5AEBA

Crystal structure of the class b3 di-zinc metallo-beta-lactamase lra- 12 from an alaskan soil metagenome.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
264
structure length
264
Chain Sequence
VKEPTVSNADWSKPYRPFRIAGNLYYIGTYDLACYLITTKQGNIIVNTGLAASALQIKNNIKALGFKLTDTKILLTTQAHYDHLGAMAEIKKITGAKLMADEGDATVMADGGSSDYAFGGHGSMFEPIIADRLLHDKDTIQLGDTKLVMLHHPGHTKGSCSFLFDTKDEQRSYRILIANMPTIVIEKKFSEVSSYPGIAKDYAYTLQAMKNLSFDIWVASHASQFSMHSKHKPGDGYNPKSFMDRKGYDESLDKLQKEYEKHLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords LRA-12
publication title Crystal structure and kinetic analysis of the class B3 di-zinc metallo-beta-lactamase LRA-12 from an Alaskan soil metagenome.
pubmed doi rcsb
total genus 85
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5aebA00
3L6NA 3IDZA 2I7VA 2Q42A 3PG4A 5HH6A 3FCZA 4UWPB 4EYFA 5LMCA 3IEMA 1M2XA 1BMCA 2FK6A 5FQCA 4AWYB 1X8GA 5AHRA 4UWOB 1XM8A 4C1GA 2P97A 5K0WA 2Y8BA 4TZEA 5LCHA 1P9EA 3G1PA 4Z5ZA 1K07A 4EYBA 4ZEJA 4D1VA 2QINA 2FU8A 2YNVB 4O98A 4XWTA 2GKLA 2WHGA 3T9MA 5FQAA 4EXYA 5HIQA 4ZO2A 4HL2A 5HH5A 2GCUA 4RBSA 4GYUA 1X8HA 3S0ZA 1BVTA 4UBQA 4D02A 4DILA 3ESHA 2ZWRA 4RAMA 1WUOA 2Q0JA 2BGAA 5EV8A 3SFPA 2FU7A 2BFKA 4YSKA 4GYQA 1ZKPA 1L9YA 3ZNBA 4AX0B 3SPUA 4RL2A 3X2ZA 3T3NA 2FHXB 4V0HA 3P2UA 2AZ4A 2AIOA 3IELA 1YCFA 4RL0A 4C1HA 1JJEA 1DXKA 5LE1A 5ACRA 4UA4A 2BR6A 3JXPA 4GCWA 3X30A 4XWWA 1X8IA 2BTNA 4HL1A 4EY2A 2ZO4A 4EXSA 2OHJA 5IQKA 2QDTA 1E5DA 4B87A 4J5HA 2VW8A 4F6ZA 5ACTA 3AF6A 4FR7A 5ACUA 4TZBA 3KNRA 4FEKA 2YNUA 5HISA 1HLKA 4TYFA 1KO2A 4ZO3A 2NYPA 4ZNBA 5EVDA 5ACVA 2BG2A 2OHHA 3IE0A 5LSCA 5AXRA 2QDSA 2XF4A 3PY6A 1KO3A 2BMIA 3X2YA 3BK1A 3SBLA 5LM6A 2M5DA 1DDKA 1VJNA 5B15A 2GFKA 4C09A 1Y44A 5B3RA 2FU6A 2YNWA 5ACXA 5KILA 1YCHA 4NQ5A 3RKJA 5ACSA 3I13A 4D1TA 4PVTA 3T3OA 5AHOA 3IE1A 3IE2A 2NZEA 3IEKA 2H6AA 3BV6A 2OHIA 2BC2A 1BC2A 2GMNA 3IOFA 5KIKA 3BK2A 4J5FA 3BC2A 1VMEA 3I15A 5K4KA 2CBNA 2BG8A 5HIOA 2I7XA 1YCGA 1ZNBA 5EVKA 2P4ZA 4C1DA 4D1UA 1A8TA 3ZWFA 5A0VA 2BFZA 1QH5A 2QEDA 3QH8A 3RPCA 5A87A 2YNTA 2HB9A 3H3EA 1DD6A 3AF5A 3DHAA 5EHTA 2BIBA 3I11A 4P62A 4H0DA 4AX1B 5EW0A 1ZTCA 2DKFA 1WW1A 2YCBA 2WYLA 3LVZA 4PVOA 4UAMA 3ZR9A 1QH3A 1WUPA 3I0VA 2YZ3A 5LCAA 4NQ2A 3KL7A 5FQBA 3I14A 3SRXA 4YSLA 2XR1A 5AYAA 3WXCA 4C1CA 5EWAA 4D1WA 3Q6VA 1SMLA 3DHCA 2A7MA 2DOOA 4TZFA 2GFJA 2I7TA 2P1EA 4DIKA 3A4YA 4JO0A 4KEPA 4TZ9A 2Q9UA 3SW3A 4BZ3A 3PY5A 3FAIA 4EYLA 4C1EA 5LLDA 4Z6XA 5EVBA 4UWRB 4UWSB 3TP9A 3VQZA 4AWZA 1KR3A 5DPXA 5K4MA 4Z5YA 2YNVA 2Q0IA 5EH9A 4Z60A 4FSBA 2R2DA 2BG7A 2NXAA 3AJ3A 5K4NA 3SD9A 3DH8A 4NQ6A 1MQOA 5HIPA 4CHLA 3MD7A 3IOGA 3X2XA 1VGNA 2BG6A 2FU9A 2BG8B 2WYMA 4XUKA 3ZQ4A 5ACQA 3DHBA 2Y87A 5AEBA 4LE6A 5EV6A 2BFZB 4BP0A 5ACPA 2YNTB 4WD6A 1WRAA 4Z7RA 2FHXA 1A7TA 4U4LA 2WRSA 5B1UA 3RKKA 1XTOA 5LCFA 4AD9A 5LS3A 3VPEA 2Y8AA 4KEQA 4NQ4A 5ACWA 5HH4A 1JJTA 5AXOA 2WYMC 2ZZIA 2NZFA 5A5ZA 2ZNBA 5A0TA 4EFZA 4TYTA 3ADRA 2E7YA 3F9OA 2BFLA 4RM5A 3KNSA 2QJSA 4Z67A 1JT1A 2P18A 4HKYA 4YSBA 4C1FA 3R2UA 2M5CA 2UYXA 4RAWA 2FM6A 4F6HA
chains in the Genus database with same CATH superfamily
3L6NA 3IDZA 2I7VA 2Q42A 3PG4A 5HH6A 5A23A 3FCZA 4UWPB 4EYFA 5LMCA 3IEMA 1M2XA 1BMCA 2FK6A 5FQCA 4AWYB 1X8GA 5AHRA 4UWOB 1XM8A 4C1GA 2P97A 5K0WA 2Y8BA 4TZEA 5LCHA 1P9EA 3G1PA 4Z5ZA 1K07A 4EYBA 4ZEJA 4D1VA 2QINA 2FU8A 2YNVB 4O98A 4XWTA 2GKLA 2WHGA 3T9MA 5FQAA 4EXYA 5HIQA 4ZO2A 4HL2A 5HH5A 2GCUA 4RBSA 4GYUA 1X8HA 2CFZA 3S0ZA 1BVTA 4PDXA 4UBQA 4D02A 4DILA 3ESHA 2ZWRA 4RAMA 1WUOA 2Q0JA 2BGAA 4AV7A 5EV8A 3SFPA 2FU7A 2BFKA 4YSKA 4GYQA 1ZKPA 1L9YA 3ZNBA 4AX0B 3SPUA 4RL2A 3X2ZA 3T3NA 2FHXB 4V0HA 3P2UA 2AZ4A 2AIOA 3IELA 1YCFA 4RL0A 4C1HA 1JJEA 1DXKA 5LE1A 5ACRA 4UA4A 2BR6A 3JXPA 4GCWA 3X30A 4XWWA 1X8IA 2BTNA 4HL1A 4EY2A 2ZO4A 2CG2A 4EXSA 2OHJA 5IQKA 2QDTA 1E5DA 4B87A 4J5HA 2VW8A 4F6ZA 5ACTA 3AF6A 4FR7A 5ACUA 4TZBA 2CFUA 3KNRA 4FEKA 5AJLA 2YNUA 5HISA 1HLKA 4TYFA 1KO2A 4ZO3A 2NYPA 4ZNBA 5EVDA 5ACVA 2BG2A 2OHHA 3IE0A 5LSCA 5AXRA 2QDSA 2XF4A 3PY6A 1KO3A 2BMIA 3X2YA 3BK1A 3SBLA 5LM6A 2M5DA 1DDKA 1VJNA 5B15A 2GFKA 4C09A 1Y44A 5B3RA 2FU6A 2YNWA 5ACXA 5KILA 1YCHA 4NQ5A 3RKJA 5ACSA 3I13A 4D1TA 4PVTA 3T3OA 5AHOA 3IE1A 3IE2A 2NZEA 3IEKA 2H6AA 3BV6A 2OHIA 2BC2A 1BC2A 2GMNA 3IOFA 5KIKA 3BK2A 4J5FA 3BC2A 1VMEA 3I15A 5K4KA 2CBNA 2BG8A 5HIOA 2I7XA 1YCGA 1ZNBA 5EVKA 2P4ZA 4C1DA 4D1UA 1A8TA 3ZWFA 5A0VA 2BFZA 1QH5A 2QEDA 3QH8A 3RPCA 5A87A 2YNTA 2HB9A 5AIJA 3H3EA 2CG3A 1DD6A 3AF5A 3DHAA 5EHTA 2YHEA 2BIBA 3I11A 4P62A 4H0DA 4AX1B 5EW0A 1ZTCA 2DKFA 1WW1A 2YCBA 2WYLA 3LVZA 4PVOA 4UAMA 3ZR9A 1QH3A 1WUPA 3I0VA 2YZ3A 5LCAA 4NQ2A 4AXHA 3KL7A 5FQBA 3I14A 3SRXA 4YSLA 2XR1A 5AYAA 3WXCA 4C1CA 5EWAA 4D1WA 3Q6VA 1SMLA 3DHCA 2A7MA 2DOOA 4TZFA 2GFJA 2I7TA 2P1EA 4DIKA 3A4YA 4JO0A 4KEPA 4TZ9A 2Q9UA 3SW3A 4BZ3A 3PY5A 3FAIA 4EYLA 4C1EA 5LLDA 4Z6XA 5EVBA 4UWRB 4UWSB 3TP9A 3VQZA 4AWZA 1KR3A 5DPXA 5K4MA 4Z5YA 2YNVA 2Q0IA 5EH9A 4Z60A 4FSBA 2R2DA 2BG7A 4NURA 2NXAA 3AJ3A 5K4NA 3SD9A 3DH8A 4NQ6A 1MQOA 5HIPA 4CHLA 3MD7A 3IOGA 3X2XA 1VGNA 2BG6A 2FU9A 2BG8B 2WYMA 4XUKA 3ZQ4A 5ACQA 3DHBA 2Y87A 5AEBA 4LE6A 5EV6A 2BFZB 4BP0A 5ACPA 2YNTB 4WD6A 1WRAA 4Z7RA 2FHXA 1A7TA 4U4LA 2WRSA 5B1UA 3RKKA 1XTOA 5LCFA 4AD9A 5LS3A 3VPEA 2Y8AA 4KEQA 4NQ4A 5ACWA 5HH4A 1JJTA 5AXOA 2WYMC 2ZZIA 2NZFA 5A5ZA 2ZNBA 5A0TA 4EFZA 4TYTA 3ADRA 2E7YA 3F9OA 2BFLA 4RM5A 3KNSA 2QJSA 4Z67A 1JT1A 2P18A 4HKYA 4YSBA 4C1FA 3R2UA 2M5CA 2UYXA 4RAWA 2FM6A 4F6HA
chains in the Genus database with same CATH topology
3L6NA 3IDZA 2I7VA 2Q42A 3PG4A 5HH6A 3FCZA 4UWPB 4EYFA 5LMCA 3IEMA 1M2XA 1BMCA 2FK6A 5FQCA 4AWYB 1X8GA 5AHRA 4UWOB 1XM8A 4C1GA 2P97A 5K0WA 2Y8BA 4TZEA 5LCHA 1P9EA 3G1PA 4Z5ZA 1K07A 4EYBA 4ZEJA 4D1VA 2QINA 2FU8A 2YNVB 4O98A 4XWTA 2GKLA 2WHGA 3T9MA 5FQAA 4EXYA 5HIQA 4ZO2A 4HL2A 5HH5A 2GCUA 4RBSA 4GYUA 1X8HA 3S0ZA 1BVTA 4UBQA 4D02A 4DILA 3ESHA 2ZWRA 4RAMA 1WUOA 2Q0JA 2BGAA 5EV8A 3SFPA 2FU7A 2BFKA 4YSKA 4GYQA 1ZKPA 1L9YA 3ZNBA 4AX0B 3SPUA 4RL2A 3X2ZA 3T3NA 2FHXB 4V0HA 3P2UA 2AZ4A 2AIOA 3IELA 1YCFA 4RL0A 4C1HA 1JJEA 1DXKA 5LE1A 5ACRA 4UA4A 2BR6A 3JXPA 4GCWA 3X30A 4XWWA 1X8IA 2BTNA 4HL1A 4EY2A 2ZO4A 4EXSA 2OHJA 5IQKA 2QDTA 1E5DA 4B87A 4J5HA 2VW8A 4F6ZA 5ACTA 3AF6A 4FR7A 5ACUA 4TZBA 3KNRA 4FEKA 2YNUA 5HISA 1HLKA 4TYFA 1KO2A 4ZO3A 2NYPA 4ZNBA 5EVDA 5ACVA 2BG2A 2OHHA 3IE0A 5LSCA 5AXRA 2QDSA 2XF4A 3PY6A 1KO3A 2BMIA 3X2YA 3BK1A 3SBLA 5LM6A 2M5DA 1DDKA 1VJNA 5B15A 2GFKA 4C09A 1Y44A 5B3RA 2FU6A 2YNWA 5ACXA 5KILA 1YCHA 4NQ5A 3RKJA 5ACSA 3I13A 4D1TA 4PVTA 3T3OA 5AHOA 3IE1A 3IE2A 2NZEA 3IEKA 2H6AA 3BV6A 2OHIA 2BC2A 1BC2A 2GMNA 3IOFA 5KIKA 3BK2A 4J5FA 3BC2A 1VMEA 3I15A 5K4KA 2CBNA 2BG8A 5HIOA 2I7XA 1YCGA 1ZNBA 5EVKA 2P4ZA 4C1DA 4D1UA 1A8TA 3ZWFA 5A0VA 2BFZA 1QH5A 2QEDA 3QH8A 3RPCA 5A87A 2YNTA 2HB9A 3H3EA 1DD6A 3AF5A 3DHAA 5EHTA 2BIBA 3I11A 4P62A 4H0DA 4AX1B 5EW0A 1ZTCA 2DKFA 1WW1A 2YCBA 2WYLA 3LVZA 4PVOA 4UAMA 3ZR9A 1QH3A 1WUPA 3I0VA 2YZ3A 5LCAA 4NQ2A 3KL7A 5FQBA 3I14A 3SRXA 4YSLA 2XR1A 5AYAA 3WXCA 4C1CA 5EWAA 4D1WA 3Q6VA 1SMLA 3DHCA 2A7MA 2DOOA 4TZFA 2GFJA 2I7TA 2P1EA 4DIKA 3A4YA 4JO0A 4KEPA 4TZ9A 2Q9UA 3SW3A 4BZ3A 3PY5A 3FAIA 4EYLA 4C1EA 5LLDA 4Z6XA 5EVBA 4UWRB 4UWSB 3TP9A 3VQZA 4AWZA 1KR3A 5DPXA 5K4MA 4Z5YA 2YNVA 2Q0IA 5EH9A 4Z60A 4FSBA 2R2DA 2BG7A 2NXAA 3AJ3A 5K4NA 3SD9A 3DH8A 4NQ6A 1MQOA 5HIPA 4CHLA 3MD7A 3IOGA 3X2XA 1VGNA 2BG6A 2FU9A 2BG8B 2WYMA 4XUKA 3ZQ4A 5ACQA 3DHBA 2Y87A 5AEBA 4LE6A 5EV6A 2BFZB 4BP0A 5ACPA 2YNTB 4WD6A 1WRAA 4Z7RA 2FHXA 1A7TA 4U4LA 2WRSA 5B1UA 3RKKA 1XTOA 5LCFA 4AD9A 5LS3A 3VPEA 2Y8AA 4KEQA 4NQ4A 5ACWA 5HH4A 1JJTA 5AXOA 2WYMC 2ZZIA 2NZFA 5A5ZA 2ZNBA 5A0TA 4EFZA 4TYTA 3ADRA 2E7YA 3F9OA 2BFLA 4RM5A 3KNSA 2QJSA 4Z67A 1JT1A 2P18A 4HKYA 4YSBA 4C1FA 3R2UA 2M5CA 2UYXA 4RAWA 2FM6A 4F6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L6N A;  3IDZ A;  2I7V A;  2Q42 A;  3PG4 A;  5HH6 A;  3FCZ A;  4UWP B;  4EYF A;  5LMC A;  3IEM A;  1M2X A;  1BMC A;  2FK6 A;  5FQC A;  4AWY B;  1X8G A;  5AHR A;  4UWO B;  1XM8 A;  4C1G A;  2P97 A;  5K0W A;  2Y8B A;  4TZE A;  5LCH A;  1P9E A;  3G1P A;  4Z5Z A;  1K07 A;  4EYB A;  4ZEJ A;  4D1V A;  2QIN A;  2FU8 A;  2YNV B;  4O98 A;  4XWT A;  2GKL A;  2WHG A;  3T9M A;  5FQA A;  4EXY A;  5HIQ A;  4ZO2 A;  4HL2 A;  5HH5 A;  2GCU A;  4RBS A;  4GYU A;  1X8H A;  3S0Z A;  1BVT A;  4UBQ A;  4D02 A;  4DIL A;  3ESH A;  2ZWR A;  4RAM A;  1WUO A;  2Q0J A;  2BGA A;  5EV8 A;  3SFP A;  2FU7 A;  2BFK A;  4YSK A;  4GYQ A;  1ZKP A;  1L9Y A;  3ZNB A;  4AX0 B;  3SPU A;  4RL2 A;  3X2Z A;  3T3N A;  2FHX B;  4V0H A;  3P2U A;  2AZ4 A;  2AIO A;  3IEL A;  1YCF A;  4RL0 A;  4C1H A;  1JJE A;  1DXK A;  5LE1 A;  5ACR A;  4UA4 A;  2BR6 A;  3JXP A;  4GCW A;  3X30 A;  4XWW A;  1X8I A;  2BTN A;  4HL1 A;  4EY2 A;  2ZO4 A;  4EXS A;  2OHJ A;  5IQK A;  2QDT A;  1E5D A;  4B87 A;  4J5H A;  2VW8 A;  4F6Z A;  5ACT A;  3AF6 A;  4FR7 A;  5ACU A;  4TZB A;  3KNR A;  4FEK A;  2YNU A;  5HIS A;  1HLK A;  4TYF A;  1KO2 A;  4ZO3 A;  2NYP A;  4ZNB A;  5EVD A;  5ACV A;  2BG2 A;  2OHH A;  3IE0 A;  5LSC A;  5AXR A;  2QDS A;  2XF4 A;  3PY6 A;  1KO3 A;  2BMI A;  3X2Y A;  3BK1 A;  3SBL A;  5LM6 A;  2M5D A;  1DDK A;  1VJN A;  5B15 A;  2GFK A;  4C09 A;  1Y44 A;  5B3R A;  2FU6 A;  2YNW A;  5ACX A;  5KIL A;  1YCH A;  4NQ5 A;  3RKJ A;  5ACS A;  3I13 A;  4D1T A;  4PVT A;  3T3O A;  5AHO A;  3IE1 A;  3IE2 A;  2NZE A;  3IEK A;  2H6A A;  3BV6 A;  2OHI A;  2BC2 A;  1BC2 A;  2GMN A;  3IOF A;  5KIK A;  3BK2 A;  4J5F A;  3BC2 A;  1VME A;  3I15 A;  5K4K A;  2CBN A;  2BG8 A;  5HIO A;  2I7X A;  1YCG A;  1ZNB A;  5EVK A;  2P4Z A;  4C1D A;  4D1U A;  1A8T A;  3ZWF A;  5A0V A;  2BFZ A;  1QH5 A;  2QED A;  3QH8 A;  3RPC A;  5A87 A;  2YNT A;  2HB9 A;  3H3E A;  1DD6 A;  3AF5 A;  3DHA A;  5EHT A;  2BIB A;  3I11 A;  4P62 A;  4H0D A;  4AX1 B;  5EW0 A;  1ZTC A;  2DKF A;  1WW1 A;  2YCB A;  2WYL A;  3LVZ A;  4PVO A;  4UAM A;  3ZR9 A;  1QH3 A;  1WUP A;  3I0V A;  2YZ3 A;  5LCA A;  4NQ2 A;  3KL7 A;  5FQB A;  3I14 A;  3SRX A;  4YSL A;  2XR1 A;  5AYA A;  3WXC A;  4C1C A;  5EWA A;  4D1W A;  3Q6V A;  1SML A;  3DHC A;  2A7M A;  2DOO A;  4TZF A;  2GFJ A;  2I7T A;  2P1E A;  4DIK A;  3A4Y A;  4JO0 A;  4KEP A;  4TZ9 A;  2Q9U A;  3SW3 A;  4BZ3 A;  3PY5 A;  3FAI A;  4EYL A;  4C1E A;  5LLD A;  4Z6X A;  5EVB A;  4UWR B;  4UWS B;  3TP9 A;  3VQZ A;  4AWZ A;  1KR3 A;  5DPX A;  5K4M A;  4Z5Y A;  2YNV A;  2Q0I A;  5EH9 A;  4Z60 A;  4FSB A;  2R2D A;  2BG7 A;  2NXA A;  3AJ3 A;  5K4N A;  3SD9 A;  3DH8 A;  4NQ6 A;  1MQO A;  5HIP A;  4CHL A;  3MD7 A;  3IOG A;  3X2X A;  1VGN A;  2BG6 A;  2FU9 A;  2BG8 B;  2WYM A;  4XUK A;  3ZQ4 A;  5ACQ A;  3DHB A;  2Y87 A;  5AEB A;  4LE6 A;  5EV6 A;  2BFZ B;  4BP0 A;  5ACP A;  2YNT B;  4WD6 A;  1WRA A;  4Z7R A;  2FHX A;  1A7T A;  4U4L A;  2WRS A;  5B1U A;  3RKK A;  1XTO A;  5LCF A;  4AD9 A;  5LS3 A;  3VPE A;  2Y8A A;  4KEQ A;  4NQ4 A;  5ACW A;  5HH4 A;  1JJT A;  5AXO A;  2WYM C;  2ZZI A;  2NZF A;  5A5Z A;  2ZNB A;  5A0T A;  4EFZ A;  4TYT A;  3ADR A;  2E7Y A;  3F9O A;  2BFL A;  4RM5 A;  3KNS A;  2QJS A;  4Z67 A;  1JT1 A;  2P18 A;  4HKY A;  4YSB A;  4C1F A;  3R2U A;  2M5C A;  2UYX A;  4RAW A;  2FM6 A;  4F6H A; 
#chains in the Genus database with same CATH topology
 3L6N A;  3IDZ A;  2I7V A;  2Q42 A;  3PG4 A;  5HH6 A;  5A23 A;  3FCZ A;  4UWP B;  4EYF A;  5LMC A;  3IEM A;  1M2X A;  1BMC A;  2FK6 A;  5FQC A;  4AWY B;  1X8G A;  5AHR A;  4UWO B;  1XM8 A;  4C1G A;  2P97 A;  5K0W A;  2Y8B A;  4TZE A;  5LCH A;  1P9E A;  3G1P A;  4Z5Z A;  1K07 A;  4EYB A;  4ZEJ A;  4D1V A;  2QIN A;  2FU8 A;  2YNV B;  4O98 A;  4XWT A;  2GKL A;  2WHG A;  3T9M A;  5FQA A;  4EXY A;  5HIQ A;  4ZO2 A;  4HL2 A;  5HH5 A;  2GCU A;  4RBS A;  4GYU A;  1X8H A;  2CFZ A;  3S0Z A;  1BVT A;  4PDX A;  4UBQ A;  4D02 A;  4DIL A;  3ESH A;  2ZWR A;  4RAM A;  1WUO A;  2Q0J A;  2BGA A;  4AV7 A;  5EV8 A;  3SFP A;  2FU7 A;  2BFK A;  4YSK A;  4GYQ A;  1ZKP A;  1L9Y A;  3ZNB A;  4AX0 B;  3SPU A;  4RL2 A;  3X2Z A;  3T3N A;  2FHX B;  4V0H A;  3P2U A;  2AZ4 A;  2AIO A;  3IEL A;  1YCF A;  4RL0 A;  4C1H A;  1JJE A;  1DXK A;  5LE1 A;  5ACR A;  4UA4 A;  2BR6 A;  3JXP A;  4GCW A;  3X30 A;  4XWW A;  1X8I A;  2BTN A;  4HL1 A;  4EY2 A;  2ZO4 A;  2CG2 A;  4EXS A;  2OHJ A;  5IQK A;  2QDT A;  1E5D A;  4B87 A;  4J5H A;  2VW8 A;  4F6Z A;  5ACT A;  3AF6 A;  4FR7 A;  5ACU A;  4TZB A;  2CFU A;  3KNR A;  4FEK A;  5AJL A;  2YNU A;  5HIS A;  1HLK A;  4TYF A;  1KO2 A;  4ZO3 A;  2NYP A;  4ZNB A;  5EVD A;  5ACV A;  2BG2 A;  2OHH A;  3IE0 A;  5LSC A;  5AXR A;  2QDS A;  2XF4 A;  3PY6 A;  1KO3 A;  2BMI A;  3X2Y A;  3BK1 A;  3SBL A;  5LM6 A;  2M5D A;  1DDK A;  1VJN A;  5B15 A;  2GFK A;  4C09 A;  1Y44 A;  5B3R A;  2FU6 A;  2YNW A;  5ACX A;  5KIL A;  1YCH A;  4NQ5 A;  3RKJ A;  5ACS A;  3I13 A;  4D1T A;  4PVT A;  3T3O A;  5AHO A;  3IE1 A;  3IE2 A;  2NZE A;  3IEK A;  2H6A A;  3BV6 A;  2OHI A;  2BC2 A;  1BC2 A;  2GMN A;  3IOF A;  5KIK A;  3BK2 A;  4J5F A;  3BC2 A;  1VME A;  3I15 A;  5K4K A;  2CBN A;  2BG8 A;  5HIO A;  2I7X A;  1YCG A;  1ZNB A;  5EVK A;  2P4Z A;  4C1D A;  4D1U A;  1A8T A;  3ZWF A;  5A0V A;  2BFZ A;  1QH5 A;  2QED A;  3QH8 A;  3RPC A;  5A87 A;  2YNT A;  2HB9 A;  5AIJ A;  3H3E A;  2CG3 A;  1DD6 A;  3AF5 A;  3DHA A;  5EHT A;  2YHE A;  2BIB A;  3I11 A;  4P62 A;  4H0D A;  4AX1 B;  5EW0 A;  1ZTC A;  2DKF A;  1WW1 A;  2YCB A;  2WYL A;  3LVZ A;  4PVO A;  4UAM A;  3ZR9 A;  1QH3 A;  1WUP A;  3I0V A;  2YZ3 A;  5LCA A;  4NQ2 A;  4AXH A;  3KL7 A;  5FQB A;  3I14 A;  3SRX A;  4YSL A;  2XR1 A;  5AYA A;  3WXC A;  4C1C A;  5EWA A;  4D1W A;  3Q6V A;  1SML A;  3DHC A;  2A7M A;  2DOO A;  4TZF A;  2GFJ A;  2I7T A;  2P1E A;  4DIK A;  3A4Y A;  4JO0 A;  4KEP A;  4TZ9 A;  2Q9U A;  3SW3 A;  4BZ3 A;  3PY5 A;  3FAI A;  4EYL A;  4C1E A;  5LLD A;  4Z6X A;  5EVB A;  4UWR B;  4UWS B;  3TP9 A;  3VQZ A;  4AWZ A;  1KR3 A;  5DPX A;  5K4M A;  4Z5Y A;  2YNV A;  2Q0I A;  5EH9 A;  4Z60 A;  4FSB A;  2R2D A;  2BG7 A;  4NUR A;  2NXA A;  3AJ3 A;  5K4N A;  3SD9 A;  3DH8 A;  4NQ6 A;  1MQO A;  5HIP A;  4CHL A;  3MD7 A;  3IOG A;  3X2X A;  1VGN A;  2BG6 A;  2FU9 A;  2BG8 B;  2WYM A;  4XUK A;  3ZQ4 A;  5ACQ A;  3DHB A;  2Y87 A;  5AEB A;  4LE6 A;  5EV6 A;  2BFZ B;  4BP0 A;  5ACP A;  2YNT B;  4WD6 A;  1WRA A;  4Z7R A;  2FHX A;  1A7T A;  4U4L A;  2WRS A;  5B1U A;  3RKK A;  1XTO A;  5LCF A;  4AD9 A;  5LS3 A;  3VPE A;  2Y8A A;  4KEQ A;  4NQ4 A;  5ACW A;  5HH4 A;  1JJT A;  5AXO A;  2WYM C;  2ZZI A;  2NZF A;  5A5Z A;  2ZNB A;  5A0T A;  4EFZ A;  4TYT A;  3ADR A;  2E7Y A;  3F9O A;  2BFL A;  4RM5 A;  3KNS A;  2QJS A;  4Z67 A;  1JT1 A;  2P18 A;  4HKY A;  4YSB A;  4C1F A;  3R2U A;  2M5C A;  2UYX A;  4RAW A;  2FM6 A;  4F6H A; 
#chains in the Genus database with same CATH homology
 3L6N A;  3IDZ A;  2I7V A;  2Q42 A;  3PG4 A;  5HH6 A;  3FCZ A;  4UWP B;  4EYF A;  5LMC A;  3IEM A;  1M2X A;  1BMC A;  2FK6 A;  5FQC A;  4AWY B;  1X8G A;  5AHR A;  4UWO B;  1XM8 A;  4C1G A;  2P97 A;  5K0W A;  2Y8B A;  4TZE A;  5LCH A;  1P9E A;  3G1P A;  4Z5Z A;  1K07 A;  4EYB A;  4ZEJ A;  4D1V A;  2QIN A;  2FU8 A;  2YNV B;  4O98 A;  4XWT A;  2GKL A;  2WHG A;  3T9M A;  5FQA A;  4EXY A;  5HIQ A;  4ZO2 A;  4HL2 A;  5HH5 A;  2GCU A;  4RBS A;  4GYU A;  1X8H A;  3S0Z A;  1BVT A;  4UBQ A;  4D02 A;  4DIL A;  3ESH A;  2ZWR A;  4RAM A;  1WUO A;  2Q0J A;  2BGA A;  5EV8 A;  3SFP A;  2FU7 A;  2BFK A;  4YSK A;  4GYQ A;  1ZKP A;  1L9Y A;  3ZNB A;  4AX0 B;  3SPU A;  4RL2 A;  3X2Z A;  3T3N A;  2FHX B;  4V0H A;  3P2U A;  2AZ4 A;  2AIO A;  3IEL A;  1YCF A;  4RL0 A;  4C1H A;  1JJE A;  1DXK A;  5LE1 A;  5ACR A;  4UA4 A;  2BR6 A;  3JXP A;  4GCW A;  3X30 A;  4XWW A;  1X8I A;  2BTN A;  4HL1 A;  4EY2 A;  2ZO4 A;  4EXS A;  2OHJ A;  5IQK A;  2QDT A;  1E5D A;  4B87 A;  4J5H A;  2VW8 A;  4F6Z A;  5ACT A;  3AF6 A;  4FR7 A;  5ACU A;  4TZB A;  3KNR A;  4FEK A;  2YNU A;  5HIS A;  1HLK A;  4TYF A;  1KO2 A;  4ZO3 A;  2NYP A;  4ZNB A;  5EVD A;  5ACV A;  2BG2 A;  2OHH A;  3IE0 A;  5LSC A;  5AXR A;  2QDS A;  2XF4 A;  3PY6 A;  1KO3 A;  2BMI A;  3X2Y A;  3BK1 A;  3SBL A;  5LM6 A;  2M5D A;  1DDK A;  1VJN A;  5B15 A;  2GFK A;  4C09 A;  1Y44 A;  5B3R A;  2FU6 A;  2YNW A;  5ACX A;  5KIL A;  1YCH A;  4NQ5 A;  3RKJ A;  5ACS A;  3I13 A;  4D1T A;  4PVT A;  3T3O A;  5AHO A;  3IE1 A;  3IE2 A;  2NZE A;  3IEK A;  2H6A A;  3BV6 A;  2OHI A;  2BC2 A;  1BC2 A;  2GMN A;  3IOF A;  5KIK A;  3BK2 A;  4J5F A;  3BC2 A;  1VME A;  3I15 A;  5K4K A;  2CBN A;  2BG8 A;  5HIO A;  2I7X A;  1YCG A;  1ZNB A;  5EVK A;  2P4Z A;  4C1D A;  4D1U A;  1A8T A;  3ZWF A;  5A0V A;  2BFZ A;  1QH5 A;  2QED A;  3QH8 A;  3RPC A;  5A87 A;  2YNT A;  2HB9 A;  3H3E A;  1DD6 A;  3AF5 A;  3DHA A;  5EHT A;  2BIB A;  3I11 A;  4P62 A;  4H0D A;  4AX1 B;  5EW0 A;  1ZTC A;  2DKF A;  1WW1 A;  2YCB A;  2WYL A;  3LVZ A;  4PVO A;  4UAM A;  3ZR9 A;  1QH3 A;  1WUP A;  3I0V A;  2YZ3 A;  5LCA A;  4NQ2 A;  3KL7 A;  5FQB A;  3I14 A;  3SRX A;  4YSL A;  2XR1 A;  5AYA A;  3WXC A;  4C1C A;  5EWA A;  4D1W A;  3Q6V A;  1SML A;  3DHC A;  2A7M A;  2DOO A;  4TZF A;  2GFJ A;  2I7T A;  2P1E A;  4DIK A;  3A4Y A;  4JO0 A;  4KEP A;  4TZ9 A;  2Q9U A;  3SW3 A;  4BZ3 A;  3PY5 A;  3FAI A;  4EYL A;  4C1E A;  5LLD A;  4Z6X A;  5EVB A;  4UWR B;  4UWS B;  3TP9 A;  3VQZ A;  4AWZ A;  1KR3 A;  5DPX A;  5K4M A;  4Z5Y A;  2YNV A;  2Q0I A;  5EH9 A;  4Z60 A;  4FSB A;  2R2D A;  2BG7 A;  2NXA A;  3AJ3 A;  5K4N A;  3SD9 A;  3DH8 A;  4NQ6 A;  1MQO A;  5HIP A;  4CHL A;  3MD7 A;  3IOG A;  3X2X A;  1VGN A;  2BG6 A;  2FU9 A;  2BG8 B;  2WYM A;  4XUK A;  3ZQ4 A;  5ACQ A;  3DHB A;  2Y87 A;  5AEB A;  4LE6 A;  5EV6 A;  2BFZ B;  4BP0 A;  5ACP A;  2YNT B;  4WD6 A;  1WRA A;  4Z7R A;  2FHX A;  1A7T A;  4U4L A;  2WRS A;  5B1U A;  3RKK A;  1XTO A;  5LCF A;  4AD9 A;  5LS3 A;  3VPE A;  2Y8A A;  4KEQ A;  4NQ4 A;  5ACW A;  5HH4 A;  1JJT A;  5AXO A;  2WYM C;  2ZZI A;  2NZF A;  5A5Z A;  2ZNB A;  5A0T A;  4EFZ A;  4TYT A;  3ADR A;  2E7Y A;  3F9O A;  2BFL A;  4RM5 A;  3KNS A;  2QJS A;  4Z67 A;  1JT1 A;  2P18 A;  4HKY A;  4YSB A;  4C1F A;  3R2U A;  2M5C A;  2UYX A;  4RAW A;  2FM6 A;  4F6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...