2AIO A;  5K4N A;  3JXP A;  4TZ9 A;  2Q0I A;  2BG2 A;  4UWP B;  3AJ3 A;  4YSK A;  2BIB A;  3A4Y A;  2QDT A;  1A7T A;  3BK1 A;  3TP9 A;  4RAM A;  2NZE A;  5A87 A;  4XWW A;  4UWR B;  4Z5Z A;  5ACQ A;  4DIK A;  3VQZ A;  2Y8B A;  3ZNB A;  1BVT A;  2R2D A;  3QH8 A;  3IEM A;  1JT1 A;  3I0V A;  1JJT A;  3IOG A;  2YNT B;  2BC2 A;  2P4Z A;  2P18 A;  1WUP A;  2E7Y A;  1KO2 A;  3I13 A;  2WRS A;  4LE6 A;  2GKL A;  2QDS A;  5KIK A;  2ZO4 A;  2Q0J A;  5LM6 A;  4EXS A;  2FK6 A;  4Z67 A;  4HL2 A;  2HB9 A;  4Z7R A;  1BMC A;  4UWO B;  2FU6 A;  3IE1 A;  5LLD A;  4B87 A;  2GFK A;  3DH8 A;  3KNS A;  4Z60 A;  2CBN A;  2YNV A;  4AX1 B;  5EVK A;  3R2U A;  3AF5 A;  2QED A;  5ACV A;  4TZF A;  2Q9U A;  2FU8 A;  2QJS A;  2BGA A;  3S0Z A;  2BG6 A;  1WUO A;  4XUK A;  5EV6 A;  5EW0 A;  5ACW A;  2GMN A;  4CHL A;  2WYM A;  3FAI A;  4V0H A;  3RPC A;  5ACX A;  5ACS A;  3P2U A;  1WW1 A;  4NQ6 A;  5ACT A;  1YCG A;  5HH4 A;  4YSL A;  5EH9 A;  2BFZ B;  4O98 A;  2BG7 A;  3Q6V A;  1SML A;  1M2X A;  4ZNB A;  3DHC A;  3IE0 A;  3ZR9 A;  4GYQ A;  3ZQ4 A;  4RL0 A;  4Z6X A;  4EYF A;  3F9O A;  2DKF A;  5LMC A;  3L6N A;  4Z5Y A;  5HIP A;  3SPU A;  3I15 A;  2YZ3 A;  3ZWF A;  4C1G A;  5IQK A;  2M5C A;  2BG8 B;  3X2Z A;  4F6Z A;  3G1P A;  3SBL A;  5EVB A;  5A5Z A;  3KL7 A;  1YCH A;  3DHB A;  4C1C A;  3I11 A;  4EFZ A;  5AHO A;  4KEQ A;  4UBQ A;  5HH5 A;  5HIS A;  3T9M A;  3ADR A;  5LSC A;  2VW8 A;  3RKK A;  1ZKP A;  4D1W A;  4XWT A;  2YNT A;  2Y87 A;  2QIN A;  2I7X A;  5AXO A;  3VPE A;  4BP0 A;  4U4L A;  5EWA A;  4NQ4 A;  4TZB A;  2XR1 A;  1X8I A;  1XM8 A;  3BK2 A;  2BFL A;  4RBS A;  4HKY A;  3IDZ A;  2FU7 A;  2UYX A;  5FQB A;  4AX0 B;  4JO0 A;  2P97 A;  4PVO A;  3IOF A;  2FHX B;  4GCW A;  5KIL A;  4C1F A;  5DPX A;  5LE1 A;  5AEB A;  3RKJ A;  2NYP A;  5FQA A;  2AZ4 A;  4EYL A;  1DDK A;  4C1E A;  2I7T A;  1MQO A;  4J5F A;  5B1U A;  3ESH A;  1X8G A;  1BC2 A;  2P1E A;  4FSB A; 
#chains in the Genus database with same CATH topology
 4EYB A;  4PVT A;  3PG4 A;  5AXR A;  2M5D A;  3LVZ A;  5LCA A;  5B15 A;  3WXC A;  2I7V A;  2CG3 A;  4EXY A;  3H3E A;  3IEL A;  5FQC A;  1YCF A;  2BTN A;  4KEP A;  3X2Y A;  4AWZ A;  4D1T A;  1A8T A;  2ZWR A;  5A23 A;  4RAW A;  4FEK A;  5LCF A;  4AWY B;  4UAM A;  1VME A;  4RM5 A;  3BV6 A;  2BFZ A;  5HIQ A;  3MD7 A;  2FU9 A;  2WYL A;  4AD9 A;  4FR7 A;  1P9E A;  4D1V A;  3T3N A;  5B3R A;  2Y8A A;  4HL1 A;  4DIL A;  4AV7 A;  4TYT A;  3PY5 A;  3T3O A;  4D02 A;  4GYU A;  1KR3 A;  4YSB A;  3BC2 A;  2OHI A;  5AYA A;  3DHA A;  3X30 A;  2BG8 A;  1KO3 A;  5EV8 A;  5EVD A;  2YNW A;  4UWS B;  2Q42 A;  5LS3 A;  3SW3 A;  4TYF A;  2OHH A;  4BZ3 A;  3IEK A;  1K07 A;  1ZNB A;  2WHG A;  1VGN A;  2GFJ A;  2NXA A;  2CFU A;  1XTO A;  1DXK A;  3SFP A;  1VJN A;  3X2X A;  3SD9 A;  2H6A A;  5ACR A;  5A0V A;  5ACP A;  4P62 A;  4ZO2 A;  2BMI A;  2WYM C;  4C1H A;  5A0T A;  2ZNB A;  1JJE A;  2YNV B;  3I14 A;  1QH3 A;  2XF4 A;  3FCZ A;  3KNR A;  4UA4 A;  4WD6 A;  4D1U A;  3AF6 A;  4NQ5 A;  3SRX A;  2CG2 A;  2YCB A;  5EHT A;  4F6H A;  1QH5 A;  5HH6 A;  4C1D A;  5LCH A;  1Y44 A;  4EY2 A;  1E5D A;  2GCU A;  4TZE A;  2OHJ A;  2A7M A;  2FHX A;  5K0W A;  2NZF A;  2BR6 A;  2BFK A;  4ZO3 A;  4J5H A;  2CFZ A;  5HIO A;  2FM6 A;  4ZEJ A;  3PY6 A;  5AHR A;  1L9Y A;  1ZTC A;  4RL2 A;  1X8H A;  4NQ2 A;  4C09 A;  4NUR A;  2YNU A;  5ACU A;  2DOO A;  1WRA A;  5K4K A;  1DD6 A;  1HLK A;  5K4M A;  3IE2 A;  2ZZI A;  4H0D A;  2AIO A;  5K4N A;  3JXP A;  4TZ9 A;  2Q0I A;  2BG2 A;  4UWP B;  3AJ3 A;  4YSK A;  2BIB A;  3A4Y A;  2QDT A;  1A7T A;  3BK1 A;  3TP9 A;  4RAM A;  2NZE A;  5A87 A;  4XWW A;  4UWR B;  4Z5Z A;  5ACQ A;  4DIK A;  3VQZ A;  2Y8B A;  3ZNB A;  1BVT A;  2R2D A;  3QH8 A;  3IEM A;  1JT1 A;  3I0V A;  1JJT A;  3IOG A;  2YNT B;  2BC2 A;  2P4Z A;  2P18 A;  1WUP A;  2E7Y A;  1KO2 A;  3I13 A;  2WRS A;  4LE6 A;  2GKL A;  2QDS A;  5KIK A;  2ZO4 A;  2Q0J A;  5LM6 A;  4EXS A;  2FK6 A;  4Z67 A;  4HL2 A;  2HB9 A;  4Z7R A;  1BMC A;  4UWO B;  2FU6 A;  3IE1 A;  5LLD A;  4B87 A;  2GFK A;  3DH8 A;  3KNS A;  4Z60 A;  2CBN A;  2YNV A;  4AX1 B;  5EVK A;  3R2U A;  3AF5 A;  2QED A;  5ACV A;  4TZF A;  2Q9U A;  2FU8 A;  2QJS A;  2BGA A;  3S0Z A;  2BG6 A;  1WUO A;  4XUK A;  5EV6 A;  5EW0 A;  5ACW A;  2GMN A;  4CHL A;  2WYM A;  3FAI A;  4V0H A;  3RPC A;  5ACX A;  5ACS A;  3P2U A;  1WW1 A;  4NQ6 A;  5ACT A;  1YCG A;  5HH4 A;  4YSL A;  5EH9 A;  2BFZ B;  4O98 A;  2BG7 A;  3Q6V A;  1SML A;  1M2X A;  4ZNB A;  3DHC A;  3IE0 A;  3ZR9 A;  4GYQ A;  3ZQ4 A;  4RL0 A;  4Z6X A;  4EYF A;  3F9O A;  2DKF A;  5LMC A;  3L6N A;  4Z5Y A;  5HIP A;  3SPU A;  3I15 A;  2YZ3 A;  3ZWF A;  4C1G A;  5IQK A;  2M5C A;  2BG8 B;  3X2Z A;  4F6Z A;  3G1P A;  3SBL A;  5EVB A;  5A5Z A;  3KL7 A;  1YCH A;  5AIJ A;  3DHB A;  4C1C A;  3I11 A;  4EFZ A;  5AJL A;  5AHO A;  4KEQ A;  4UBQ A;  5HH5 A;  5HIS A;  3T9M A;  3ADR A;  5LSC A;  2VW8 A;  3RKK A;  1ZKP A;  4D1W A;  4XWT A;  2YNT A;  2Y87 A;  2QIN A;  2I7X A;  5AXO A;  3VPE A;  4BP0 A;  4U4L A;  5EWA A;  4NQ4 A;  2YHE A;  4TZB A;  4AXH A;  2XR1 A;  1X8I A;  1XM8 A;  3BK2 A;  2BFL A;  4RBS A;  4HKY A;  3IDZ A;  2FU7 A;  2UYX A;  5FQB A;  4AX0 B;  4JO0 A;  2P97 A;  4PVO A;  3IOF A;  2FHX B;  4GCW A;  5KIL A;  4C1F A;  4PDX A;  5DPX A;  5LE1 A;  5AEB A;  3RKJ A;  2NYP A;  5FQA A;  2AZ4 A;  4EYL A;  1DDK A;  4C1E A;  2I7T A;  1MQO A;  4J5F A;  5B1U A;  3ESH A;  1X8G A;  1BC2 A;  2P1E A;  4FSB A; 
#chains in the Genus database with same CATH homology
 4EYB A;  4PVT A;  3PG4 A;  5AXR A;  2M5D A;  3LVZ A;  5LCA A;  5B15 A;  3WXC A;  2I7V A;  4EXY A;  3H3E A;  3IEL A;  5FQC A;  1YCF A;  2BTN A;  4KEP A;  3X2Y A;  4AWZ A;  4D1T A;  1A8T A;  2ZWR A;  4RAW A;  4FEK A;  5LCF A;  4AWY B;  4UAM A;  1VME A;  4RM5 A;  3BV6 A;  2BFZ A;  5HIQ A;  3MD7 A;  2FU9 A;  2WYL A;  4AD9 A;  4FR7 A;  1P9E A;  4D1V A;  3T3N A;  5B3R A;  2Y8A A;  4HL1 A;  4DIL A;  4TYT A;  3PY5 A;  3T3O A;  4D02 A;  4GYU A;  1KR3 A;  4YSB A;  3BC2 A;  2OHI A;  5AYA A;  3DHA A;  3X30 A;  2BG8 A;  1KO3 A;  5EV8 A;  5EVD A;  2YNW A;  4UWS B;  2Q42 A;  5LS3 A;  3SW3 A;  4TYF A;  2OHH A;  4BZ3 A;  3IEK A;  1K07 A;  1ZNB A;  2WHG A;  1VGN A;  2GFJ A;  2NXA A;  1XTO A;  1DXK A;  3SFP A;  1VJN A;  3X2X A;  3SD9 A;  2H6A A;  5ACR A;  5A0V A;  5ACP A;  4P62 A;  4ZO2 A;  2BMI A;  2WYM C;  4C1H A;  5A0T A;  2ZNB A;  1JJE A;  2YNV B;  3I14 A;  1QH3 A;  2XF4 A;  3FCZ A;  3KNR A;  4UA4 A;  4WD6 A;  4D1U A;  3AF6 A;  4NQ5 A;  3SRX A;  2YCB A;  5EHT A;  4F6H A;  1QH5 A;  5HH6 A;  4C1D A;  5LCH A;  1Y44 A;  4EY2 A;  1E5D A;  2GCU A;  4TZE A;  2OHJ A;  2A7M A;  2FHX A;  5K0W A;  2NZF A;  2BR6 A;  2BFK A;  4ZO3 A;  4J5H A;  5HIO A;  2FM6 A;  4ZEJ A;  3PY6 A;  5AHR A;  1L9Y A;  1ZTC A;  4RL2 A;  1X8H A;  4NQ2 A;  4C09 A;  2YNU A;  5ACU A;  2DOO A;  1WRA A;  5K4K A;  1DD6 A;  1HLK A;  5K4M A;  3IE2 A;  2ZZI A;  4H0D A;  2AIO A;  5K4N A;  3JXP A;  4TZ9 A;  2Q0I A;  2BG2 A;  4UWP B;  3AJ3 A;  4YSK A;  2BIB A;  3A4Y A;  2QDT A;  1A7T A;  3BK1 A;  3TP9 A;  4RAM A;  2NZE A;  5A87 A;  4XWW A;  4UWR B;  4Z5Z A;  5ACQ A;  4DIK A;  3VQZ A;  2Y8B A;  3ZNB A;  1BVT A;  2R2D A;  3QH8 A;  3IEM A;  1JT1 A;  3I0V A;  1JJT A;  3IOG A;  2YNT B;  2BC2 A;  2P4Z A;  2P18 A;  1WUP A;  2E7Y A;  1KO2 A;  3I13 A;  2WRS A;  4LE6 A;  2GKL A;  2QDS A;  5KIK A;  2ZO4 A;  2Q0J A;  5LM6 A;  4EXS A;  2FK6 A;  4Z67 A;  4HL2 A;  2HB9 A;  4Z7R A;  1BMC A;  4UWO B;  2FU6 A;  3IE1 A;  5LLD A;  4B87 A;  2GFK A;  3DH8 A;  3KNS A;  4Z60 A;  2CBN A;  2YNV A;  4AX1 B;  5EVK A;  3R2U A;  3AF5 A;  2QED A;  5ACV A;  4TZF A;  2Q9U A;  2FU8 A;  2QJS A;  2BGA A;  3S0Z A;  2BG6 A;  1WUO A;  4XUK A;  5EV6 A;  5EW0 A;  5ACW A;  2GMN A;  4CHL A;  2WYM A;  3FAI A;  4V0H A;  3RPC A;  5ACX A;  5ACS A;  3P2U A;  1WW1 A;  4NQ6 A;  5ACT A;  1YCG A;  5HH4 A;  4YSL A;  5EH9 A;  2BFZ B;  4O98 A;  2BG7 A;  3Q6V A;  1SML A;  1M2X A;  4ZNB A;  3DHC A;  3IE0 A;  3ZR9 A;  4GYQ A;  3ZQ4 A;  4RL0 A;  4Z6X A;  4EYF A;  3F9O A;  2DKF A;  5LMC A;  3L6N A;  4Z5Y A;  5HIP A;  3SPU A;  3I15 A;  2YZ3 A;  3ZWF A;  4C1G A;  5IQK A;  2M5C A;  2BG8 B;  3X2Z A;  4F6Z A;  3G1P A;  3SBL A;  5EVB A;  5A5Z A;  3KL7 A;  1YCH A;  3DHB A;  4C1C A;  3I11 A;  4EFZ A;  5AHO A;  4KEQ A;  4UBQ A;  5HH5 A;  5HIS A;  3T9M A;  3ADR A;  5LSC A;  2VW8 A;  3RKK A;  1ZKP A;  4D1W A;  4XWT A;  2YNT A;  2Y87 A;  2QIN A;  2I7X A;  5AXO A;  3VPE A;  4BP0 A;  4U4L A;  5EWA A;  4NQ4 A;  4TZB A;  2XR1 A;  1X8I A;  1XM8 A;  3BK2 A;  2BFL A;  4RBS A;  4HKY A;  3IDZ A;  2FU7 A;  2UYX A;  5FQB A;  4AX0 B;  4JO0 A;  2P97 A;  4PVO A;  3IOF A;  2FHX B;  4GCW A;  5KIL A;  4C1F A;  5DPX A;  5LE1 A;  5AEB A;  3RKJ A;  2NYP A;  5FQA A;  2AZ4 A;  4EYL A;  1DDK A;  4C1E A;  2I7T A;  1MQO A;  4J5F A;  5B1U A;  3ESH A;  1X8G A;  1BC2 A;  2P1E A;  4FSB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...