3ADRA

The first crystal structure of an archaeal metallo-beta-lactamase superfamily protein; st1585 from sulfolobus tokodaii
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
259
structure length
259
Chain Sequence
b'PCRGLHSIPAGPVEFPEIATVYVMCGEKLTVMIDAGVSNSIADFSFLDKLDYIVLTHLHIDHIGLLPELLQVYKAKVLVKSGFKKYLTSEDGLKKLNESAEKVLGDLYYVYGGLEKKLDQDKVIEVEGNEEFDLGGYRMRLIYTPGHARHHMSVLVDDFLFTGDSAGAYFNGVVIPTTPPVIDYKMYMESLKRQIELKPKVVGFAHGGLVSPKIMEEHLKQMLSKEEIQINVDIGGVAGEILRKQIEVNLRGLRESKKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein ST1585
publication title The first crystal structure of an archaeal metallo-beta-lactamase superfamily protein; ST1585 from Sulfolobus tokodaii
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Signaling protein
total genus 76
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3adrA00
2WHGA 3DHCA 4H0DA 1X8IA 5EVKA 3IELA 3X2YA 3BV6A 5K4MA 2FM6A 2QINA 5AXOA 2BG7A 2AIOA 2R2DA 4FR7A 5ACRA 4B87A 3BK1A 4RL2A 3QH8A 4Z60A 3VQZA 3SPUA 3AJ3A 2QJSA 1K07A 2P4ZA 1XTOA 1BMCA 5ACQA 4V0HA 5A0TA 2YCBA 3SRXA 5EHTA 5EWAA 5AYAA 4HL1A 1JJEA 4EY2A 2BGAA 4ZO3A 2QDSA 3H3EA 2E7YA 3P2UA 1BVTA 1X8GA 2BFKA 2UYXA 4AWZA 1VJNA 2GFKA 2I7VA 3PY5A 5LMCA 2QEDA 2FK6A 2Y87A 5AHOA 1YCGA 1P9EA 2HB9A 5EH9A 1WUOA 4Z6XA 2ZWRA 5LM6A 3PY6A 5HIQA 3BC2A 4LE6A 4EXSA 1ZTCA 4GYQA 3SD9A 2Q0IA 4HL2A 4KEQA 4TZFA 4YSKA 2BTNA 2DKFA 5LE1A 4RAWA 4TZEA 3I14A 1QH5A 3ESHA 5KIKA 5HIPA 5ACPA 3ZWFA 4PVTA 3T3OA 4RM5A 2BG2A 4UWOB 4O98A 2WYMC 4Z5YA 2BG6A 4TZ9A 4KEPA 4UA4A 1DDKA 5B3RA 1WW1A 2BIBA 5FQCA 4ZEJA 4WD6A 2XR1A 2NXAA 4F6HA 1JJTA 3RKJA 2FHXB 4U4LA 3DH8A 3ZQ4A 1L9YA 4CHLA 2ZO4A 2AZ4A 4GCWA 1YCFA 2Y8AA 5AEBA 4UWRB 1DD6A 2OHJA 3IE0A 5FQAA 1X8HA 5LCFA 4J5HA 3IEMA 3DHBA 4EXYA 2OHIA 1QH3A 4YSLA 4UWPB 2GKLA 4AX0B 1VMEA 2M5DA 3RKKA 3FAIA 5IQKA 4EYFA 2FHXA 1E5DA 3RPCA 4YSBA 1WRAA 5ACTA 2NZEA 4UBQA 2P1EA 4D1UA 3KNSA 2BMIA 2WRSA 2FU8A 5KILA 4GYUA 1MQOA 3JXPA 4J5FA 5HISA 4NQ6A 2I7TA 4C1HA 4ZO2A 1KO3A 2BFLA 5K4KA 4RBSA 2WYLA 4AWYB 2YNWA 4ZNBA 1KR3A 2NYPA 4NQ2A 5A0VA 4RL0A 5ACSA 1YCHA 5K0WA 5EV6A 2FU7A 4EYBA 3ZR9A 2VW8A 3FCZA 1A8TA 2BC2A 4P62A 4C1GA 2YZ3A 3IE2A 2YNVB 3R2UA 4XUKA 5EVDA 1JT1A 4C1DA 3PG4A 4JO0A 3LVZA 2P18A 3F9OA 3A4YA 2NZFA 4EFZA 2P97A 5HH5A 1KO2A 5HIOA 4D1TA 5ACUA 4D1WA 4XWWA 4FEKA 2FU9A 5EW0A 4F6ZA 3X2ZA 1XM8A 2GMNA 4C1CA 2YNVA 3DHAA 4NQ4A 3T3NA 5HH6A 2Q9UA 5LCHA 1WUPA 1ZNBA 3I11A 1DXKA 2WYMA 4C1FA 3AF6A 3X30A 2Q0JA 4C1EA 5ACWA 2XF4A 3BK2A 4BZ3A 3IE1A 4DIKA 2GFJA 3I15A 2DOOA 5AXRA 4XWTA 2YNTB 5K4NA 5EV8A 3ADRA 5LSCA 5AHRA 3L6NA 4BP0A 4Z67A 1ZKPA 2FU6A 4AX1B 2BFZB 1SMLA 3X2XA 3SBLA 2BG8B 4D1VA 3S0ZA 5LLDA 4NQ5A 1M2XA 3MD7A 2OHHA 4Z5ZA 2BR6A 4UWSB 3TP9A 3SW3A 4DILA 2YNTA 3WXCA 3IOFA 3G1PA 3KL7A 3Q6VA 1A7TA 2YNUA 4TYTA 3AF5A 5EVBA 2BFZA 2I7XA 3IEKA 3SFPA 3KNRA 3T9MA 5LCAA 2A7MA 2BG8A 5A87A 2M5CA 3ZNBA 5FQBA 1Y44A 2H6AA 2Y8BA 4HKYA 3VPEA 4TYFA 4EYLA 1VGNA 3I13A 4FSBA 5B1UA 4UAMA 3I0VA 1HLKA 3IDZA 2ZZIA 5A5ZA 5DPXA 1BC2A 4AD9A 4RAMA 2Q42A 3IOGA 2QDTA 5ACXA 2ZNBA 5HH4A 4C09A 4TZBA 5LS3A 4D02A 4Z7RA 4PVOA 5B15A 2GCUA 5ACVA 2CBNA
chains in the Genus database with same CATH superfamily
2WHGA 3DHCA 4H0DA 1X8IA 5EVKA 3IELA 3X2YA 3BV6A 5K4MA 2FM6A 2QINA 5AXOA 2BG7A 2AIOA 2R2DA 4FR7A 5ACRA 4B87A 3BK1A 4RL2A 3QH8A 4Z60A 3VQZA 3SPUA 3AJ3A 2QJSA 1K07A 2P4ZA 1XTOA 4PDXA 1BMCA 2CG3A 5ACQA 4V0HA 5A0TA 2YCBA 2CFZA 3SRXA 5EHTA 5EWAA 5AYAA 4HL1A 2CFUA 1JJEA 4EY2A 2BGAA 4ZO3A 2QDSA 3H3EA 2E7YA 3P2UA 1BVTA 1X8GA 2BFKA 2UYXA 4AWZA 1VJNA 2GFKA 2I7VA 3PY5A 5LMCA 2QEDA 2FK6A 2Y87A 5AHOA 1YCGA 1P9EA 2HB9A 5EH9A 1WUOA 4Z6XA 2ZWRA 5LM6A 3PY6A 5HIQA 3BC2A 4LE6A 4EXSA 5AIJA 1ZTCA 4GYQA 3SD9A 2Q0IA 4HL2A 4KEQA 4TZFA 4YSKA 2BTNA 2DKFA 5LE1A 4RAWA 4TZEA 3I14A 1QH5A 3ESHA 5KIKA 5HIPA 5ACPA 3ZWFA 4PVTA 3T3OA 4RM5A 2BG2A 4UWOB 4O98A 2WYMC 4Z5YA 2BG6A 4TZ9A 4KEPA 4UA4A 1DDKA 5B3RA 1WW1A 2BIBA 5FQCA 4ZEJA 4WD6A 2XR1A 2NXAA 4F6HA 1JJTA 3RKJA 2FHXB 4U4LA 3DH8A 3ZQ4A 1L9YA 4CHLA 2ZO4A 4NURA 2AZ4A 4GCWA 1YCFA 2Y8AA 5AEBA 4UWRB 1DD6A 2OHJA 3IE0A 5FQAA 1X8HA 5LCFA 4J5HA 3IEMA 3DHBA 4EXYA 2OHIA 1QH3A 4YSLA 4UWPB 2GKLA 4AX0B 1VMEA 2M5DA 3RKKA 3FAIA 5IQKA 4EYFA 2FHXA 1E5DA 3RPCA 4YSBA 1WRAA 4AXHA 2NZEA 4UBQA 5ACTA 2P1EA 4D1UA 3KNSA 2BMIA 2WRSA 2FU8A 5KILA 4GYUA 1MQOA 3JXPA 4J5FA 5HISA 4NQ6A 2I7TA 4C1HA 4ZO2A 1KO3A 2BFLA 5K4KA 4RBSA 2WYLA 4AWYB 2YNWA 4ZNBA 1KR3A 2NYPA 4NQ2A 5A0VA 4RL0A 5ACSA 1YCHA 5K0WA 5EV6A 2FU7A 4EYBA 3ZR9A 2VW8A 3FCZA 1A8TA 2BC2A 4P62A 4C1GA 2YZ3A 3IE2A 2YNVB 3R2UA 4XUKA 5EVDA 1JT1A 4C1DA 3PG4A 4JO0A 3LVZA 2P18A 3F9OA 3A4YA 2NZFA 4EFZA 2P97A 5HH5A 1KO2A 5HIOA 4D1TA 5ACUA 4D1WA 4XWWA 4FEKA 2FU9A 5EW0A 4F6ZA 3X2ZA 1XM8A 2GMNA 4C1CA 2CG2A 2YNVA 3DHAA 4NQ4A 3T3NA 5HH6A 2Q9UA 5LCHA 1WUPA 1ZNBA 3I11A 1DXKA 2WYMA 4C1FA 3AF6A 3X30A 2Q0JA 4C1EA 5ACWA 2XF4A 2YHEA 3BK2A 4BZ3A 3IE1A 4DIKA 2GFJA 3I15A 2DOOA 5AXRA 4XWTA 2YNTB 5K4NA 5EV8A 3ADRA 5LSCA 5AHRA 3L6NA 4BP0A 4Z67A 1ZKPA 2FU6A 4AX1B 2BFZB 1SMLA 3X2XA 3SBLA 2BG8B 5AJLA 4D1VA 3S0ZA 5LLDA 4NQ5A 1M2XA 3MD7A 2OHHA 4AV7A 4Z5ZA 2BR6A 4UWSB 3TP9A 3SW3A 4DILA 2YNTA 3WXCA 3IOFA 3G1PA 3KL7A 3Q6VA 1A7TA 2YNUA 4TYTA 3AF5A 5EVBA 2BFZA 2I7XA 3IEKA 3SFPA 3KNRA 3T9MA 5LCAA 2A7MA 2BG8A 5A87A 2M5CA 3ZNBA 5FQBA 1Y44A 2H6AA 2Y8BA 4HKYA 3VPEA 4TYFA 4EYLA 1VGNA 5A23A 3I13A 4FSBA 5B1UA 4UAMA 3I0VA 1HLKA 3IDZA 2ZZIA 5A5ZA 5DPXA 1BC2A 4AD9A 4RAMA 2Q42A 3IOGA 2QDTA 5ACXA 2ZNBA 5HH4A 4C09A 4TZBA 5LS3A 4D02A 4Z7RA 4PVOA 5B15A 2GCUA 5ACVA 2CBNA
chains in the Genus database with same CATH topology
2WHGA 3DHCA 4H0DA 1X8IA 5EVKA 3IELA 3X2YA 3BV6A 5K4MA 2FM6A 2QINA 5AXOA 2BG7A 2AIOA 2R2DA 4FR7A 5ACRA 4B87A 3BK1A 4RL2A 3QH8A 4Z60A 3VQZA 3SPUA 3AJ3A 2QJSA 1K07A 2P4ZA 1XTOA 1BMCA 5ACQA 4V0HA 5A0TA 2YCBA 3SRXA 5EHTA 5EWAA 5AYAA 4HL1A 1JJEA 4EY2A 2BGAA 4ZO3A 2QDSA 3H3EA 2E7YA 3P2UA 1BVTA 1X8GA 2BFKA 2UYXA 4AWZA 1VJNA 2GFKA 2I7VA 3PY5A 5LMCA 2QEDA 2FK6A 2Y87A 5AHOA 1YCGA 1P9EA 2HB9A 5EH9A 1WUOA 4Z6XA 2ZWRA 5LM6A 3PY6A 5HIQA 3BC2A 4LE6A 4EXSA 1ZTCA 4GYQA 3SD9A 2Q0IA 4HL2A 4KEQA 4TZFA 4YSKA 2BTNA 2DKFA 5LE1A 4RAWA 4TZEA 3I14A 1QH5A 3ESHA 5KIKA 5HIPA 5ACPA 3ZWFA 4PVTA 3T3OA 4RM5A 2BG2A 4UWOB 4O98A 2WYMC 4Z5YA 2BG6A 4TZ9A 4KEPA 4UA4A 1DDKA 5B3RA 1WW1A 2BIBA 5FQCA 4ZEJA 4WD6A 2XR1A 2NXAA 4F6HA 1JJTA 3RKJA 2FHXB 4U4LA 3DH8A 3ZQ4A 1L9YA 4CHLA 2ZO4A 2AZ4A 4GCWA 1YCFA 2Y8AA 5AEBA 4UWRB 1DD6A 2OHJA 3IE0A 5FQAA 1X8HA 5LCFA 4J5HA 3IEMA 3DHBA 4EXYA 2OHIA 1QH3A 4YSLA 4UWPB 2GKLA 4AX0B 1VMEA 2M5DA 3RKKA 3FAIA 5IQKA 4EYFA 2FHXA 1E5DA 3RPCA 4YSBA 1WRAA 5ACTA 2NZEA 4UBQA 2P1EA 4D1UA 3KNSA 2BMIA 2WRSA 2FU8A 5KILA 4GYUA 1MQOA 3JXPA 4J5FA 5HISA 4NQ6A 2I7TA 4C1HA 4ZO2A 1KO3A 2BFLA 5K4KA 4RBSA 2WYLA 4AWYB 2YNWA 4ZNBA 1KR3A 2NYPA 4NQ2A 5A0VA 4RL0A 5ACSA 1YCHA 5K0WA 5EV6A 2FU7A 4EYBA 3ZR9A 2VW8A 3FCZA 1A8TA 2BC2A 4P62A 4C1GA 2YZ3A 3IE2A 2YNVB 3R2UA 4XUKA 5EVDA 1JT1A 4C1DA 3PG4A 4JO0A 3LVZA 2P18A 3F9OA 3A4YA 2NZFA 4EFZA 2P97A 5HH5A 1KO2A 5HIOA 4D1TA 5ACUA 4D1WA 4XWWA 4FEKA 2FU9A 5EW0A 4F6ZA 3X2ZA 1XM8A 2GMNA 4C1CA 2YNVA 3DHAA 4NQ4A 3T3NA 5HH6A 2Q9UA 5LCHA 1WUPA 1ZNBA 3I11A 1DXKA 2WYMA 4C1FA 3AF6A 3X30A 2Q0JA 4C1EA 5ACWA 2XF4A 3BK2A 4BZ3A 3IE1A 4DIKA 2GFJA 3I15A 2DOOA 5AXRA 4XWTA 2YNTB 5K4NA 5EV8A 3ADRA 5LSCA 5AHRA 3L6NA 4BP0A 4Z67A 1ZKPA 2FU6A 4AX1B 2BFZB 1SMLA 3X2XA 3SBLA 2BG8B 4D1VA 3S0ZA 5LLDA 4NQ5A 1M2XA 3MD7A 2OHHA 4Z5ZA 2BR6A 4UWSB 3TP9A 3SW3A 4DILA 2YNTA 3WXCA 3IOFA 3G1PA 3KL7A 3Q6VA 1A7TA 2YNUA 4TYTA 3AF5A 5EVBA 2BFZA 2I7XA 3IEKA 3SFPA 3KNRA 3T9MA 5LCAA 2A7MA 2BG8A 5A87A 2M5CA 3ZNBA 5FQBA 1Y44A 2H6AA 2Y8BA 4HKYA 3VPEA 4TYFA 4EYLA 1VGNA 3I13A 4FSBA 5B1UA 4UAMA 3I0VA 1HLKA 3IDZA 2ZZIA 5A5ZA 5DPXA 1BC2A 4AD9A 4RAMA 2Q42A 3IOGA 2QDTA 5ACXA 2ZNBA 5HH4A 4C09A 4TZBA 5LS3A 4D02A 4Z7RA 4PVOA 5B15A 2GCUA 5ACVA 2CBNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WHG A;  3DHC A;  4H0D A;  1X8I A;  5EVK A;  3IEL A;  3X2Y A;  3BV6 A;  5K4M A;  2FM6 A;  2QIN A;  5AXO A;  2BG7 A;  2AIO A;  2R2D A;  4FR7 A;  5ACR A;  4B87 A;  3BK1 A;  4RL2 A;  3QH8 A;  4Z60 A;  3VQZ A;  3SPU A;  3AJ3 A;  2QJS A;  1K07 A;  2P4Z A;  1XTO A;  1BMC A;  5ACQ A;  4V0H A;  5A0T A;  2YCB A;  3SRX A;  5EHT A;  5EWA A;  5AYA A;  4HL1 A;  1JJE A;  4EY2 A;  2BGA A;  4ZO3 A;  2QDS A;  3H3E A;  2E7Y A;  3P2U A;  1BVT A;  1X8G A;  2BFK A;  2UYX A;  4AWZ A;  1VJN A;  2GFK A;  2I7V A;  3PY5 A;  5LMC A;  2QED A;  2FK6 A;  2Y87 A;  5AHO A;  1YCG A;  1P9E A;  2HB9 A;  5EH9 A;  1WUO A;  4Z6X A;  2ZWR A;  5LM6 A;  3PY6 A;  5HIQ A;  3BC2 A;  4LE6 A;  4EXS A;  1ZTC A;  4GYQ A;  3SD9 A;  2Q0I A;  4HL2 A;  4KEQ A;  4TZF A;  4YSK A;  2BTN A;  2DKF A;  5LE1 A;  4RAW A;  4TZE A;  3I14 A;  1QH5 A;  3ESH A;  5KIK A;  5HIP A;  5ACP A;  3ZWF A;  4PVT A;  3T3O A;  4RM5 A;  2BG2 A;  4UWO B;  4O98 A;  2WYM C;  4Z5Y A;  2BG6 A;  4TZ9 A;  4KEP A;  4UA4 A;  1DDK A;  5B3R A;  1WW1 A;  2BIB A;  5FQC A;  4ZEJ A;  4WD6 A;  2XR1 A;  2NXA A;  4F6H A;  1JJT A;  3RKJ A;  2FHX B;  4U4L A;  3DH8 A;  3ZQ4 A;  1L9Y A;  4CHL A;  2ZO4 A;  2AZ4 A;  4GCW A;  1YCF A;  2Y8A A;  5AEB A;  4UWR B;  1DD6 A;  2OHJ A;  3IE0 A;  5FQA A;  1X8H A;  5LCF A;  4J5H A;  3IEM A;  3DHB A;  4EXY A;  2OHI A;  1QH3 A;  4YSL A;  4UWP B;  2GKL A;  4AX0 B;  1VME A;  2M5D A;  3RKK A;  3FAI A;  5IQK A;  4EYF A;  2FHX A;  1E5D A;  3RPC A;  4YSB A;  1WRA A;  5ACT A;  2NZE A;  4UBQ A;  2P1E A;  4D1U A;  3KNS A;  2BMI A;  2WRS A;  2FU8 A;  5KIL A;  4GYU A;  1MQO A;  3JXP A;  4J5F A;  5HIS A;  4NQ6 A;  2I7T A;  4C1H A;  4ZO2 A;  1KO3 A;  2BFL A;  5K4K A;  4RBS A;  2WYL A;  4AWY B;  2YNW A;  4ZNB A;  1KR3 A;  2NYP A;  4NQ2 A;  5A0V A;  4RL0 A;  5ACS A;  1YCH A;  5K0W A;  5EV6 A;  2FU7 A;  4EYB A;  3ZR9 A;  2VW8 A;  3FCZ A;  1A8T A;  2BC2 A;  4P62 A;  4C1G A;  2YZ3 A;  3IE2 A;  2YNV B;  3R2U A;  4XUK A;  5EVD A;  1JT1 A;  4C1D A;  3PG4 A;  4JO0 A;  3LVZ A;  2P18 A;  3F9O A;  3A4Y A;  2NZF A;  4EFZ A;  2P97 A;  5HH5 A;  1KO2 A;  5HIO A;  4D1T A;  5ACU A;  4D1W A;  4XWW A;  4FEK A;  2FU9 A;  5EW0 A;  4F6Z A;  3X2Z A;  1XM8 A;  2GMN A;  4C1C A;  2YNV A;  3DHA A;  4NQ4 A;  3T3N A;  5HH6 A;  2Q9U A;  5LCH A;  1WUP A;  1ZNB A;  3I11 A;  1DXK A;  2WYM A;  4C1F A;  3AF6 A;  3X30 A;  2Q0J A;  4C1E A;  5ACW A;  2XF4 A;  3BK2 A;  4BZ3 A;  3IE1 A;  4DIK A;  2GFJ A;  3I15 A;  2DOO A;  5AXR A;  4XWT A;  2YNT B;  5K4N A;  5EV8 A;  3ADR A;  5LSC A;  5AHR A;  3L6N A;  4BP0 A;  4Z67 A;  1ZKP A;  2FU6 A;  4AX1 B;  2BFZ B;  1SML A;  3X2X A;  3SBL A;  2BG8 B;  4D1V A;  3S0Z A;  5LLD A;  4NQ5 A;  1M2X A;  3MD7 A;  2OHH A;  4Z5Z A;  2BR6 A;  4UWS B;  3TP9 A;  3SW3 A;  4DIL A;  2YNT A;  3WXC A;  3IOF A;  3G1P A;  3KL7 A;  3Q6V A;  1A7T A;  2YNU A;  4TYT A;  3AF5 A;  5EVB A;  2BFZ A;  2I7X A;  3IEK A;  3SFP A;  3KNR A;  3T9M A;  5LCA A;  2A7M A;  2BG8 A;  5A87 A;  2M5C A;  3ZNB A;  5FQB A;  1Y44 A;  2H6A A;  2Y8B A;  4HKY A;  3VPE A;  4TYF A;  4EYL A;  1VGN A;  3I13 A;  4FSB A;  5B1U A;  4UAM A;  3I0V A;  1HLK A;  3IDZ A;  2ZZI A;  5A5Z A;  5DPX A;  1BC2 A;  4AD9 A;  4RAM A;  2Q42 A;  3IOG A;  2QDT A;  5ACX A;  2ZNB A;  5HH4 A;  4C09 A;  4TZB A;  5LS3 A;  4D02 A;  4Z7R A;  4PVO A;  5B15 A;  2GCU A;  5ACV A;  2CBN A; 
#chains in the Genus database with same CATH topology
 2WHG A;  3DHC A;  4H0D A;  1X8I A;  5EVK A;  3IEL A;  3X2Y A;  3BV6 A;  5K4M A;  2FM6 A;  2QIN A;  5AXO A;  2BG7 A;  2AIO A;  2R2D A;  4FR7 A;  5ACR A;  4B87 A;  3BK1 A;  4RL2 A;  3QH8 A;  4Z60 A;  3VQZ A;  3SPU A;  3AJ3 A;  2QJS A;  1K07 A;  2P4Z A;  1XTO A;  4PDX A;  1BMC A;  2CG3 A;  5ACQ A;  4V0H A;  5A0T A;  2YCB A;  2CFZ A;  3SRX A;  5EHT A;  5EWA A;  5AYA A;  4HL1 A;  2CFU A;  1JJE A;  4EY2 A;  2BGA A;  4ZO3 A;  2QDS A;  3H3E A;  2E7Y A;  3P2U A;  1BVT A;  1X8G A;  2BFK A;  2UYX A;  4AWZ A;  1VJN A;  2GFK A;  2I7V A;  3PY5 A;  5LMC A;  2QED A;  2FK6 A;  2Y87 A;  5AHO A;  1YCG A;  1P9E A;  2HB9 A;  5EH9 A;  1WUO A;  4Z6X A;  2ZWR A;  5LM6 A;  3PY6 A;  5HIQ A;  3BC2 A;  4LE6 A;  4EXS A;  5AIJ A;  1ZTC A;  4GYQ A;  3SD9 A;  2Q0I A;  4HL2 A;  4KEQ A;  4TZF A;  4YSK A;  2BTN A;  2DKF A;  5LE1 A;  4RAW A;  4TZE A;  3I14 A;  1QH5 A;  3ESH A;  5KIK A;  5HIP A;  5ACP A;  3ZWF A;  4PVT A;  3T3O A;  4RM5 A;  2BG2 A;  4UWO B;  4O98 A;  2WYM C;  4Z5Y A;  2BG6 A;  4TZ9 A;  4KEP A;  4UA4 A;  1DDK A;  5B3R A;  1WW1 A;  2BIB A;  5FQC A;  4ZEJ A;  4WD6 A;  2XR1 A;  2NXA A;  4F6H A;  1JJT A;  3RKJ A;  2FHX B;  4U4L A;  3DH8 A;  3ZQ4 A;  1L9Y A;  4CHL A;  2ZO4 A;  4NUR A;  2AZ4 A;  4GCW A;  1YCF A;  2Y8A A;  5AEB A;  4UWR B;  1DD6 A;  2OHJ A;  3IE0 A;  5FQA A;  1X8H A;  5LCF A;  4J5H A;  3IEM A;  3DHB A;  4EXY A;  2OHI A;  1QH3 A;  4YSL A;  4UWP B;  2GKL A;  4AX0 B;  1VME A;  2M5D A;  3RKK A;  3FAI A;  5IQK A;  4EYF A;  2FHX A;  1E5D A;  3RPC A;  4YSB A;  1WRA A;  4AXH A;  2NZE A;  4UBQ A;  5ACT A;  2P1E A;  4D1U A;  3KNS A;  2BMI A;  2WRS A;  2FU8 A;  5KIL A;  4GYU A;  1MQO A;  3JXP A;  4J5F A;  5HIS A;  4NQ6 A;  2I7T A;  4C1H A;  4ZO2 A;  1KO3 A;  2BFL A;  5K4K A;  4RBS A;  2WYL A;  4AWY B;  2YNW A;  4ZNB A;  1KR3 A;  2NYP A;  4NQ2 A;  5A0V A;  4RL0 A;  5ACS A;  1YCH A;  5K0W A;  5EV6 A;  2FU7 A;  4EYB A;  3ZR9 A;  2VW8 A;  3FCZ A;  1A8T A;  2BC2 A;  4P62 A;  4C1G A;  2YZ3 A;  3IE2 A;  2YNV B;  3R2U A;  4XUK A;  5EVD A;  1JT1 A;  4C1D A;  3PG4 A;  4JO0 A;  3LVZ A;  2P18 A;  3F9O A;  3A4Y A;  2NZF A;  4EFZ A;  2P97 A;  5HH5 A;  1KO2 A;  5HIO A;  4D1T A;  5ACU A;  4D1W A;  4XWW A;  4FEK A;  2FU9 A;  5EW0 A;  4F6Z A;  3X2Z A;  1XM8 A;  2GMN A;  4C1C A;  2CG2 A;  2YNV A;  3DHA A;  4NQ4 A;  3T3N A;  5HH6 A;  2Q9U A;  5LCH A;  1WUP A;  1ZNB A;  3I11 A;  1DXK A;  2WYM A;  4C1F A;  3AF6 A;  3X30 A;  2Q0J A;  4C1E A;  5ACW A;  2XF4 A;  2YHE A;  3BK2 A;  4BZ3 A;  3IE1 A;  4DIK A;  2GFJ A;  3I15 A;  2DOO A;  5AXR A;  4XWT A;  2YNT B;  5K4N A;  5EV8 A;  3ADR A;  5LSC A;  5AHR A;  3L6N A;  4BP0 A;  4Z67 A;  1ZKP A;  2FU6 A;  4AX1 B;  2BFZ B;  1SML A;  3X2X A;  3SBL A;  2BG8 B;  5AJL A;  4D1V A;  3S0Z A;  5LLD A;  4NQ5 A;  1M2X A;  3MD7 A;  2OHH A;  4AV7 A;  4Z5Z A;  2BR6 A;  4UWS B;  3TP9 A;  3SW3 A;  4DIL A;  2YNT A;  3WXC A;  3IOF A;  3G1P A;  3KL7 A;  3Q6V A;  1A7T A;  2YNU A;  4TYT A;  3AF5 A;  5EVB A;  2BFZ A;  2I7X A;  3IEK A;  3SFP A;  3KNR A;  3T9M A;  5LCA A;  2A7M A;  2BG8 A;  5A87 A;  2M5C A;  3ZNB A;  5FQB A;  1Y44 A;  2H6A A;  2Y8B A;  4HKY A;  3VPE A;  4TYF A;  4EYL A;  1VGN A;  5A23 A;  3I13 A;  4FSB A;  5B1U A;  4UAM A;  3I0V A;  1HLK A;  3IDZ A;  2ZZI A;  5A5Z A;  5DPX A;  1BC2 A;  4AD9 A;  4RAM A;  2Q42 A;  3IOG A;  2QDT A;  5ACX A;  2ZNB A;  5HH4 A;  4C09 A;  4TZB A;  5LS3 A;  4D02 A;  4Z7R A;  4PVO A;  5B15 A;  2GCU A;  5ACV A;  2CBN A; 
#chains in the Genus database with same CATH homology
 2WHG A;  3DHC A;  4H0D A;  1X8I A;  5EVK A;  3IEL A;  3X2Y A;  3BV6 A;  5K4M A;  2FM6 A;  2QIN A;  5AXO A;  2BG7 A;  2AIO A;  2R2D A;  4FR7 A;  5ACR A;  4B87 A;  3BK1 A;  4RL2 A;  3QH8 A;  4Z60 A;  3VQZ A;  3SPU A;  3AJ3 A;  2QJS A;  1K07 A;  2P4Z A;  1XTO A;  1BMC A;  5ACQ A;  4V0H A;  5A0T A;  2YCB A;  3SRX A;  5EHT A;  5EWA A;  5AYA A;  4HL1 A;  1JJE A;  4EY2 A;  2BGA A;  4ZO3 A;  2QDS A;  3H3E A;  2E7Y A;  3P2U A;  1BVT A;  1X8G A;  2BFK A;  2UYX A;  4AWZ A;  1VJN A;  2GFK A;  2I7V A;  3PY5 A;  5LMC A;  2QED A;  2FK6 A;  2Y87 A;  5AHO A;  1YCG A;  1P9E A;  2HB9 A;  5EH9 A;  1WUO A;  4Z6X A;  2ZWR A;  5LM6 A;  3PY6 A;  5HIQ A;  3BC2 A;  4LE6 A;  4EXS A;  1ZTC A;  4GYQ A;  3SD9 A;  2Q0I A;  4HL2 A;  4KEQ A;  4TZF A;  4YSK A;  2BTN A;  2DKF A;  5LE1 A;  4RAW A;  4TZE A;  3I14 A;  1QH5 A;  3ESH A;  5KIK A;  5HIP A;  5ACP A;  3ZWF A;  4PVT A;  3T3O A;  4RM5 A;  2BG2 A;  4UWO B;  4O98 A;  2WYM C;  4Z5Y A;  2BG6 A;  4TZ9 A;  4KEP A;  4UA4 A;  1DDK A;  5B3R A;  1WW1 A;  2BIB A;  5FQC A;  4ZEJ A;  4WD6 A;  2XR1 A;  2NXA A;  4F6H A;  1JJT A;  3RKJ A;  2FHX B;  4U4L A;  3DH8 A;  3ZQ4 A;  1L9Y A;  4CHL A;  2ZO4 A;  2AZ4 A;  4GCW A;  1YCF A;  2Y8A A;  5AEB A;  4UWR B;  1DD6 A;  2OHJ A;  3IE0 A;  5FQA A;  1X8H A;  5LCF A;  4J5H A;  3IEM A;  3DHB A;  4EXY A;  2OHI A;  1QH3 A;  4YSL A;  4UWP B;  2GKL A;  4AX0 B;  1VME A;  2M5D A;  3RKK A;  3FAI A;  5IQK A;  4EYF A;  2FHX A;  1E5D A;  3RPC A;  4YSB A;  1WRA A;  5ACT A;  2NZE A;  4UBQ A;  2P1E A;  4D1U A;  3KNS A;  2BMI A;  2WRS A;  2FU8 A;  5KIL A;  4GYU A;  1MQO A;  3JXP A;  4J5F A;  5HIS A;  4NQ6 A;  2I7T A;  4C1H A;  4ZO2 A;  1KO3 A;  2BFL A;  5K4K A;  4RBS A;  2WYL A;  4AWY B;  2YNW A;  4ZNB A;  1KR3 A;  2NYP A;  4NQ2 A;  5A0V A;  4RL0 A;  5ACS A;  1YCH A;  5K0W A;  5EV6 A;  2FU7 A;  4EYB A;  3ZR9 A;  2VW8 A;  3FCZ A;  1A8T A;  2BC2 A;  4P62 A;  4C1G A;  2YZ3 A;  3IE2 A;  2YNV B;  3R2U A;  4XUK A;  5EVD A;  1JT1 A;  4C1D A;  3PG4 A;  4JO0 A;  3LVZ A;  2P18 A;  3F9O A;  3A4Y A;  2NZF A;  4EFZ A;  2P97 A;  5HH5 A;  1KO2 A;  5HIO A;  4D1T A;  5ACU A;  4D1W A;  4XWW A;  4FEK A;  2FU9 A;  5EW0 A;  4F6Z A;  3X2Z A;  1XM8 A;  2GMN A;  4C1C A;  2YNV A;  3DHA A;  4NQ4 A;  3T3N A;  5HH6 A;  2Q9U A;  5LCH A;  1WUP A;  1ZNB A;  3I11 A;  1DXK A;  2WYM A;  4C1F A;  3AF6 A;  3X30 A;  2Q0J A;  4C1E A;  5ACW A;  2XF4 A;  3BK2 A;  4BZ3 A;  3IE1 A;  4DIK A;  2GFJ A;  3I15 A;  2DOO A;  5AXR A;  4XWT A;  2YNT B;  5K4N A;  5EV8 A;  3ADR A;  5LSC A;  5AHR A;  3L6N A;  4BP0 A;  4Z67 A;  1ZKP A;  2FU6 A;  4AX1 B;  2BFZ B;  1SML A;  3X2X A;  3SBL A;  2BG8 B;  4D1V A;  3S0Z A;  5LLD A;  4NQ5 A;  1M2X A;  3MD7 A;  2OHH A;  4Z5Z A;  2BR6 A;  4UWS B;  3TP9 A;  3SW3 A;  4DIL A;  2YNT A;  3WXC A;  3IOF A;  3G1P A;  3KL7 A;  3Q6V A;  1A7T A;  2YNU A;  4TYT A;  3AF5 A;  5EVB A;  2BFZ A;  2I7X A;  3IEK A;  3SFP A;  3KNR A;  3T9M A;  5LCA A;  2A7M A;  2BG8 A;  5A87 A;  2M5C A;  3ZNB A;  5FQB A;  1Y44 A;  2H6A A;  2Y8B A;  4HKY A;  3VPE A;  4TYF A;  4EYL A;  1VGN A;  3I13 A;  4FSB A;  5B1U A;  4UAM A;  3I0V A;  1HLK A;  3IDZ A;  2ZZI A;  5A5Z A;  5DPX A;  1BC2 A;  4AD9 A;  4RAM A;  2Q42 A;  3IOG A;  2QDT A;  5ACX A;  2ZNB A;  5HH4 A;  4C09 A;  4TZB A;  5LS3 A;  4D02 A;  4Z7R A;  4PVO A;  5B15 A;  2GCU A;  5ACV A;  2CBN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...