5AEBA

Crystal structure of the class b3 di-zinc metallo-beta-lactamase lra- 12 from an alaskan soil metagenome.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
264
structure length
264
Chain Sequence
VKEPTVSNADWSKPYRPFRIAGNLYYIGTYDLACYLITTKQGNIIVNTGLAASALQIKNNIKALGFKLTDTKILLTTQAHYDHLGAMAEIKKITGAKLMADEGDATVMADGGSSDYAFGGHGSMFEPIIADRLLHDKDTIQLGDTKLVMLHHPGHTKGSCSFLFDTKDEQRSYRILIANMPTIVIEKKFSEVSSYPGIAKDYAYTLQAMKNLSFDIWVASHASQFSMHSKHKPGDGYNPKSFMDRKGYDESLDKLQKEYEKHLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and kinetic analysis of the class B3 di-zinc metallo-beta-lactamase LRA-12 from an Alaskan soil metagenome.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords LRA-12
total genus 85
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5aebA00
2CBNA 3ZR9A 3P2UA 3DH8A 2GFJA 4BP0A 4C1EA 1QH3A 1P9EA 4NQ5A 5ACTA 5HH4A 4LE6A 4UWRB 5HIPA 2FM6A 1A8TA 4GYUA 5ACPA 1E5DA 4YSKA 3Q6VA 1YCFA 3I13A 2BFLA 2WYMC 5AYAA 4FEKA 1JT1A 3BK2A 5AXOA 4P62A 2H6AA 4CHLA 4XWTA 5EVKA 4RL0A 4XUKA 1DXKA 5HH5A 3I11A 4U4LA 3SW3A 2WYLA 2OHHA 1VMEA 5FQCA 4AX1B 5LCAA 3T9MA 2DOOA 2YNVB 3A4YA 5LCFA 1X8HA 4ZO3A 2FHXA 2E7YA 5K4MA 1KO2A 2FU9A 5ACUA 3X2XA 5LLDA 3RKJA 4JO0A 4V0HA 4D1VA 2Y8BA 2ZNBA 3I14A 4C1HA 4DILA 2OHJA 1WW1A 3IEMA 1VGNA 2A7MA 4C1GA 5A5ZA 5EV6A 4UWOB 3IDZA 2AIOA 3PY5A 3G1PA 4FR7A 4C1CA 4UBQA 2Q42A 4RM5A 4RAWA 3I0VA 3VQZA 4ZNBA 4Z7RA 2FHXB 1YCHA 3AF6A 2I7VA 1DDKA 4HKYA 2P4ZA 4F6HA 2BC2A 5AEBA 4EFZA 3IELA 4TYFA 3BK1A 1QH5A 2NXAA 3FAIA 4ZO2A 1MQOA 3AF5A 2FK6A 3IE0A 5ACVA 2I7XA 3H3EA 2BGAA 4C1DA 3DHAA 4HL1A 3QH8A 4C09A 2P18A 2Q0JA 4NQ4A 3LVZA 5ACQA 4TZEA 5B15A 2ZO4A 3X30A 5K0WA 2BIBA 4AD9A 4EYFA 3S0ZA 3BV6A 1ZNBA 2AZ4A 2FU6A 4FSBA 2XF4A 4D02A 3RKKA 3WXCA 2YNTA 1ZKPA 3AJ3A 5ACSA 2BTNA 4KEQA 2Q9UA 4D1WA 5HISA 4D1UA 5LSCA 2QDTA 4PVOA 2P1EA 5LMCA 4UAMA 5A0VA 4YSLA 5LS3A 3BC2A 4EYLA 1BVTA 4J5HA 3T3NA 2Q0IA 4WD6A 4Z6XA 2BMIA 2BG6A 2BFKA 4PVTA 4NQ2A 3F9OA 2QJSA 2ZWRA 3R2UA 2BG2A 2NZEA 1JJEA 3SFPA 3PG4A 4C1FA 1KO3A 3IOFA 4ZEJA 5HH6A 2GMNA 4B87A 4DIKA 3T3OA 5K4KA 2XR1A 3JXPA 4J5FA 3KNRA 3SD9A 2FU8A 4Z5YA 2BG8B 5EVBA 3VPEA 5EV8A 2VW8A 1BC2A 5HIOA 4AWYB 1WUPA 1YCGA 2YNUA 5A87A 1SMLA 4UWSB 4Z5ZA 5AXRA 4HL2A 4TZFA 4AWZA 3RPCA 4EXSA 5EVDA 3TP9A 3PY6A 5LE1A 1Y44A 2I7TA 5LM6A 2P97A 5FQBA 5ACWA 2M5DA 1ZTCA 2NZFA 4F6ZA 2BFZB 5A0TA 5EH9A 2Y8AA 4RL2A 2GCUA 3ZQ4A 3KL7A 4XWWA 3IE2A 2UYXA 1X8IA 1WRAA 2YNWA 4TYTA 1M2XA 1VJNA 5DPXA 1K07A 5ACXA 1WUOA 4BZ3A 2QEDA 2WYMA 3X2YA 4GCWA 2BG8A 4GYQA 5EWAA 2ZZIA 2R2DA 5B3RA 1DD6A 2GFKA 1L9YA 3ZNBA 1KR3A 5B1UA 3FCZA 3X2ZA 4H0DA 4D1TA 4YSBA 5ACRA 3ADRA 3KNSA 2GKLA 2BFZA 3SPUA 5EW0A 3SBLA 4KEPA 5AHOA 4Z67A 3ZWFA 2BG7A 2BR6A 2OHIA 5IQKA 2WRSA 4RBSA 2FU7A 3IEKA 1A7TA 4AX0B 2YNTB 2QINA 4O98A 1JJTA 4NQ6A 5AHRA 3I15A 3DHCA 5FQAA 3DHBA 1HLKA 2Y87A 1XM8A 4EY2A 1BMCA 4RAMA 4EXYA 4Z60A 2QDSA 5KIKA 4TZ9A 2HB9A 4UWPB 4TZBA 2YZ3A 5LCHA 4UA4A 2YNVA 3L6NA 5HIQA 3ESHA 2DKFA 3IOGA 3SRXA 3MD7A 5K4NA 5EHTA 5KILA 1XTOA 2M5CA 3IE1A 2WHGA 2YCBA 2NYPA 4EYBA 1X8GA
chains in the Genus database with same CATH superfamily
2CBNA 3ZR9A 3P2UA 3DH8A 2GFJA 4BP0A 4C1EA 1QH3A 1P9EA 4NQ5A 5ACTA 5HH4A 4LE6A 4UWRB 5HIPA 2FM6A 1A8TA 4GYUA 5ACPA 1E5DA 4YSKA 3Q6VA 1YCFA 3I13A 2BFLA 2WYMC 5AYAA 4FEKA 1JT1A 3BK2A 5AXOA 4P62A 2H6AA 4CHLA 4XWTA 5EVKA 4RL0A 4XUKA 1DXKA 5HH5A 3I11A 4U4LA 3SW3A 2WYLA 2OHHA 1VMEA 5FQCA 4AX1B 5LCAA 3T9MA 2DOOA 2YNVB 3A4YA 5LCFA 1X8HA 4ZO3A 2FHXA 2E7YA 5K4MA 1KO2A 2FU9A 5ACUA 3X2XA 5LLDA 3RKJA 4JO0A 4V0HA 4D1VA 2Y8BA 2ZNBA 3I14A 4C1HA 4DILA 2OHJA 1WW1A 3IEMA 1VGNA 2A7MA 4C1GA 4AXHA 5A5ZA 5EV6A 4UWOB 3IDZA 2AIOA 3PY5A 5A23A 3G1PA 4FR7A 4C1CA 4UBQA 2Q42A 4RM5A 4RAWA 3I0VA 3VQZA 4ZNBA 4Z7RA 2FHXB 1YCHA 3AF6A 2I7VA 1DDKA 4HKYA 2P4ZA 4F6HA 2BC2A 5AEBA 4EFZA 3IELA 4TYFA 3BK1A 1QH5A 2NXAA 3FAIA 4ZO2A 1MQOA 3AF5A 2FK6A 3IE0A 5ACVA 2I7XA 3H3EA 2BGAA 4C1DA 3DHAA 4HL1A 3QH8A 4C09A 2P18A 2Q0JA 4NQ4A 3LVZA 5ACQA 4TZEA 5B15A 2ZO4A 3X30A 5K0WA 2BIBA 4AD9A 4EYFA 3S0ZA 3BV6A 2CFUA 1ZNBA 2AZ4A 2FU6A 4FSBA 2XF4A 4D02A 3RKKA 3WXCA 2YNTA 1ZKPA 3AJ3A 5ACSA 2BTNA 4KEQA 2Q9UA 4D1WA 5HISA 4D1UA 5LSCA 2QDTA 4PVOA 2P1EA 5LMCA 4UAMA 5A0VA 4YSLA 5LS3A 3BC2A 4EYLA 1BVTA 4J5HA 3T3NA 2Q0IA 4WD6A 4Z6XA 2BMIA 2BG6A 2BFKA 4PVTA 4NQ2A 3F9OA 2QJSA 5AJLA 2ZWRA 3R2UA 2BG2A 2NZEA 1JJEA 3SFPA 2CFZA 3PG4A 4C1FA 1KO3A 3IOFA 4ZEJA 5HH6A 2GMNA 4B87A 4DIKA 3T3OA 5K4KA 2XR1A 3JXPA 4J5FA 3KNRA 3SD9A 2FU8A 4Z5YA 2BG8B 5EVBA 4PDXA 3VPEA 5EV8A 2VW8A 1BC2A 5HIOA 4NURA 4AWYB 1WUPA 1YCGA 2YNUA 5A87A 1SMLA 4UWSB 4Z5ZA 5AXRA 4HL2A 4TZFA 4AWZA 3RPCA 4EXSA 5EVDA 3TP9A 3PY6A 5LE1A 1Y44A 2I7TA 5LM6A 2P97A 5FQBA 5ACWA 2M5DA 1ZTCA 2NZFA 4F6ZA 2BFZB 5A0TA 5EH9A 2Y8AA 4RL2A 2GCUA 3ZQ4A 3KL7A 4XWWA 2CG3A 2UYXA 1X8IA 3IE2A 1WRAA 2YNWA 4TYTA 1M2XA 1VJNA 5DPXA 1K07A 5ACXA 1WUOA 4BZ3A 2QEDA 2WYMA 3X2YA 4GCWA 2BG8A 4GYQA 5EWAA 2ZZIA 2R2DA 5B3RA 1DD6A 2GFKA 1L9YA 3ZNBA 1KR3A 5B1UA 3FCZA 3X2ZA 4H0DA 4D1TA 4YSBA 5ACRA 3ADRA 3KNSA 2GKLA 2BFZA 5AIJA 3SPUA 5EW0A 3SBLA 4KEPA 5AHOA 4Z67A 3ZWFA 2BG7A 2BR6A 2OHIA 5IQKA 2WRSA 4RBSA 2FU7A 3IEKA 1A7TA 4AX0B 2YNTB 4AV7A 2QINA 4O98A 1JJTA 4NQ6A 5AHRA 3I15A 3DHCA 5FQAA 3DHBA 1HLKA 2Y87A 1XM8A 4EY2A 1BMCA 4RAMA 4EXYA 4Z60A 2CG2A 2QDSA 5KIKA 4TZ9A 2HB9A 4UWPB 4TZBA 2YZ3A 5LCHA 4UA4A 2YNVA 3L6NA 5HIQA 3ESHA 2DKFA 3IOGA 3SRXA 3MD7A 5K4NA 5EHTA 5KILA 1XTOA 2M5CA 3IE1A 2WHGA 2YCBA 2NYPA 2YHEA 4EYBA 1X8GA
chains in the Genus database with same CATH topology
2CBNA 3ZR9A 3P2UA 3DH8A 2GFJA 4BP0A 4C1EA 1QH3A 1P9EA 4NQ5A 5ACTA 5HH4A 4LE6A 4UWRB 5HIPA 2FM6A 1A8TA 4GYUA 5ACPA 1E5DA 4YSKA 3Q6VA 1YCFA 3I13A 2BFLA 2WYMC 5AYAA 4FEKA 1JT1A 3BK2A 5AXOA 4P62A 2H6AA 4CHLA 4XWTA 5EVKA 4RL0A 4XUKA 1DXKA 5HH5A 3I11A 4U4LA 3SW3A 2WYLA 2OHHA 1VMEA 5FQCA 4AX1B 5LCAA 3T9MA 2DOOA 2YNVB 3A4YA 5LCFA 1X8HA 4ZO3A 2FHXA 2E7YA 5K4MA 1KO2A 2FU9A 5ACUA 3X2XA 5LLDA 3RKJA 4JO0A 4V0HA 4D1VA 2Y8BA 2ZNBA 3I14A 4C1HA 4DILA 2OHJA 1WW1A 3IEMA 1VGNA 2A7MA 4C1GA 5A5ZA 5EV6A 4UWOB 3IDZA 2AIOA 3PY5A 3G1PA 4FR7A 4C1CA 4UBQA 2Q42A 4RM5A 4RAWA 3I0VA 3VQZA 4ZNBA 4Z7RA 2FHXB 1YCHA 3AF6A 2I7VA 1DDKA 4HKYA 2P4ZA 4F6HA 2BC2A 5AEBA 4EFZA 3IELA 4TYFA 3BK1A 1QH5A 2NXAA 3FAIA 4ZO2A 1MQOA 3AF5A 2FK6A 3IE0A 5ACVA 2I7XA 3H3EA 2BGAA 4C1DA 3DHAA 4HL1A 3QH8A 4C09A 2P18A 2Q0JA 4NQ4A 3LVZA 5ACQA 4TZEA 5B15A 2ZO4A 3X30A 5K0WA 2BIBA 4AD9A 4EYFA 3S0ZA 3BV6A 1ZNBA 2AZ4A 2FU6A 4FSBA 2XF4A 4D02A 3RKKA 3WXCA 2YNTA 1ZKPA 3AJ3A 5ACSA 2BTNA 4KEQA 2Q9UA 4D1WA 5HISA 4D1UA 5LSCA 2QDTA 4PVOA 2P1EA 5LMCA 4UAMA 5A0VA 4YSLA 5LS3A 3BC2A 4EYLA 1BVTA 4J5HA 3T3NA 2Q0IA 4WD6A 4Z6XA 2BMIA 2BG6A 2BFKA 4PVTA 4NQ2A 3F9OA 2QJSA 2ZWRA 3R2UA 2BG2A 2NZEA 1JJEA 3SFPA 3PG4A 4C1FA 1KO3A 3IOFA 4ZEJA 5HH6A 2GMNA 4B87A 4DIKA 3T3OA 5K4KA 2XR1A 3JXPA 4J5FA 3KNRA 3SD9A 2FU8A 4Z5YA 2BG8B 5EVBA 3VPEA 5EV8A 2VW8A 1BC2A 5HIOA 4AWYB 1WUPA 1YCGA 2YNUA 5A87A 1SMLA 4UWSB 4Z5ZA 5AXRA 4HL2A 4TZFA 4AWZA 3RPCA 4EXSA 5EVDA 3TP9A 3PY6A 5LE1A 1Y44A 2I7TA 5LM6A 2P97A 5FQBA 5ACWA 2M5DA 1ZTCA 2NZFA 4F6ZA 2BFZB 5A0TA 5EH9A 2Y8AA 4RL2A 2GCUA 3ZQ4A 3KL7A 4XWWA 3IE2A 2UYXA 1X8IA 1WRAA 2YNWA 4TYTA 1M2XA 1VJNA 5DPXA 1K07A 5ACXA 1WUOA 4BZ3A 2QEDA 2WYMA 3X2YA 4GCWA 2BG8A 4GYQA 5EWAA 2ZZIA 2R2DA 5B3RA 1DD6A 2GFKA 1L9YA 3ZNBA 1KR3A 5B1UA 3FCZA 3X2ZA 4H0DA 4D1TA 4YSBA 5ACRA 3ADRA 3KNSA 2GKLA 2BFZA 3SPUA 5EW0A 3SBLA 4KEPA 5AHOA 4Z67A 3ZWFA 2BG7A 2BR6A 2OHIA 5IQKA 2WRSA 4RBSA 2FU7A 3IEKA 1A7TA 4AX0B 2YNTB 2QINA 4O98A 1JJTA 4NQ6A 5AHRA 3I15A 3DHCA 5FQAA 3DHBA 1HLKA 2Y87A 1XM8A 4EY2A 1BMCA 4RAMA 4EXYA 4Z60A 2QDSA 5KIKA 4TZ9A 2HB9A 4UWPB 4TZBA 2YZ3A 5LCHA 4UA4A 2YNVA 3L6NA 5HIQA 3ESHA 2DKFA 3IOGA 3SRXA 3MD7A 5K4NA 5EHTA 5KILA 1XTOA 2M5CA 3IE1A 2WHGA 2YCBA 2NYPA 4EYBA 1X8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CBN A;  3ZR9 A;  3P2U A;  3DH8 A;  2GFJ A;  4BP0 A;  4C1E A;  1QH3 A;  1P9E A;  4NQ5 A;  5ACT A;  5HH4 A;  4LE6 A;  4UWR B;  5HIP A;  2FM6 A;  1A8T A;  4GYU A;  5ACP A;  1E5D A;  4YSK A;  3Q6V A;  1YCF A;  3I13 A;  2BFL A;  2WYM C;  5AYA A;  4FEK A;  1JT1 A;  3BK2 A;  5AXO A;  4P62 A;  2H6A A;  4CHL A;  4XWT A;  5EVK A;  4RL0 A;  4XUK A;  1DXK A;  5HH5 A;  3I11 A;  4U4L A;  3SW3 A;  2WYL A;  2OHH A;  1VME A;  5FQC A;  4AX1 B;  5LCA A;  3T9M A;  2DOO A;  2YNV B;  3A4Y A;  5LCF A;  1X8H A;  4ZO3 A;  2FHX A;  2E7Y A;  5K4M A;  1KO2 A;  2FU9 A;  5ACU A;  3X2X A;  5LLD A;  3RKJ A;  4JO0 A;  4V0H A;  4D1V A;  2Y8B A;  2ZNB A;  3I14 A;  4C1H A;  4DIL A;  2OHJ A;  1WW1 A;  3IEM A;  1VGN A;  2A7M A;  4C1G A;  5A5Z A;  5EV6 A;  4UWO B;  3IDZ A;  2AIO A;  3PY5 A;  3G1P A;  4FR7 A;  4C1C A;  4UBQ A;  2Q42 A;  4RM5 A;  4RAW A;  3I0V A;  3VQZ A;  4ZNB A;  4Z7R A;  2FHX B;  1YCH A;  3AF6 A;  2I7V A;  1DDK A;  4HKY A;  2P4Z A;  4F6H A;  2BC2 A;  5AEB A;  4EFZ A;  3IEL A;  4TYF A;  3BK1 A;  1QH5 A;  2NXA A;  3FAI A;  4ZO2 A;  1MQO A;  3AF5 A;  2FK6 A;  3IE0 A;  5ACV A;  2I7X A;  3H3E A;  2BGA A;  4C1D A;  3DHA A;  4HL1 A;  3QH8 A;  4C09 A;  2P18 A;  2Q0J A;  4NQ4 A;  3LVZ A;  5ACQ A;  4TZE A;  5B15 A;  2ZO4 A;  3X30 A;  5K0W A;  2BIB A;  4AD9 A;  4EYF A;  3S0Z A;  3BV6 A;  1ZNB A;  2AZ4 A;  2FU6 A;  4FSB A;  2XF4 A;  4D02 A;  3RKK A;  3WXC A;  2YNT A;  1ZKP A;  3AJ3 A;  5ACS A;  2BTN A;  4KEQ A;  2Q9U A;  4D1W A;  5HIS A;  4D1U A;  5LSC A;  2QDT A;  4PVO A;  2P1E A;  5LMC A;  4UAM A;  5A0V A;  4YSL A;  5LS3 A;  3BC2 A;  4EYL A;  1BVT A;  4J5H A;  3T3N A;  2Q0I A;  4WD6 A;  4Z6X A;  2BMI A;  2BG6 A;  2BFK A;  4PVT A;  4NQ2 A;  3F9O A;  2QJS A;  2ZWR A;  3R2U A;  2BG2 A;  2NZE A;  1JJE A;  3SFP A;  3PG4 A;  4C1F A;  1KO3 A;  3IOF A;  4ZEJ A;  5HH6 A;  2GMN A;  4B87 A;  4DIK A;  3T3O A;  5K4K A;  2XR1 A;  3JXP A;  4J5F A;  3KNR A;  3SD9 A;  2FU8 A;  4Z5Y A;  2BG8 B;  5EVB A;  3VPE A;  5EV8 A;  2VW8 A;  1BC2 A;  5HIO A;  4AWY B;  1WUP A;  1YCG A;  2YNU A;  5A87 A;  1SML A;  4UWS B;  4Z5Z A;  5AXR A;  4HL2 A;  4TZF A;  4AWZ A;  3RPC A;  4EXS A;  5EVD A;  3TP9 A;  3PY6 A;  5LE1 A;  1Y44 A;  2I7T A;  5LM6 A;  2P97 A;  5FQB A;  5ACW A;  2M5D A;  1ZTC A;  2NZF A;  4F6Z A;  2BFZ B;  5A0T A;  5EH9 A;  2Y8A A;  4RL2 A;  2GCU A;  3ZQ4 A;  3KL7 A;  4XWW A;  3IE2 A;  2UYX A;  1X8I A;  1WRA A;  2YNW A;  4TYT A;  1M2X A;  1VJN A;  5DPX A;  1K07 A;  5ACX A;  1WUO A;  4BZ3 A;  2QED A;  2WYM A;  3X2Y A;  4GCW A;  2BG8 A;  4GYQ A;  5EWA A;  2ZZI A;  2R2D A;  5B3R A;  1DD6 A;  2GFK A;  1L9Y A;  3ZNB A;  1KR3 A;  5B1U A;  3FCZ A;  3X2Z A;  4H0D A;  4D1T A;  4YSB A;  5ACR A;  3ADR A;  3KNS A;  2GKL A;  2BFZ A;  3SPU A;  5EW0 A;  3SBL A;  4KEP A;  5AHO A;  4Z67 A;  3ZWF A;  2BG7 A;  2BR6 A;  2OHI A;  5IQK A;  2WRS A;  4RBS A;  2FU7 A;  3IEK A;  1A7T A;  4AX0 B;  2YNT B;  2QIN A;  4O98 A;  1JJT A;  4NQ6 A;  5AHR A;  3I15 A;  3DHC A;  5FQA A;  3DHB A;  1HLK A;  2Y87 A;  1XM8 A;  4EY2 A;  1BMC A;  4RAM A;  4EXY A;  4Z60 A;  2QDS A;  5KIK A;  4TZ9 A;  2HB9 A;  4UWP B;  4TZB A;  2YZ3 A;  5LCH A;  4UA4 A;  2YNV A;  3L6N A;  5HIQ A;  3ESH A;  2DKF A;  3IOG A;  3SRX A;  3MD7 A;  5K4N A;  5EHT A;  5KIL A;  1XTO A;  2M5C A;  3IE1 A;  2WHG A;  2YCB A;  2NYP A;  4EYB A;  1X8G A; 
#chains in the Genus database with same CATH topology
 2CBN A;  3ZR9 A;  3P2U A;  3DH8 A;  2GFJ A;  4BP0 A;  4C1E A;  1QH3 A;  1P9E A;  4NQ5 A;  5ACT A;  5HH4 A;  4LE6 A;  4UWR B;  5HIP A;  2FM6 A;  1A8T A;  4GYU A;  5ACP A;  1E5D A;  4YSK A;  3Q6V A;  1YCF A;  3I13 A;  2BFL A;  2WYM C;  5AYA A;  4FEK A;  1JT1 A;  3BK2 A;  5AXO A;  4P62 A;  2H6A A;  4CHL A;  4XWT A;  5EVK A;  4RL0 A;  4XUK A;  1DXK A;  5HH5 A;  3I11 A;  4U4L A;  3SW3 A;  2WYL A;  2OHH A;  1VME A;  5FQC A;  4AX1 B;  5LCA A;  3T9M A;  2DOO A;  2YNV B;  3A4Y A;  5LCF A;  1X8H A;  4ZO3 A;  2FHX A;  2E7Y A;  5K4M A;  1KO2 A;  2FU9 A;  5ACU A;  3X2X A;  5LLD A;  3RKJ A;  4JO0 A;  4V0H A;  4D1V A;  2Y8B A;  2ZNB A;  3I14 A;  4C1H A;  4DIL A;  2OHJ A;  1WW1 A;  3IEM A;  1VGN A;  2A7M A;  4C1G A;  4AXH A;  5A5Z A;  5EV6 A;  4UWO B;  3IDZ A;  2AIO A;  3PY5 A;  5A23 A;  3G1P A;  4FR7 A;  4C1C A;  4UBQ A;  2Q42 A;  4RM5 A;  4RAW A;  3I0V A;  3VQZ A;  4ZNB A;  4Z7R A;  2FHX B;  1YCH A;  3AF6 A;  2I7V A;  1DDK A;  4HKY A;  2P4Z A;  4F6H A;  2BC2 A;  5AEB A;  4EFZ A;  3IEL A;  4TYF A;  3BK1 A;  1QH5 A;  2NXA A;  3FAI A;  4ZO2 A;  1MQO A;  3AF5 A;  2FK6 A;  3IE0 A;  5ACV A;  2I7X A;  3H3E A;  2BGA A;  4C1D A;  3DHA A;  4HL1 A;  3QH8 A;  4C09 A;  2P18 A;  2Q0J A;  4NQ4 A;  3LVZ A;  5ACQ A;  4TZE A;  5B15 A;  2ZO4 A;  3X30 A;  5K0W A;  2BIB A;  4AD9 A;  4EYF A;  3S0Z A;  3BV6 A;  2CFU A;  1ZNB A;  2AZ4 A;  2FU6 A;  4FSB A;  2XF4 A;  4D02 A;  3RKK A;  3WXC A;  2YNT A;  1ZKP A;  3AJ3 A;  5ACS A;  2BTN A;  4KEQ A;  2Q9U A;  4D1W A;  5HIS A;  4D1U A;  5LSC A;  2QDT A;  4PVO A;  2P1E A;  5LMC A;  4UAM A;  5A0V A;  4YSL A;  5LS3 A;  3BC2 A;  4EYL A;  1BVT A;  4J5H A;  3T3N A;  2Q0I A;  4WD6 A;  4Z6X A;  2BMI A;  2BG6 A;  2BFK A;  4PVT A;  4NQ2 A;  3F9O A;  2QJS A;  5AJL A;  2ZWR A;  3R2U A;  2BG2 A;  2NZE A;  1JJE A;  3SFP A;  2CFZ A;  3PG4 A;  4C1F A;  1KO3 A;  3IOF A;  4ZEJ A;  5HH6 A;  2GMN A;  4B87 A;  4DIK A;  3T3O A;  5K4K A;  2XR1 A;  3JXP A;  4J5F A;  3KNR A;  3SD9 A;  2FU8 A;  4Z5Y A;  2BG8 B;  5EVB A;  4PDX A;  3VPE A;  5EV8 A;  2VW8 A;  1BC2 A;  5HIO A;  4NUR A;  4AWY B;  1WUP A;  1YCG A;  2YNU A;  5A87 A;  1SML A;  4UWS B;  4Z5Z A;  5AXR A;  4HL2 A;  4TZF A;  4AWZ A;  3RPC A;  4EXS A;  5EVD A;  3TP9 A;  3PY6 A;  5LE1 A;  1Y44 A;  2I7T A;  5LM6 A;  2P97 A;  5FQB A;  5ACW A;  2M5D A;  1ZTC A;  2NZF A;  4F6Z A;  2BFZ B;  5A0T A;  5EH9 A;  2Y8A A;  4RL2 A;  2GCU A;  3ZQ4 A;  3KL7 A;  4XWW A;  2CG3 A;  2UYX A;  1X8I A;  3IE2 A;  1WRA A;  2YNW A;  4TYT A;  1M2X A;  1VJN A;  5DPX A;  1K07 A;  5ACX A;  1WUO A;  4BZ3 A;  2QED A;  2WYM A;  3X2Y A;  4GCW A;  2BG8 A;  4GYQ A;  5EWA A;  2ZZI A;  2R2D A;  5B3R A;  1DD6 A;  2GFK A;  1L9Y A;  3ZNB A;  1KR3 A;  5B1U A;  3FCZ A;  3X2Z A;  4H0D A;  4D1T A;  4YSB A;  5ACR A;  3ADR A;  3KNS A;  2GKL A;  2BFZ A;  5AIJ A;  3SPU A;  5EW0 A;  3SBL A;  4KEP A;  5AHO A;  4Z67 A;  3ZWF A;  2BG7 A;  2BR6 A;  2OHI A;  5IQK A;  2WRS A;  4RBS A;  2FU7 A;  3IEK A;  1A7T A;  4AX0 B;  2YNT B;  4AV7 A;  2QIN A;  4O98 A;  1JJT A;  4NQ6 A;  5AHR A;  3I15 A;  3DHC A;  5FQA A;  3DHB A;  1HLK A;  2Y87 A;  1XM8 A;  4EY2 A;  1BMC A;  4RAM A;  4EXY A;  4Z60 A;  2CG2 A;  2QDS A;  5KIK A;  4TZ9 A;  2HB9 A;  4UWP B;  4TZB A;  2YZ3 A;  5LCH A;  4UA4 A;  2YNV A;  3L6N A;  5HIQ A;  3ESH A;  2DKF A;  3IOG A;  3SRX A;  3MD7 A;  5K4N A;  5EHT A;  5KIL A;  1XTO A;  2M5C A;  3IE1 A;  2WHG A;  2YCB A;  2NYP A;  2YHE A;  4EYB A;  1X8G A; 
#chains in the Genus database with same CATH homology
 2CBN A;  3ZR9 A;  3P2U A;  3DH8 A;  2GFJ A;  4BP0 A;  4C1E A;  1QH3 A;  1P9E A;  4NQ5 A;  5ACT A;  5HH4 A;  4LE6 A;  4UWR B;  5HIP A;  2FM6 A;  1A8T A;  4GYU A;  5ACP A;  1E5D A;  4YSK A;  3Q6V A;  1YCF A;  3I13 A;  2BFL A;  2WYM C;  5AYA A;  4FEK A;  1JT1 A;  3BK2 A;  5AXO A;  4P62 A;  2H6A A;  4CHL A;  4XWT A;  5EVK A;  4RL0 A;  4XUK A;  1DXK A;  5HH5 A;  3I11 A;  4U4L A;  3SW3 A;  2WYL A;  2OHH A;  1VME A;  5FQC A;  4AX1 B;  5LCA A;  3T9M A;  2DOO A;  2YNV B;  3A4Y A;  5LCF A;  1X8H A;  4ZO3 A;  2FHX A;  2E7Y A;  5K4M A;  1KO2 A;  2FU9 A;  5ACU A;  3X2X A;  5LLD A;  3RKJ A;  4JO0 A;  4V0H A;  4D1V A;  2Y8B A;  2ZNB A;  3I14 A;  4C1H A;  4DIL A;  2OHJ A;  1WW1 A;  3IEM A;  1VGN A;  2A7M A;  4C1G A;  5A5Z A;  5EV6 A;  4UWO B;  3IDZ A;  2AIO A;  3PY5 A;  3G1P A;  4FR7 A;  4C1C A;  4UBQ A;  2Q42 A;  4RM5 A;  4RAW A;  3I0V A;  3VQZ A;  4ZNB A;  4Z7R A;  2FHX B;  1YCH A;  3AF6 A;  2I7V A;  1DDK A;  4HKY A;  2P4Z A;  4F6H A;  2BC2 A;  5AEB A;  4EFZ A;  3IEL A;  4TYF A;  3BK1 A;  1QH5 A;  2NXA A;  3FAI A;  4ZO2 A;  1MQO A;  3AF5 A;  2FK6 A;  3IE0 A;  5ACV A;  2I7X A;  3H3E A;  2BGA A;  4C1D A;  3DHA A;  4HL1 A;  3QH8 A;  4C09 A;  2P18 A;  2Q0J A;  4NQ4 A;  3LVZ A;  5ACQ A;  4TZE A;  5B15 A;  2ZO4 A;  3X30 A;  5K0W A;  2BIB A;  4AD9 A;  4EYF A;  3S0Z A;  3BV6 A;  1ZNB A;  2AZ4 A;  2FU6 A;  4FSB A;  2XF4 A;  4D02 A;  3RKK A;  3WXC A;  2YNT A;  1ZKP A;  3AJ3 A;  5ACS A;  2BTN A;  4KEQ A;  2Q9U A;  4D1W A;  5HIS A;  4D1U A;  5LSC A;  2QDT A;  4PVO A;  2P1E A;  5LMC A;  4UAM A;  5A0V A;  4YSL A;  5LS3 A;  3BC2 A;  4EYL A;  1BVT A;  4J5H A;  3T3N A;  2Q0I A;  4WD6 A;  4Z6X A;  2BMI A;  2BG6 A;  2BFK A;  4PVT A;  4NQ2 A;  3F9O A;  2QJS A;  2ZWR A;  3R2U A;  2BG2 A;  2NZE A;  1JJE A;  3SFP A;  3PG4 A;  4C1F A;  1KO3 A;  3IOF A;  4ZEJ A;  5HH6 A;  2GMN A;  4B87 A;  4DIK A;  3T3O A;  5K4K A;  2XR1 A;  3JXP A;  4J5F A;  3KNR A;  3SD9 A;  2FU8 A;  4Z5Y A;  2BG8 B;  5EVB A;  3VPE A;  5EV8 A;  2VW8 A;  1BC2 A;  5HIO A;  4AWY B;  1WUP A;  1YCG A;  2YNU A;  5A87 A;  1SML A;  4UWS B;  4Z5Z A;  5AXR A;  4HL2 A;  4TZF A;  4AWZ A;  3RPC A;  4EXS A;  5EVD A;  3TP9 A;  3PY6 A;  5LE1 A;  1Y44 A;  2I7T A;  5LM6 A;  2P97 A;  5FQB A;  5ACW A;  2M5D A;  1ZTC A;  2NZF A;  4F6Z A;  2BFZ B;  5A0T A;  5EH9 A;  2Y8A A;  4RL2 A;  2GCU A;  3ZQ4 A;  3KL7 A;  4XWW A;  3IE2 A;  2UYX A;  1X8I A;  1WRA A;  2YNW A;  4TYT A;  1M2X A;  1VJN A;  5DPX A;  1K07 A;  5ACX A;  1WUO A;  4BZ3 A;  2QED A;  2WYM A;  3X2Y A;  4GCW A;  2BG8 A;  4GYQ A;  5EWA A;  2ZZI A;  2R2D A;  5B3R A;  1DD6 A;  2GFK A;  1L9Y A;  3ZNB A;  1KR3 A;  5B1U A;  3FCZ A;  3X2Z A;  4H0D A;  4D1T A;  4YSB A;  5ACR A;  3ADR A;  3KNS A;  2GKL A;  2BFZ A;  3SPU A;  5EW0 A;  3SBL A;  4KEP A;  5AHO A;  4Z67 A;  3ZWF A;  2BG7 A;  2BR6 A;  2OHI A;  5IQK A;  2WRS A;  4RBS A;  2FU7 A;  3IEK A;  1A7T A;  4AX0 B;  2YNT B;  2QIN A;  4O98 A;  1JJT A;  4NQ6 A;  5AHR A;  3I15 A;  3DHC A;  5FQA A;  3DHB A;  1HLK A;  2Y87 A;  1XM8 A;  4EY2 A;  1BMC A;  4RAM A;  4EXY A;  4Z60 A;  2QDS A;  5KIK A;  4TZ9 A;  2HB9 A;  4UWP B;  4TZB A;  2YZ3 A;  5LCH A;  4UA4 A;  2YNV A;  3L6N A;  5HIQ A;  3ESH A;  2DKF A;  3IOG A;  3SRX A;  3MD7 A;  5K4N A;  5EHT A;  5KIL A;  1XTO A;  2M5C A;  3IE1 A;  2WHG A;  2YCB A;  2NYP A;  4EYB A;  1X8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...