5AEBA

Crystal structure of the class b3 di-zinc metallo-beta-lactamase lra- 12 from an alaskan soil metagenome.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
264
structure length
264
Chain Sequence
VKEPTVSNADWSKPYRPFRIAGNLYYIGTYDLACYLITTKQGNIIVNTGLAASALQIKNNIKALGFKLTDTKILLTTQAHYDHLGAMAEIKKITGAKLMADEGDATVMADGGSSDYAFGGHGSMFEPIIADRLLHDKDTIQLGDTKLVMLHHPGHTKGSCSFLFDTKDEQRSYRILIANMPTIVIEKKFSEVSSYPGIAKDYAYTLQAMKNLSFDIWVASHASQFSMHSKHKPGDGYNPKSFMDRKGYDESLDKLQKEYEKHLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LRA-12
publication title Crystal structure and kinetic analysis of the class B3 di-zinc metallo-beta-lactamase LRA-12 from an Alaskan soil metagenome.
pubmed doi rcsb
molecule tags Hydrolase
total genus 85
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5aebA00
4XWWA 5KILA 2Q0IA 1A7TA 2E7YA 3I0VA 2WYMA 2NZFA 2ZO4A 1BVTA 1VGNA 2BMIA 2P97A 3IOFA 1BMCA 3Q6VA 5HIOA 3L6NA 4J5HA 3X30A 1JT1A 2FU7A 5AHRA 2DOOA 5DPXA 4FR7A 2Q9UA 3G1PA 5AXOA 4O98A 4C1GA 4D1TA 1QH5A 1WUOA 2Q0JA 2OHHA 1X8GA 2YCBA 3WXCA 2YNTA 3ADRA 3QH8A 2ZZIA 5B3RA 4NQ4A 3S0ZA 3PG4A 2XR1A 2HB9A 4EXSA 5ACTA 4Z5ZA 3X2XA 4RBSA 3I14A 3TP9A 4GYUA 3BK2A 3IDZA 1DXKA 2BFZB 4Z60A 2BR6A 4AX1B 1YCFA 5ACXA 1M2XA 4EYFA 1L9YA 1VMEA 3I15A 3BV6A 3RKJA 4J5FA 5AXRA 2Q42A 2R2DA 2WYLA 2YNUA 4C1HA 2UYXA 4GYQA 1Y44A 2Y87A 2BC2A 4LE6A 3SRXA 3H3EA 5K4MA 5K4NA 4ZEJA 5EV8A 2FU9A 4NQ2A 4FEKA 1BC2A 5EW0A 5ACVA 2QDSA 2OHJA 1SMLA 2P4ZA 2QDTA 2CBNA 4NQ6A 3IOGA 2M5DA 3DHCA 4C1FA 3BK1A 1P9EA 4UBQA 2DKFA 4Z6XA 4YSBA 2BG8B 2WRSA 5HIQA 5K4KA 4RL0A 4BP0A 3LVZA 2BIBA 1ZTCA 5A0TA 5EH9A 1XM8A 2NXAA 2VW8A 1DDKA 3ZNBA 2I7TA 3KNRA 2M5CA 5EV6A 4TZEA 4BZ3A 3R2UA 5A0VA 5HISA 5HH4A 2FU8A 4Z7RA 3IEKA 2Y8AA 5LCHA 5HH5A 5LCFA 4C09A 4UA4A 2QEDA 5ACRA 2FHXB 2YNVA 2P18A 4ZO2A 1JJTA 5KIKA 1DD6A 1HLKA 4AX0B 2FU6A 5A87A 5EHTA 3X2ZA 2AIOA 5EVDA 4C1CA 5FQCA 2Y8BA 5B15A 5LCAA 5LLDA 3DHBA 2I7XA 4FSBA 2NZEA 2YNWA 4Z5YA 3SW3A 4F6HA 2YNTB 4ZO3A 4EYLA 5AEBA 2FM6A 4B87A 4ZNBA 2GKLA 1E5DA 5IQKA 4UAMA 4D1UA 4TYFA 5EVBA 4U4LA 2WHGA 4D1VA 4HKYA 2XF4A 4D1WA 4KEQA 4CHLA 4EFZA 4HL2A 4AWZA 4PVTA 5HH6A 5ACUA 2ZWRA 1YCHA 5ACWA 4H0DA 2BGAA 2BFKA 3SPUA 4Z67A 4PVOA 3AF6A 3VPEA 5K0WA 4WD6A 1A8TA 2I7VA 3FAIA 3IE2A 3I13A 3SFPA 5EWAA 2GFKA 3IE0A 5LM6A 2BG2A 3FCZA 4YSLA 4TZBA 4JO0A 3PY5A 3AF5A 3VQZA 2OHIA 3ZR9A 4UWOB 3SBLA 2FHXA 2BG6A 3BC2A 5LSCA 5ACPA 5EVKA 1VJNA 3ESHA 3KNSA 4NQ5A 4UWPB 3T3OA 4C1EA 3JXPA 4AD9A 2GCUA 4YSKA 1MQOA 2QINA 3P2UA 1JJEA 4XUKA 2BFZA 1WUPA 3AJ3A 2AZ4A 2NYPA 4UWSB 1KO3A 4P62A 2BTNA 4HL1A 2P1EA 5B1UA 5ACSA 4RAWA 3IELA 3I11A 5A5ZA 4TYTA 4AWYB 3KL7A 4EY2A 3MD7A 3RPCA 4TZ9A 2FK6A 5AHOA 1YCGA 3T9MA 3X2YA 2YNVB 4RAMA 1QH3A 4V0HA 1X8IA 3DH8A 5FQBA 2YZ3A 3A4YA 2BG7A 4RL2A 4DILA 1WW1A 1K07A 1KO2A 2BG8A 4D02A 5LS3A 5LE1A 3ZWFA 4EXYA 3RKKA 5FQAA 5AYAA 2A7MA 4GCWA 3IE1A 2BFLA 3T3NA 2H6AA 5LMCA 1XTOA 1KR3A 5ACQA 4F6ZA 1WRAA 4UWRB 1X8HA 2ZNBA 4KEPA 3PY6A 3F9OA 4C1DA 3IEMA 4EYBA 3DHAA 4XWTA 3SD9A 2QJSA 4TZFA 4RM5A 2GFJA 3ZQ4A 4DIKA 1ZKPA 2WYMC 2GMNA 5HIPA 1ZNBA
chains in the Genus database with same CATH superfamily
4XWWA 5KILA 2Q0IA 1A7TA 2E7YA 3I0VA 2WYMA 2NZFA 2ZO4A 1BVTA 1VGNA 2BMIA 2P97A 3IOFA 1BMCA 3Q6VA 5HIOA 3L6NA 4J5HA 3X30A 1JT1A 2FU7A 5AHRA 2DOOA 2CG2A 5DPXA 4FR7A 2Q9UA 3G1PA 5AXOA 4O98A 4C1GA 4D1TA 1QH5A 1WUOA 2Q0JA 2OHHA 1X8GA 2YCBA 3WXCA 2YNTA 3ADRA 3QH8A 2ZZIA 5B3RA 4NQ4A 3S0ZA 3PG4A 2XR1A 2HB9A 4EXSA 5ACTA 4Z5ZA 3X2XA 2CFUA 3I14A 4RBSA 3TP9A 4GYUA 3BK2A 3IDZA 1DXKA 5AIJA 2BFZB 4Z60A 2BR6A 4AX1B 1YCFA 5ACXA 1M2XA 4EYFA 1L9YA 1VMEA 3I15A 3BV6A 3RKJA 4J5FA 5AXRA 2Q42A 2R2DA 2WYLA 2YNUA 4C1HA 2UYXA 4GYQA 1Y44A 2Y87A 2BC2A 4LE6A 3SRXA 3H3EA 5K4MA 5K4NA 4ZEJA 5EV8A 2FU9A 4NQ2A 4FEKA 1BC2A 5EW0A 5ACVA 2QDSA 2OHJA 1SMLA 2P4ZA 2QDTA 2CBNA 4NQ6A 3IOGA 2M5DA 3DHCA 4C1FA 3BK1A 1P9EA 4UBQA 2DKFA 4Z6XA 4YSBA 2BG8B 2WRSA 5HIQA 5K4KA 4RL0A 4BP0A 3LVZA 2BIBA 1ZTCA 5A0TA 5EH9A 1XM8A 2YHEA 2NXAA 2VW8A 1DDKA 3ZNBA 2I7TA 3KNRA 2M5CA 5EV6A 4TZEA 4BZ3A 3R2UA 5A0VA 5HISA 5HH4A 2FU8A 4Z7RA 3IEKA 2Y8AA 5LCHA 5HH5A 5LCFA 4C09A 4UA4A 2QEDA 5ACRA 2FHXB 2YNVA 2P18A 4ZO2A 5A23A 1JJTA 5AJLA 5KIKA 1DD6A 1HLKA 4AX0B 2CG3A 2FU6A 5A87A 5EHTA 3X2ZA 2AIOA 5EVDA 4C1CA 5FQCA 2Y8BA 5B15A 5LCAA 5LLDA 3DHBA 2I7XA 4FSBA 2NZEA 2YNWA 4Z5YA 3SW3A 4F6HA 2YNTB 4ZO3A 4EYLA 5AEBA 2FM6A 4B87A 4ZNBA 2GKLA 1E5DA 5IQKA 4UAMA 4D1UA 4TYFA 5EVBA 4U4LA 2WHGA 4D1VA 4HKYA 2XF4A 4D1WA 4KEQA 4CHLA 4EFZA 4HL2A 4AWZA 4PVTA 5HH6A 5ACUA 2ZWRA 1YCHA 5ACWA 4H0DA 2BGAA 2BFKA 3SPUA 4Z67A 4PVOA 4NURA 3AF6A 3VPEA 5K0WA 4WD6A 4AXHA 1A8TA 2I7VA 3FAIA 3IE2A 3I13A 3SFPA 5EWAA 2GFKA 3IE0A 5LM6A 2BG2A 3FCZA 4YSLA 4TZBA 4JO0A 3PY5A 3AF5A 3VQZA 2OHIA 3ZR9A 4UWOB 3SBLA 2FHXA 2BG6A 3BC2A 5LSCA 5ACPA 5EVKA 1VJNA 3ESHA 2CFZA 3KNSA 4NQ5A 4UWPB 3T3OA 4C1EA 3JXPA 4AD9A 2GCUA 4YSKA 1MQOA 2QINA 3P2UA 1JJEA 4XUKA 2BFZA 1WUPA 3AJ3A 2AZ4A 2NYPA 4UWSB 1KO3A 4P62A 2BTNA 4HL1A 4AV7A 2P1EA 5B1UA 5ACSA 4RAWA 3IELA 3I11A 5A5ZA 4TYTA 4AWYB 3KL7A 4EY2A 3MD7A 3RPCA 4TZ9A 2FK6A 5AHOA 1YCGA 3T9MA 3X2YA 2YNVB 4RAMA 1QH3A 4V0HA 1X8IA 3DH8A 5FQBA 2YZ3A 3A4YA 2BG7A 4RL2A 4PDXA 4DILA 1WW1A 1K07A 1KO2A 2BG8A 4D02A 5LS3A 5LE1A 3ZWFA 4EXYA 3RKKA 5FQAA 5AYAA 2A7MA 4GCWA 3IE1A 2BFLA 3T3NA 2H6AA 5LMCA 1XTOA 1KR3A 5ACQA 4F6ZA 1WRAA 4UWRB 1X8HA 2ZNBA 4KEPA 3PY6A 3F9OA 4C1DA 3IEMA 4EYBA 3DHAA 4XWTA 3SD9A 2QJSA 4TZFA 4RM5A 2GFJA 3ZQ4A 4DIKA 1ZKPA 2WYMC 2GMNA 5HIPA 1ZNBA
chains in the Genus database with same CATH topology
4XWWA 5KILA 2Q0IA 1A7TA 2E7YA 3I0VA 2WYMA 2NZFA 2ZO4A 1BVTA 1VGNA 2BMIA 2P97A 3IOFA 1BMCA 3Q6VA 5HIOA 3L6NA 4J5HA 3X30A 1JT1A 2FU7A 5AHRA 2DOOA 5DPXA 4FR7A 2Q9UA 3G1PA 5AXOA 4O98A 4C1GA 4D1TA 1QH5A 1WUOA 2Q0JA 2OHHA 1X8GA 2YCBA 3WXCA 2YNTA 3ADRA 3QH8A 2ZZIA 5B3RA 4NQ4A 3S0ZA 3PG4A 2XR1A 2HB9A 4EXSA 5ACTA 4Z5ZA 3X2XA 4RBSA 3I14A 3TP9A 4GYUA 3BK2A 3IDZA 1DXKA 2BFZB 4Z60A 2BR6A 4AX1B 1YCFA 5ACXA 1M2XA 4EYFA 1L9YA 1VMEA 3I15A 3BV6A 3RKJA 4J5FA 5AXRA 2Q42A 2R2DA 2WYLA 2YNUA 4C1HA 2UYXA 4GYQA 1Y44A 2Y87A 2BC2A 4LE6A 3SRXA 3H3EA 5K4MA 5K4NA 4ZEJA 5EV8A 2FU9A 4NQ2A 4FEKA 1BC2A 5EW0A 5ACVA 2QDSA 2OHJA 1SMLA 2P4ZA 2QDTA 2CBNA 4NQ6A 3IOGA 2M5DA 3DHCA 4C1FA 3BK1A 1P9EA 4UBQA 2DKFA 4Z6XA 4YSBA 2BG8B 2WRSA 5HIQA 5K4KA 4RL0A 4BP0A 3LVZA 2BIBA 1ZTCA 5A0TA 5EH9A 1XM8A 2NXAA 2VW8A 1DDKA 3ZNBA 2I7TA 3KNRA 2M5CA 5EV6A 4TZEA 4BZ3A 3R2UA 5A0VA 5HISA 5HH4A 2FU8A 4Z7RA 3IEKA 2Y8AA 5LCHA 5HH5A 5LCFA 4C09A 4UA4A 2QEDA 5ACRA 2FHXB 2YNVA 2P18A 4ZO2A 1JJTA 5KIKA 1DD6A 1HLKA 4AX0B 2FU6A 5A87A 5EHTA 3X2ZA 2AIOA 5EVDA 4C1CA 5FQCA 2Y8BA 5B15A 5LCAA 5LLDA 3DHBA 2I7XA 4FSBA 2NZEA 2YNWA 4Z5YA 3SW3A 4F6HA 2YNTB 4ZO3A 4EYLA 5AEBA 2FM6A 4B87A 4ZNBA 2GKLA 1E5DA 5IQKA 4UAMA 4D1UA 4TYFA 5EVBA 4U4LA 2WHGA 4D1VA 4HKYA 2XF4A 4D1WA 4KEQA 4CHLA 4EFZA 4HL2A 4AWZA 4PVTA 5HH6A 5ACUA 2ZWRA 1YCHA 5ACWA 4H0DA 2BGAA 2BFKA 3SPUA 4Z67A 4PVOA 3AF6A 3VPEA 5K0WA 4WD6A 1A8TA 2I7VA 3FAIA 3IE2A 3I13A 3SFPA 5EWAA 2GFKA 3IE0A 5LM6A 2BG2A 3FCZA 4YSLA 4TZBA 4JO0A 3PY5A 3AF5A 3VQZA 2OHIA 3ZR9A 4UWOB 3SBLA 2FHXA 2BG6A 3BC2A 5LSCA 5ACPA 5EVKA 1VJNA 3ESHA 3KNSA 4NQ5A 4UWPB 3T3OA 4C1EA 3JXPA 4AD9A 2GCUA 4YSKA 1MQOA 2QINA 3P2UA 1JJEA 4XUKA 2BFZA 1WUPA 3AJ3A 2AZ4A 2NYPA 4UWSB 1KO3A 4P62A 2BTNA 4HL1A 2P1EA 5B1UA 5ACSA 4RAWA 3IELA 3I11A 5A5ZA 4TYTA 4AWYB 3KL7A 4EY2A 3MD7A 3RPCA 4TZ9A 2FK6A 5AHOA 1YCGA 3T9MA 3X2YA 2YNVB 4RAMA 1QH3A 4V0HA 1X8IA 3DH8A 5FQBA 2YZ3A 3A4YA 2BG7A 4RL2A 4DILA 1WW1A 1K07A 1KO2A 2BG8A 4D02A 5LS3A 5LE1A 3ZWFA 4EXYA 3RKKA 5FQAA 5AYAA 2A7MA 4GCWA 3IE1A 2BFLA 3T3NA 2H6AA 5LMCA 1XTOA 1KR3A 5ACQA 4F6ZA 1WRAA 4UWRB 1X8HA 2ZNBA 4KEPA 3PY6A 3F9OA 4C1DA 3IEMA 4EYBA 3DHAA 4XWTA 3SD9A 2QJSA 4TZFA 4RM5A 2GFJA 3ZQ4A 4DIKA 1ZKPA 2WYMC 2GMNA 5HIPA 1ZNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XWW A;  5KIL A;  2Q0I A;  1A7T A;  2E7Y A;  3I0V A;  2WYM A;  2NZF A;  2ZO4 A;  1BVT A;  1VGN A;  2BMI A;  2P97 A;  3IOF A;  1BMC A;  3Q6V A;  5HIO A;  3L6N A;  4J5H A;  3X30 A;  1JT1 A;  2FU7 A;  5AHR A;  2DOO A;  5DPX A;  4FR7 A;  2Q9U A;  3G1P A;  5AXO A;  4O98 A;  4C1G A;  4D1T A;  1QH5 A;  1WUO A;  2Q0J A;  2OHH A;  1X8G A;  2YCB A;  3WXC A;  2YNT A;  3ADR A;  3QH8 A;  2ZZI A;  5B3R A;  4NQ4 A;  3S0Z A;  3PG4 A;  2XR1 A;  2HB9 A;  4EXS A;  5ACT A;  4Z5Z A;  3X2X A;  4RBS A;  3I14 A;  3TP9 A;  4GYU A;  3BK2 A;  3IDZ A;  1DXK A;  2BFZ B;  4Z60 A;  2BR6 A;  4AX1 B;  1YCF A;  5ACX A;  1M2X A;  4EYF A;  1L9Y A;  1VME A;  3I15 A;  3BV6 A;  3RKJ A;  4J5F A;  5AXR A;  2Q42 A;  2R2D A;  2WYL A;  2YNU A;  4C1H A;  2UYX A;  4GYQ A;  1Y44 A;  2Y87 A;  2BC2 A;  4LE6 A;  3SRX A;  3H3E A;  5K4M A;  5K4N A;  4ZEJ A;  5EV8 A;  2FU9 A;  4NQ2 A;  4FEK A;  1BC2 A;  5EW0 A;  5ACV A;  2QDS A;  2OHJ A;  1SML A;  2P4Z A;  2QDT A;  2CBN A;  4NQ6 A;  3IOG A;  2M5D A;  3DHC A;  4C1F A;  3BK1 A;  1P9E A;  4UBQ A;  2DKF A;  4Z6X A;  4YSB A;  2BG8 B;  2WRS A;  5HIQ A;  5K4K A;  4RL0 A;  4BP0 A;  3LVZ A;  2BIB A;  1ZTC A;  5A0T A;  5EH9 A;  1XM8 A;  2NXA A;  2VW8 A;  1DDK A;  3ZNB A;  2I7T A;  3KNR A;  2M5C A;  5EV6 A;  4TZE A;  4BZ3 A;  3R2U A;  5A0V A;  5HIS A;  5HH4 A;  2FU8 A;  4Z7R A;  3IEK A;  2Y8A A;  5LCH A;  5HH5 A;  5LCF A;  4C09 A;  4UA4 A;  2QED A;  5ACR A;  2FHX B;  2YNV A;  2P18 A;  4ZO2 A;  1JJT A;  5KIK A;  1DD6 A;  1HLK A;  4AX0 B;  2FU6 A;  5A87 A;  5EHT A;  3X2Z A;  2AIO A;  5EVD A;  4C1C A;  5FQC A;  2Y8B A;  5B15 A;  5LCA A;  5LLD A;  3DHB A;  2I7X A;  4FSB A;  2NZE A;  2YNW A;  4Z5Y A;  3SW3 A;  4F6H A;  2YNT B;  4ZO3 A;  4EYL A;  5AEB A;  2FM6 A;  4B87 A;  4ZNB A;  2GKL A;  1E5D A;  5IQK A;  4UAM A;  4D1U A;  4TYF A;  5EVB A;  4U4L A;  2WHG A;  4D1V A;  4HKY A;  2XF4 A;  4D1W A;  4KEQ A;  4CHL A;  4EFZ A;  4HL2 A;  4AWZ A;  4PVT A;  5HH6 A;  5ACU A;  2ZWR A;  1YCH A;  5ACW A;  4H0D A;  2BGA A;  2BFK A;  3SPU A;  4Z67 A;  4PVO A;  3AF6 A;  3VPE A;  5K0W A;  4WD6 A;  1A8T A;  2I7V A;  3FAI A;  3IE2 A;  3I13 A;  3SFP A;  5EWA A;  2GFK A;  3IE0 A;  5LM6 A;  2BG2 A;  3FCZ A;  4YSL A;  4TZB A;  4JO0 A;  3PY5 A;  3AF5 A;  3VQZ A;  2OHI A;  3ZR9 A;  4UWO B;  3SBL A;  2FHX A;  2BG6 A;  3BC2 A;  5LSC A;  5ACP A;  5EVK A;  1VJN A;  3ESH A;  3KNS A;  4NQ5 A;  4UWP B;  3T3O A;  4C1E A;  3JXP A;  4AD9 A;  2GCU A;  4YSK A;  1MQO A;  2QIN A;  3P2U A;  1JJE A;  4XUK A;  2BFZ A;  1WUP A;  3AJ3 A;  2AZ4 A;  2NYP A;  4UWS B;  1KO3 A;  4P62 A;  2BTN A;  4HL1 A;  2P1E A;  5B1U A;  5ACS A;  4RAW A;  3IEL A;  3I11 A;  5A5Z A;  4TYT A;  4AWY B;  3KL7 A;  4EY2 A;  3MD7 A;  3RPC A;  4TZ9 A;  2FK6 A;  5AHO A;  1YCG A;  3T9M A;  3X2Y A;  2YNV B;  4RAM A;  1QH3 A;  4V0H A;  1X8I A;  3DH8 A;  5FQB A;  2YZ3 A;  3A4Y A;  2BG7 A;  4RL2 A;  4DIL A;  1WW1 A;  1K07 A;  1KO2 A;  2BG8 A;  4D02 A;  5LS3 A;  5LE1 A;  3ZWF A;  4EXY A;  3RKK A;  5FQA A;  5AYA A;  2A7M A;  4GCW A;  3IE1 A;  2BFL A;  3T3N A;  2H6A A;  5LMC A;  1XTO A;  1KR3 A;  5ACQ A;  4F6Z A;  1WRA A;  4UWR B;  1X8H A;  2ZNB A;  4KEP A;  3PY6 A;  3F9O A;  4C1D A;  3IEM A;  4EYB A;  3DHA A;  4XWT A;  3SD9 A;  2QJS A;  4TZF A;  4RM5 A;  2GFJ A;  3ZQ4 A;  4DIK A;  1ZKP A;  2WYM C;  2GMN A;  5HIP A;  1ZNB A; 
#chains in the Genus database with same CATH topology
 4XWW A;  5KIL A;  2Q0I A;  1A7T A;  2E7Y A;  3I0V A;  2WYM A;  2NZF A;  2ZO4 A;  1BVT A;  1VGN A;  2BMI A;  2P97 A;  3IOF A;  1BMC A;  3Q6V A;  5HIO A;  3L6N A;  4J5H A;  3X30 A;  1JT1 A;  2FU7 A;  5AHR A;  2DOO A;  2CG2 A;  5DPX A;  4FR7 A;  2Q9U A;  3G1P A;  5AXO A;  4O98 A;  4C1G A;  4D1T A;  1QH5 A;  1WUO A;  2Q0J A;  2OHH A;  1X8G A;  2YCB A;  3WXC A;  2YNT A;  3ADR A;  3QH8 A;  2ZZI A;  5B3R A;  4NQ4 A;  3S0Z A;  3PG4 A;  2XR1 A;  2HB9 A;  4EXS A;  5ACT A;  4Z5Z A;  3X2X A;  2CFU A;  3I14 A;  4RBS A;  3TP9 A;  4GYU A;  3BK2 A;  3IDZ A;  1DXK A;  5AIJ A;  2BFZ B;  4Z60 A;  2BR6 A;  4AX1 B;  1YCF A;  5ACX A;  1M2X A;  4EYF A;  1L9Y A;  1VME A;  3I15 A;  3BV6 A;  3RKJ A;  4J5F A;  5AXR A;  2Q42 A;  2R2D A;  2WYL A;  2YNU A;  4C1H A;  2UYX A;  4GYQ A;  1Y44 A;  2Y87 A;  2BC2 A;  4LE6 A;  3SRX A;  3H3E A;  5K4M A;  5K4N A;  4ZEJ A;  5EV8 A;  2FU9 A;  4NQ2 A;  4FEK A;  1BC2 A;  5EW0 A;  5ACV A;  2QDS A;  2OHJ A;  1SML A;  2P4Z A;  2QDT A;  2CBN A;  4NQ6 A;  3IOG A;  2M5D A;  3DHC A;  4C1F A;  3BK1 A;  1P9E A;  4UBQ A;  2DKF A;  4Z6X A;  4YSB A;  2BG8 B;  2WRS A;  5HIQ A;  5K4K A;  4RL0 A;  4BP0 A;  3LVZ A;  2BIB A;  1ZTC A;  5A0T A;  5EH9 A;  1XM8 A;  2YHE A;  2NXA A;  2VW8 A;  1DDK A;  3ZNB A;  2I7T A;  3KNR A;  2M5C A;  5EV6 A;  4TZE A;  4BZ3 A;  3R2U A;  5A0V A;  5HIS A;  5HH4 A;  2FU8 A;  4Z7R A;  3IEK A;  2Y8A A;  5LCH A;  5HH5 A;  5LCF A;  4C09 A;  4UA4 A;  2QED A;  5ACR A;  2FHX B;  2YNV A;  2P18 A;  4ZO2 A;  5A23 A;  1JJT A;  5AJL A;  5KIK A;  1DD6 A;  1HLK A;  4AX0 B;  2CG3 A;  2FU6 A;  5A87 A;  5EHT A;  3X2Z A;  2AIO A;  5EVD A;  4C1C A;  5FQC A;  2Y8B A;  5B15 A;  5LCA A;  5LLD A;  3DHB A;  2I7X A;  4FSB A;  2NZE A;  2YNW A;  4Z5Y A;  3SW3 A;  4F6H A;  2YNT B;  4ZO3 A;  4EYL A;  5AEB A;  2FM6 A;  4B87 A;  4ZNB A;  2GKL A;  1E5D A;  5IQK A;  4UAM A;  4D1U A;  4TYF A;  5EVB A;  4U4L A;  2WHG A;  4D1V A;  4HKY A;  2XF4 A;  4D1W A;  4KEQ A;  4CHL A;  4EFZ A;  4HL2 A;  4AWZ A;  4PVT A;  5HH6 A;  5ACU A;  2ZWR A;  1YCH A;  5ACW A;  4H0D A;  2BGA A;  2BFK A;  3SPU A;  4Z67 A;  4PVO A;  4NUR A;  3AF6 A;  3VPE A;  5K0W A;  4WD6 A;  4AXH A;  1A8T A;  2I7V A;  3FAI A;  3IE2 A;  3I13 A;  3SFP A;  5EWA A;  2GFK A;  3IE0 A;  5LM6 A;  2BG2 A;  3FCZ A;  4YSL A;  4TZB A;  4JO0 A;  3PY5 A;  3AF5 A;  3VQZ A;  2OHI A;  3ZR9 A;  4UWO B;  3SBL A;  2FHX A;  2BG6 A;  3BC2 A;  5LSC A;  5ACP A;  5EVK A;  1VJN A;  3ESH A;  2CFZ A;  3KNS A;  4NQ5 A;  4UWP B;  3T3O A;  4C1E A;  3JXP A;  4AD9 A;  2GCU A;  4YSK A;  1MQO A;  2QIN A;  3P2U A;  1JJE A;  4XUK A;  2BFZ A;  1WUP A;  3AJ3 A;  2AZ4 A;  2NYP A;  4UWS B;  1KO3 A;  4P62 A;  2BTN A;  4HL1 A;  4AV7 A;  2P1E A;  5B1U A;  5ACS A;  4RAW A;  3IEL A;  3I11 A;  5A5Z A;  4TYT A;  4AWY B;  3KL7 A;  4EY2 A;  3MD7 A;  3RPC A;  4TZ9 A;  2FK6 A;  5AHO A;  1YCG A;  3T9M A;  3X2Y A;  2YNV B;  4RAM A;  1QH3 A;  4V0H A;  1X8I A;  3DH8 A;  5FQB A;  2YZ3 A;  3A4Y A;  2BG7 A;  4RL2 A;  4PDX A;  4DIL A;  1WW1 A;  1K07 A;  1KO2 A;  2BG8 A;  4D02 A;  5LS3 A;  5LE1 A;  3ZWF A;  4EXY A;  3RKK A;  5FQA A;  5AYA A;  2A7M A;  4GCW A;  3IE1 A;  2BFL A;  3T3N A;  2H6A A;  5LMC A;  1XTO A;  1KR3 A;  5ACQ A;  4F6Z A;  1WRA A;  4UWR B;  1X8H A;  2ZNB A;  4KEP A;  3PY6 A;  3F9O A;  4C1D A;  3IEM A;  4EYB A;  3DHA A;  4XWT A;  3SD9 A;  2QJS A;  4TZF A;  4RM5 A;  2GFJ A;  3ZQ4 A;  4DIK A;  1ZKP A;  2WYM C;  2GMN A;  5HIP A;  1ZNB A; 
#chains in the Genus database with same CATH homology
 4XWW A;  5KIL A;  2Q0I A;  1A7T A;  2E7Y A;  3I0V A;  2WYM A;  2NZF A;  2ZO4 A;  1BVT A;  1VGN A;  2BMI A;  2P97 A;  3IOF A;  1BMC A;  3Q6V A;  5HIO A;  3L6N A;  4J5H A;  3X30 A;  1JT1 A;  2FU7 A;  5AHR A;  2DOO A;  5DPX A;  4FR7 A;  2Q9U A;  3G1P A;  5AXO A;  4O98 A;  4C1G A;  4D1T A;  1QH5 A;  1WUO A;  2Q0J A;  2OHH A;  1X8G A;  2YCB A;  3WXC A;  2YNT A;  3ADR A;  3QH8 A;  2ZZI A;  5B3R A;  4NQ4 A;  3S0Z A;  3PG4 A;  2XR1 A;  2HB9 A;  4EXS A;  5ACT A;  4Z5Z A;  3X2X A;  4RBS A;  3I14 A;  3TP9 A;  4GYU A;  3BK2 A;  3IDZ A;  1DXK A;  2BFZ B;  4Z60 A;  2BR6 A;  4AX1 B;  1YCF A;  5ACX A;  1M2X A;  4EYF A;  1L9Y A;  1VME A;  3I15 A;  3BV6 A;  3RKJ A;  4J5F A;  5AXR A;  2Q42 A;  2R2D A;  2WYL A;  2YNU A;  4C1H A;  2UYX A;  4GYQ A;  1Y44 A;  2Y87 A;  2BC2 A;  4LE6 A;  3SRX A;  3H3E A;  5K4M A;  5K4N A;  4ZEJ A;  5EV8 A;  2FU9 A;  4NQ2 A;  4FEK A;  1BC2 A;  5EW0 A;  5ACV A;  2QDS A;  2OHJ A;  1SML A;  2P4Z A;  2QDT A;  2CBN A;  4NQ6 A;  3IOG A;  2M5D A;  3DHC A;  4C1F A;  3BK1 A;  1P9E A;  4UBQ A;  2DKF A;  4Z6X A;  4YSB A;  2BG8 B;  2WRS A;  5HIQ A;  5K4K A;  4RL0 A;  4BP0 A;  3LVZ A;  2BIB A;  1ZTC A;  5A0T A;  5EH9 A;  1XM8 A;  2NXA A;  2VW8 A;  1DDK A;  3ZNB A;  2I7T A;  3KNR A;  2M5C A;  5EV6 A;  4TZE A;  4BZ3 A;  3R2U A;  5A0V A;  5HIS A;  5HH4 A;  2FU8 A;  4Z7R A;  3IEK A;  2Y8A A;  5LCH A;  5HH5 A;  5LCF A;  4C09 A;  4UA4 A;  2QED A;  5ACR A;  2FHX B;  2YNV A;  2P18 A;  4ZO2 A;  1JJT A;  5KIK A;  1DD6 A;  1HLK A;  4AX0 B;  2FU6 A;  5A87 A;  5EHT A;  3X2Z A;  2AIO A;  5EVD A;  4C1C A;  5FQC A;  2Y8B A;  5B15 A;  5LCA A;  5LLD A;  3DHB A;  2I7X A;  4FSB A;  2NZE A;  2YNW A;  4Z5Y A;  3SW3 A;  4F6H A;  2YNT B;  4ZO3 A;  4EYL A;  5AEB A;  2FM6 A;  4B87 A;  4ZNB A;  2GKL A;  1E5D A;  5IQK A;  4UAM A;  4D1U A;  4TYF A;  5EVB A;  4U4L A;  2WHG A;  4D1V A;  4HKY A;  2XF4 A;  4D1W A;  4KEQ A;  4CHL A;  4EFZ A;  4HL2 A;  4AWZ A;  4PVT A;  5HH6 A;  5ACU A;  2ZWR A;  1YCH A;  5ACW A;  4H0D A;  2BGA A;  2BFK A;  3SPU A;  4Z67 A;  4PVO A;  3AF6 A;  3VPE A;  5K0W A;  4WD6 A;  1A8T A;  2I7V A;  3FAI A;  3IE2 A;  3I13 A;  3SFP A;  5EWA A;  2GFK A;  3IE0 A;  5LM6 A;  2BG2 A;  3FCZ A;  4YSL A;  4TZB A;  4JO0 A;  3PY5 A;  3AF5 A;  3VQZ A;  2OHI A;  3ZR9 A;  4UWO B;  3SBL A;  2FHX A;  2BG6 A;  3BC2 A;  5LSC A;  5ACP A;  5EVK A;  1VJN A;  3ESH A;  3KNS A;  4NQ5 A;  4UWP B;  3T3O A;  4C1E A;  3JXP A;  4AD9 A;  2GCU A;  4YSK A;  1MQO A;  2QIN A;  3P2U A;  1JJE A;  4XUK A;  2BFZ A;  1WUP A;  3AJ3 A;  2AZ4 A;  2NYP A;  4UWS B;  1KO3 A;  4P62 A;  2BTN A;  4HL1 A;  2P1E A;  5B1U A;  5ACS A;  4RAW A;  3IEL A;  3I11 A;  5A5Z A;  4TYT A;  4AWY B;  3KL7 A;  4EY2 A;  3MD7 A;  3RPC A;  4TZ9 A;  2FK6 A;  5AHO A;  1YCG A;  3T9M A;  3X2Y A;  2YNV B;  4RAM A;  1QH3 A;  4V0H A;  1X8I A;  3DH8 A;  5FQB A;  2YZ3 A;  3A4Y A;  2BG7 A;  4RL2 A;  4DIL A;  1WW1 A;  1K07 A;  1KO2 A;  2BG8 A;  4D02 A;  5LS3 A;  5LE1 A;  3ZWF A;  4EXY A;  3RKK A;  5FQA A;  5AYA A;  2A7M A;  4GCW A;  3IE1 A;  2BFL A;  3T3N A;  2H6A A;  5LMC A;  1XTO A;  1KR3 A;  5ACQ A;  4F6Z A;  1WRA A;  4UWR B;  1X8H A;  2ZNB A;  4KEP A;  3PY6 A;  3F9O A;  4C1D A;  3IEM A;  4EYB A;  3DHA A;  4XWT A;  3SD9 A;  2QJS A;  4TZF A;  4RM5 A;  2GFJ A;  3ZQ4 A;  4DIK A;  1ZKP A;  2WYM C;  2GMN A;  5HIP A;  1ZNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...