3ADRA

The first crystal structure of an archaeal metallo-beta-lactamase superfamily protein; st1585 from sulfolobus tokodaii
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
259
structure length
259
Chain Sequence
PCRGLHSIPAGPVEFPEIATVYVMCGEKLTVMIDAGVSNSIADFSFLDKLDYIVLTHLHIDHIGLLPELLQVYKAKVLVKSGFKKYLTSEDGLKKLNESAEKVLGDLYYVYGGLEKKLDQDKVIEVEGNEEFDLGGYRMRLIYTPGHARHHMSVLVDDFLFTGDSAGAYFNGVVIPTTPPVIDYKMYMESLKRQIELKPKVVGFAHGGLVSPKIMEEHLKQMLSKEEIQINVDIGGVAGEILRKQIEVNLRGLRESKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The first crystal structure of an archaeal metallo-beta-lactamase superfamily protein; ST1585 from Sulfolobus tokodaii
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Signaling protein
molecule keywords Putative uncharacterized protein ST1585
total genus 76
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3adrA00
3T9MA 1YCFA 3ESHA 5ACQA 1VMEA 2M5DA 2GMNA 3SFPA 1DDKA 1ZKPA 2YNTB 4LE6A 4RAMA 2AZ4A 4EYLA 1JJEA 5AEBA 3TP9A 2WYMC 3I15A 3F9OA 4JO0A 4GCWA 2WHGA 2FHXA 4EYFA 2XF4A 5LCHA 2Y8AA 4H0DA 5IQKA 4Z5ZA 2YNTA 3BK1A 1YCHA 3WXCA 4C1CA 1XM8A 4J5FA 2ZNBA 2BG2A 4TYFA 5HH4A 2OHJA 4XWTA 1A7TA 5FQAA 4XWWA 2HB9A 2BGAA 2M5CA 2OHIA 2Y87A 4FR7A 4EFZA 4NQ5A 4KEPA 5EVDA 5LMCA 5K4KA 4D1TA 5EV6A 2YNUA 4AX1B 3X2YA 5B15A 3I0VA 4Z60A 4D1VA 1X8IA 2BFLA 5A0VA 3G1PA 2QDTA 3AF6A 4J5HA 2NXAA 3KNSA 5A87A 3T3OA 2Q42A 2FU9A 5LM6A 2BG7A 5B1UA 3KL7A 1VJNA 3DHAA 3KNRA 2FHXB 5EHTA 3RKKA 4UA4A 5ACTA 2OHHA 4Z7RA 2P1EA 1YCGA 1E5DA 3BC2A 2WRSA 2Q0IA 5AXOA 1BC2A 3ZQ4A 4UAMA 5A0TA 3PY5A 3ADRA 4Z5YA 3A4YA 2UYXA 4C1HA 4EXYA 3DHCA 4AD9A 2GKLA 5B3RA 3IE0A 4TZBA 2I7TA 4ZEJA 5AHRA 4GYQA 4AWZA 5HH6A 4WD6A 1WUPA 2DKFA 3MD7A 4Z67A 1M2XA 4P62A 5ACWA 2BR6A 5LLDA 4ZNBA 4B87A 4YSLA 4UBQA 2WYLA 2BC2A 2GFKA 3SW3A 4FSBA 4GYUA 5AYAA 1K07A 4D02A 1HLKA 2XR1A 5KIKA 1WW1A 5EW0A 4C1FA 5K4MA 4UWRB 2Q9UA 3QH8A 2FK6A 2BMIA 4EYBA 2BG6A 4RM5A 2P4ZA 5LSCA 5FQBA 3JXPA 5ACUA 4YSBA 4D1WA 4ZO3A 1BVTA 3Q6VA 2BG8B 3BV6A 4V0HA 3FAIA 5EV8A 2NZEA 3IOFA 1SMLA 2QEDA 5EH9A 3SRXA 3IE2A 2YNVB 3H3EA 1KO3A 3RKJA 2E7YA 2BG8A 5HH5A 1VGNA 5HIQA 4TYTA 4XUKA 4HL1A 2AIOA 3P2UA 3ZWFA 4AWYB 2H6AA 5EWAA 4BZ3A 2YNVA 4PVTA 4HKYA 2QJSA 3X2XA 2ZO4A 2BIBA 2ZWRA 4RL2A 5LS3A 3R2UA 2YCBA 3SPUA 4ZO2A 3IELA 2I7VA 5HIOA 4O98A 5HIPA 2FU6A 1JJTA 3LVZA 1A8TA 3I13A 4DILA 3I11A 5KILA 4TZFA 2I7XA 2P97A 1WRAA 1X8GA 3S0ZA 3IOGA 3X2ZA 5ACPA 4FEKA 2R2DA 1KR3A 2QINA 1KO2A 5EVBA 3SD9A 3X30A 1X8HA 2Q0JA 4NQ4A 4AX0B 4Z6XA 4D1UA 4RBSA 4TZEA 2CBNA 4RL0A 1WUOA 3IEKA 4UWSB 2YZ3A 5AHOA 5LCAA 4F6ZA 3L6NA 2GCUA 4BP0A 2QDSA 5ACSA 4DIKA 5ACXA 4NQ6A 5HISA 4RAWA 5K4NA 1ZTCA 2BFKA 3BK2A 5DPXA 1P9EA 4C1EA 1ZNBA 3IEMA 4HL2A 3AJ3A 4TZ9A 3FCZA 2Y8BA 2BFZB 2GFJA 4EY2A 3T3NA 1Y44A 3IDZA 3PG4A 2VW8A 4F6HA 4C1GA 1QH5A 2DOOA 5LE1A 2WYMA 2YNWA 4YSKA 4KEQA 3ZNBA 4NQ2A 4C1DA 2A7MA 4U4LA 5FQCA 1DD6A 2NYPA 3ZR9A 5A5ZA 2P18A 3RPCA 2FU8A 5K0WA 1QH3A 4C09A 3PY6A 1XTOA 1L9YA 3VQZA 1DXKA 3VPEA 2FU7A 4UWPB 3DHBA 1JT1A 5ACRA 5LCFA 4PVOA 2NZFA 1MQOA 4UWOB 3IE1A 4CHLA 2FM6A 2BFZA 3I14A 2ZZIA 3SBLA 5ACVA 5AXRA 3AF5A 4EXSA 2BTNA 5EVKA 1BMCA 3DH8A
chains in the Genus database with same CATH superfamily
3T9MA 1YCFA 3ESHA 5ACQA 1VMEA 2M5DA 2GMNA 3SFPA 1DDKA 1ZKPA 2YNTB 4LE6A 4RAMA 2AZ4A 4EYLA 1JJEA 5AEBA 3TP9A 2WYMC 3I15A 3F9OA 4JO0A 4GCWA 2WHGA 2FHXA 4EYFA 2XF4A 5LCHA 2Y8AA 4H0DA 5IQKA 4Z5ZA 2YNTA 3BK1A 1YCHA 3WXCA 4C1CA 1XM8A 4J5FA 2ZNBA 2BG2A 4TYFA 5HH4A 2OHJA 4XWTA 1A7TA 5FQAA 4XWWA 2HB9A 2BGAA 2M5CA 2OHIA 2Y87A 4FR7A 4EFZA 4NQ5A 4KEPA 5EVDA 5LMCA 5K4KA 4D1TA 5EV6A 2YNUA 4AX1B 3X2YA 5B15A 3I0VA 4Z60A 4D1VA 1X8IA 2BFLA 5A0VA 3G1PA 2QDTA 3AF6A 4J5HA 2NXAA 3KNSA 5A87A 3T3OA 2Q42A 2FU9A 5LM6A 2BG7A 5B1UA 3KL7A 1VJNA 3DHAA 3KNRA 2FHXB 5EHTA 3RKKA 4UA4A 4AXHA 5ACTA 2OHHA 4Z7RA 2P1EA 1YCGA 1E5DA 3BC2A 2WRSA 2Q0IA 5AXOA 1BC2A 3ZQ4A 4UAMA 5A0TA 3PY5A 3ADRA 4Z5YA 3A4YA 2UYXA 4C1HA 4EXYA 3DHCA 4AD9A 2GKLA 5B3RA 3IE0A 4TZBA 2I7TA 4ZEJA 5AHRA 4GYQA 4AWZA 5HH6A 4WD6A 1WUPA 2DKFA 3MD7A 4Z67A 1M2XA 4P62A 5ACWA 2BR6A 5LLDA 4ZNBA 4B87A 4YSLA 4UBQA 2WYLA 2BC2A 2GFKA 3SW3A 4FSBA 4GYUA 5AYAA 1K07A 4D02A 1HLKA 2XR1A 5KIKA 1WW1A 5EW0A 4C1FA 5K4MA 2CFZA 4UWRB 2Q9UA 3QH8A 2FK6A 2BMIA 4EYBA 2BG6A 4RM5A 2P4ZA 5LSCA 5FQBA 3JXPA 5ACUA 4YSBA 4D1WA 4ZO3A 1BVTA 3Q6VA 2BG8B 3BV6A 4V0HA 3FAIA 5EV8A 2NZEA 3IOFA 1SMLA 2QEDA 5EH9A 3SRXA 3IE2A 2YNVB 3H3EA 1KO3A 5AJLA 3RKJA 2E7YA 4AV7A 5A23A 2BG8A 5HH5A 1VGNA 5HIQA 4TYTA 4NURA 4XUKA 4HL1A 2AIOA 3P2UA 3ZWFA 4AWYB 2H6AA 5EWAA 4BZ3A 2YNVA 4PVTA 4HKYA 2QJSA 3X2XA 2CG3A 2ZO4A 2BIBA 2ZWRA 4RL2A 5LS3A 3R2UA 2YCBA 3SPUA 4ZO2A 3IELA 2I7VA 5HIOA 4O98A 5HIPA 2FU6A 1JJTA 3LVZA 1A8TA 3I13A 4DILA 3I11A 5KILA 4TZFA 2I7XA 2P97A 1WRAA 1X8GA 3S0ZA 3IOGA 3X2ZA 5ACPA 4FEKA 2R2DA 1KR3A 2QINA 1KO2A 5EVBA 3SD9A 3X30A 1X8HA 2Q0JA 4NQ4A 4AX0B 4Z6XA 4D1UA 4RBSA 4TZEA 2CBNA 4RL0A 1WUOA 3IEKA 4UWSB 2YZ3A 5AHOA 5LCAA 4F6ZA 3L6NA 2GCUA 4BP0A 2QDSA 5ACSA 4DIKA 5ACXA 4NQ6A 5HISA 4RAWA 5K4NA 1ZTCA 2BFKA 3BK2A 5DPXA 1P9EA 4C1EA 1ZNBA 3IEMA 4HL2A 3AJ3A 4TZ9A 3FCZA 2CFUA 2Y8BA 2BFZB 2GFJA 4EY2A 3T3NA 1Y44A 3IDZA 3PG4A 2VW8A 4F6HA 4C1GA 1QH5A 2DOOA 5LE1A 2WYMA 2YNWA 4YSKA 4KEQA 3ZNBA 5AIJA 4NQ2A 4C1DA 2A7MA 4U4LA 2YHEA 5FQCA 1DD6A 2NYPA 3ZR9A 5A5ZA 2P18A 3RPCA 2FU8A 5K0WA 1QH3A 4C09A 3PY6A 1XTOA 1L9YA 3VQZA 1DXKA 3VPEA 2FU7A 4UWPB 3DHBA 1JT1A 5ACRA 5LCFA 4PVOA 2NZFA 4PDXA 1MQOA 4UWOB 3IE1A 4CHLA 2FM6A 2BFZA 3I14A 2ZZIA 3SBLA 5ACVA 5AXRA 3AF5A 4EXSA 2BTNA 2CG2A 5EVKA 1BMCA 3DH8A
chains in the Genus database with same CATH topology
3T9MA 1YCFA 3ESHA 5ACQA 1VMEA 2M5DA 2GMNA 3SFPA 1DDKA 1ZKPA 2YNTB 4LE6A 4RAMA 2AZ4A 4EYLA 1JJEA 5AEBA 3TP9A 2WYMC 3I15A 3F9OA 4JO0A 4GCWA 2WHGA 2FHXA 4EYFA 2XF4A 5LCHA 2Y8AA 4H0DA 5IQKA 4Z5ZA 2YNTA 3BK1A 1YCHA 3WXCA 4C1CA 1XM8A 4J5FA 2ZNBA 2BG2A 4TYFA 5HH4A 2OHJA 4XWTA 1A7TA 5FQAA 4XWWA 2HB9A 2BGAA 2M5CA 2OHIA 2Y87A 4FR7A 4EFZA 4NQ5A 4KEPA 5EVDA 5LMCA 5K4KA 4D1TA 5EV6A 2YNUA 4AX1B 3X2YA 5B15A 3I0VA 4Z60A 4D1VA 1X8IA 2BFLA 5A0VA 3G1PA 2QDTA 3AF6A 4J5HA 2NXAA 3KNSA 5A87A 3T3OA 2Q42A 2FU9A 5LM6A 2BG7A 5B1UA 3KL7A 1VJNA 3DHAA 3KNRA 2FHXB 5EHTA 3RKKA 4UA4A 5ACTA 2OHHA 4Z7RA 2P1EA 1YCGA 1E5DA 3BC2A 2WRSA 2Q0IA 5AXOA 1BC2A 3ZQ4A 4UAMA 5A0TA 3PY5A 3ADRA 4Z5YA 3A4YA 2UYXA 4C1HA 4EXYA 3DHCA 4AD9A 2GKLA 5B3RA 3IE0A 4TZBA 2I7TA 4ZEJA 5AHRA 4GYQA 4AWZA 5HH6A 4WD6A 1WUPA 2DKFA 3MD7A 4Z67A 1M2XA 4P62A 5ACWA 2BR6A 5LLDA 4ZNBA 4B87A 4YSLA 4UBQA 2WYLA 2BC2A 2GFKA 3SW3A 4FSBA 4GYUA 5AYAA 1K07A 4D02A 1HLKA 2XR1A 5KIKA 1WW1A 5EW0A 4C1FA 5K4MA 4UWRB 2Q9UA 3QH8A 2FK6A 2BMIA 4EYBA 2BG6A 4RM5A 2P4ZA 5LSCA 5FQBA 3JXPA 5ACUA 4YSBA 4D1WA 4ZO3A 1BVTA 3Q6VA 2BG8B 3BV6A 4V0HA 3FAIA 5EV8A 2NZEA 3IOFA 1SMLA 2QEDA 5EH9A 3SRXA 3IE2A 2YNVB 3H3EA 1KO3A 3RKJA 2E7YA 2BG8A 5HH5A 1VGNA 5HIQA 4TYTA 4XUKA 4HL1A 2AIOA 3P2UA 3ZWFA 4AWYB 2H6AA 5EWAA 4BZ3A 2YNVA 4PVTA 4HKYA 2QJSA 3X2XA 2ZO4A 2BIBA 2ZWRA 4RL2A 5LS3A 3R2UA 2YCBA 3SPUA 4ZO2A 3IELA 2I7VA 5HIOA 4O98A 5HIPA 2FU6A 1JJTA 3LVZA 1A8TA 3I13A 4DILA 3I11A 5KILA 4TZFA 2I7XA 2P97A 1WRAA 1X8GA 3S0ZA 3IOGA 3X2ZA 5ACPA 4FEKA 2R2DA 1KR3A 2QINA 1KO2A 5EVBA 3SD9A 3X30A 1X8HA 2Q0JA 4NQ4A 4AX0B 4Z6XA 4D1UA 4RBSA 4TZEA 2CBNA 4RL0A 1WUOA 3IEKA 4UWSB 2YZ3A 5AHOA 5LCAA 4F6ZA 3L6NA 2GCUA 4BP0A 2QDSA 5ACSA 4DIKA 5ACXA 4NQ6A 5HISA 4RAWA 5K4NA 1ZTCA 2BFKA 3BK2A 5DPXA 1P9EA 4C1EA 1ZNBA 3IEMA 4HL2A 3AJ3A 4TZ9A 3FCZA 2Y8BA 2BFZB 2GFJA 4EY2A 3T3NA 1Y44A 3IDZA 3PG4A 2VW8A 4F6HA 4C1GA 1QH5A 2DOOA 5LE1A 2WYMA 2YNWA 4YSKA 4KEQA 3ZNBA 4NQ2A 4C1DA 2A7MA 4U4LA 5FQCA 1DD6A 2NYPA 3ZR9A 5A5ZA 2P18A 3RPCA 2FU8A 5K0WA 1QH3A 4C09A 3PY6A 1XTOA 1L9YA 3VQZA 1DXKA 3VPEA 2FU7A 4UWPB 3DHBA 1JT1A 5ACRA 5LCFA 4PVOA 2NZFA 1MQOA 4UWOB 3IE1A 4CHLA 2FM6A 2BFZA 3I14A 2ZZIA 3SBLA 5ACVA 5AXRA 3AF5A 4EXSA 2BTNA 5EVKA 1BMCA 3DH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T9M A;  1YCF A;  3ESH A;  5ACQ A;  1VME A;  2M5D A;  2GMN A;  3SFP A;  1DDK A;  1ZKP A;  2YNT B;  4LE6 A;  4RAM A;  2AZ4 A;  4EYL A;  1JJE A;  5AEB A;  3TP9 A;  2WYM C;  3I15 A;  3F9O A;  4JO0 A;  4GCW A;  2WHG A;  2FHX A;  4EYF A;  2XF4 A;  5LCH A;  2Y8A A;  4H0D A;  5IQK A;  4Z5Z A;  2YNT A;  3BK1 A;  1YCH A;  3WXC A;  4C1C A;  1XM8 A;  4J5F A;  2ZNB A;  2BG2 A;  4TYF A;  5HH4 A;  2OHJ A;  4XWT A;  1A7T A;  5FQA A;  4XWW A;  2HB9 A;  2BGA A;  2M5C A;  2OHI A;  2Y87 A;  4FR7 A;  4EFZ A;  4NQ5 A;  4KEP A;  5EVD A;  5LMC A;  5K4K A;  4D1T A;  5EV6 A;  2YNU A;  4AX1 B;  3X2Y A;  5B15 A;  3I0V A;  4Z60 A;  4D1V A;  1X8I A;  2BFL A;  5A0V A;  3G1P A;  2QDT A;  3AF6 A;  4J5H A;  2NXA A;  3KNS A;  5A87 A;  3T3O A;  2Q42 A;  2FU9 A;  5LM6 A;  2BG7 A;  5B1U A;  3KL7 A;  1VJN A;  3DHA A;  3KNR A;  2FHX B;  5EHT A;  3RKK A;  4UA4 A;  5ACT A;  2OHH A;  4Z7R A;  2P1E A;  1YCG A;  1E5D A;  3BC2 A;  2WRS A;  2Q0I A;  5AXO A;  1BC2 A;  3ZQ4 A;  4UAM A;  5A0T A;  3PY5 A;  3ADR A;  4Z5Y A;  3A4Y A;  2UYX A;  4C1H A;  4EXY A;  3DHC A;  4AD9 A;  2GKL A;  5B3R A;  3IE0 A;  4TZB A;  2I7T A;  4ZEJ A;  5AHR A;  4GYQ A;  4AWZ A;  5HH6 A;  4WD6 A;  1WUP A;  2DKF A;  3MD7 A;  4Z67 A;  1M2X A;  4P62 A;  5ACW A;  2BR6 A;  5LLD A;  4ZNB A;  4B87 A;  4YSL A;  4UBQ A;  2WYL A;  2BC2 A;  2GFK A;  3SW3 A;  4FSB A;  4GYU A;  5AYA A;  1K07 A;  4D02 A;  1HLK A;  2XR1 A;  5KIK A;  1WW1 A;  5EW0 A;  4C1F A;  5K4M A;  4UWR B;  2Q9U A;  3QH8 A;  2FK6 A;  2BMI A;  4EYB A;  2BG6 A;  4RM5 A;  2P4Z A;  5LSC A;  5FQB A;  3JXP A;  5ACU A;  4YSB A;  4D1W A;  4ZO3 A;  1BVT A;  3Q6V A;  2BG8 B;  3BV6 A;  4V0H A;  3FAI A;  5EV8 A;  2NZE A;  3IOF A;  1SML A;  2QED A;  5EH9 A;  3SRX A;  3IE2 A;  2YNV B;  3H3E A;  1KO3 A;  3RKJ A;  2E7Y A;  2BG8 A;  5HH5 A;  1VGN A;  5HIQ A;  4TYT A;  4XUK A;  4HL1 A;  2AIO A;  3P2U A;  3ZWF A;  4AWY B;  2H6A A;  5EWA A;  4BZ3 A;  2YNV A;  4PVT A;  4HKY A;  2QJS A;  3X2X A;  2ZO4 A;  2BIB A;  2ZWR A;  4RL2 A;  5LS3 A;  3R2U A;  2YCB A;  3SPU A;  4ZO2 A;  3IEL A;  2I7V A;  5HIO A;  4O98 A;  5HIP A;  2FU6 A;  1JJT A;  3LVZ A;  1A8T A;  3I13 A;  4DIL A;  3I11 A;  5KIL A;  4TZF A;  2I7X A;  2P97 A;  1WRA A;  1X8G A;  3S0Z A;  3IOG A;  3X2Z A;  5ACP A;  4FEK A;  2R2D A;  1KR3 A;  2QIN A;  1KO2 A;  5EVB A;  3SD9 A;  3X30 A;  1X8H A;  2Q0J A;  4NQ4 A;  4AX0 B;  4Z6X A;  4D1U A;  4RBS A;  4TZE A;  2CBN A;  4RL0 A;  1WUO A;  3IEK A;  4UWS B;  2YZ3 A;  5AHO A;  5LCA A;  4F6Z A;  3L6N A;  2GCU A;  4BP0 A;  2QDS A;  5ACS A;  4DIK A;  5ACX A;  4NQ6 A;  5HIS A;  4RAW A;  5K4N A;  1ZTC A;  2BFK A;  3BK2 A;  5DPX A;  1P9E A;  4C1E A;  1ZNB A;  3IEM A;  4HL2 A;  3AJ3 A;  4TZ9 A;  3FCZ A;  2Y8B A;  2BFZ B;  2GFJ A;  4EY2 A;  3T3N A;  1Y44 A;  3IDZ A;  3PG4 A;  2VW8 A;  4F6H A;  4C1G A;  1QH5 A;  2DOO A;  5LE1 A;  2WYM A;  2YNW A;  4YSK A;  4KEQ A;  3ZNB A;  4NQ2 A;  4C1D A;  2A7M A;  4U4L A;  5FQC A;  1DD6 A;  2NYP A;  3ZR9 A;  5A5Z A;  2P18 A;  3RPC A;  2FU8 A;  5K0W A;  1QH3 A;  4C09 A;  3PY6 A;  1XTO A;  1L9Y A;  3VQZ A;  1DXK A;  3VPE A;  2FU7 A;  4UWP B;  3DHB A;  1JT1 A;  5ACR A;  5LCF A;  4PVO A;  2NZF A;  1MQO A;  4UWO B;  3IE1 A;  4CHL A;  2FM6 A;  2BFZ A;  3I14 A;  2ZZI A;  3SBL A;  5ACV A;  5AXR A;  3AF5 A;  4EXS A;  2BTN A;  5EVK A;  1BMC A;  3DH8 A; 
#chains in the Genus database with same CATH topology
 3T9M A;  1YCF A;  3ESH A;  5ACQ A;  1VME A;  2M5D A;  2GMN A;  3SFP A;  1DDK A;  1ZKP A;  2YNT B;  4LE6 A;  4RAM A;  2AZ4 A;  4EYL A;  1JJE A;  5AEB A;  3TP9 A;  2WYM C;  3I15 A;  3F9O A;  4JO0 A;  4GCW A;  2WHG A;  2FHX A;  4EYF A;  2XF4 A;  5LCH A;  2Y8A A;  4H0D A;  5IQK A;  4Z5Z A;  2YNT A;  3BK1 A;  1YCH A;  3WXC A;  4C1C A;  1XM8 A;  4J5F A;  2ZNB A;  2BG2 A;  4TYF A;  5HH4 A;  2OHJ A;  4XWT A;  1A7T A;  5FQA A;  4XWW A;  2HB9 A;  2BGA A;  2M5C A;  2OHI A;  2Y87 A;  4FR7 A;  4EFZ A;  4NQ5 A;  4KEP A;  5EVD A;  5LMC A;  5K4K A;  4D1T A;  5EV6 A;  2YNU A;  4AX1 B;  3X2Y A;  5B15 A;  3I0V A;  4Z60 A;  4D1V A;  1X8I A;  2BFL A;  5A0V A;  3G1P A;  2QDT A;  3AF6 A;  4J5H A;  2NXA A;  3KNS A;  5A87 A;  3T3O A;  2Q42 A;  2FU9 A;  5LM6 A;  2BG7 A;  5B1U A;  3KL7 A;  1VJN A;  3DHA A;  3KNR A;  2FHX B;  5EHT A;  3RKK A;  4UA4 A;  4AXH A;  5ACT A;  2OHH A;  4Z7R A;  2P1E A;  1YCG A;  1E5D A;  3BC2 A;  2WRS A;  2Q0I A;  5AXO A;  1BC2 A;  3ZQ4 A;  4UAM A;  5A0T A;  3PY5 A;  3ADR A;  4Z5Y A;  3A4Y A;  2UYX A;  4C1H A;  4EXY A;  3DHC A;  4AD9 A;  2GKL A;  5B3R A;  3IE0 A;  4TZB A;  2I7T A;  4ZEJ A;  5AHR A;  4GYQ A;  4AWZ A;  5HH6 A;  4WD6 A;  1WUP A;  2DKF A;  3MD7 A;  4Z67 A;  1M2X A;  4P62 A;  5ACW A;  2BR6 A;  5LLD A;  4ZNB A;  4B87 A;  4YSL A;  4UBQ A;  2WYL A;  2BC2 A;  2GFK A;  3SW3 A;  4FSB A;  4GYU A;  5AYA A;  1K07 A;  4D02 A;  1HLK A;  2XR1 A;  5KIK A;  1WW1 A;  5EW0 A;  4C1F A;  5K4M A;  2CFZ A;  4UWR B;  2Q9U A;  3QH8 A;  2FK6 A;  2BMI A;  4EYB A;  2BG6 A;  4RM5 A;  2P4Z A;  5LSC A;  5FQB A;  3JXP A;  5ACU A;  4YSB A;  4D1W A;  4ZO3 A;  1BVT A;  3Q6V A;  2BG8 B;  3BV6 A;  4V0H A;  3FAI A;  5EV8 A;  2NZE A;  3IOF A;  1SML A;  2QED A;  5EH9 A;  3SRX A;  3IE2 A;  2YNV B;  3H3E A;  1KO3 A;  5AJL A;  3RKJ A;  2E7Y A;  4AV7 A;  5A23 A;  2BG8 A;  5HH5 A;  1VGN A;  5HIQ A;  4TYT A;  4NUR A;  4XUK A;  4HL1 A;  2AIO A;  3P2U A;  3ZWF A;  4AWY B;  2H6A A;  5EWA A;  4BZ3 A;  2YNV A;  4PVT A;  4HKY A;  2QJS A;  3X2X A;  2CG3 A;  2ZO4 A;  2BIB A;  2ZWR A;  4RL2 A;  5LS3 A;  3R2U A;  2YCB A;  3SPU A;  4ZO2 A;  3IEL A;  2I7V A;  5HIO A;  4O98 A;  5HIP A;  2FU6 A;  1JJT A;  3LVZ A;  1A8T A;  3I13 A;  4DIL A;  3I11 A;  5KIL A;  4TZF A;  2I7X A;  2P97 A;  1WRA A;  1X8G A;  3S0Z A;  3IOG A;  3X2Z A;  5ACP A;  4FEK A;  2R2D A;  1KR3 A;  2QIN A;  1KO2 A;  5EVB A;  3SD9 A;  3X30 A;  1X8H A;  2Q0J A;  4NQ4 A;  4AX0 B;  4Z6X A;  4D1U A;  4RBS A;  4TZE A;  2CBN A;  4RL0 A;  1WUO A;  3IEK A;  4UWS B;  2YZ3 A;  5AHO A;  5LCA A;  4F6Z A;  3L6N A;  2GCU A;  4BP0 A;  2QDS A;  5ACS A;  4DIK A;  5ACX A;  4NQ6 A;  5HIS A;  4RAW A;  5K4N A;  1ZTC A;  2BFK A;  3BK2 A;  5DPX A;  1P9E A;  4C1E A;  1ZNB A;  3IEM A;  4HL2 A;  3AJ3 A;  4TZ9 A;  3FCZ A;  2CFU A;  2Y8B A;  2BFZ B;  2GFJ A;  4EY2 A;  3T3N A;  1Y44 A;  3IDZ A;  3PG4 A;  2VW8 A;  4F6H A;  4C1G A;  1QH5 A;  2DOO A;  5LE1 A;  2WYM A;  2YNW A;  4YSK A;  4KEQ A;  3ZNB A;  5AIJ A;  4NQ2 A;  4C1D A;  2A7M A;  4U4L A;  2YHE A;  5FQC A;  1DD6 A;  2NYP A;  3ZR9 A;  5A5Z A;  2P18 A;  3RPC A;  2FU8 A;  5K0W A;  1QH3 A;  4C09 A;  3PY6 A;  1XTO A;  1L9Y A;  3VQZ A;  1DXK A;  3VPE A;  2FU7 A;  4UWP B;  3DHB A;  1JT1 A;  5ACR A;  5LCF A;  4PVO A;  2NZF A;  4PDX A;  1MQO A;  4UWO B;  3IE1 A;  4CHL A;  2FM6 A;  2BFZ A;  3I14 A;  2ZZI A;  3SBL A;  5ACV A;  5AXR A;  3AF5 A;  4EXS A;  2BTN A;  2CG2 A;  5EVK A;  1BMC A;  3DH8 A; 
#chains in the Genus database with same CATH homology
 3T9M A;  1YCF A;  3ESH A;  5ACQ A;  1VME A;  2M5D A;  2GMN A;  3SFP A;  1DDK A;  1ZKP A;  2YNT B;  4LE6 A;  4RAM A;  2AZ4 A;  4EYL A;  1JJE A;  5AEB A;  3TP9 A;  2WYM C;  3I15 A;  3F9O A;  4JO0 A;  4GCW A;  2WHG A;  2FHX A;  4EYF A;  2XF4 A;  5LCH A;  2Y8A A;  4H0D A;  5IQK A;  4Z5Z A;  2YNT A;  3BK1 A;  1YCH A;  3WXC A;  4C1C A;  1XM8 A;  4J5F A;  2ZNB A;  2BG2 A;  4TYF A;  5HH4 A;  2OHJ A;  4XWT A;  1A7T A;  5FQA A;  4XWW A;  2HB9 A;  2BGA A;  2M5C A;  2OHI A;  2Y87 A;  4FR7 A;  4EFZ A;  4NQ5 A;  4KEP A;  5EVD A;  5LMC A;  5K4K A;  4D1T A;  5EV6 A;  2YNU A;  4AX1 B;  3X2Y A;  5B15 A;  3I0V A;  4Z60 A;  4D1V A;  1X8I A;  2BFL A;  5A0V A;  3G1P A;  2QDT A;  3AF6 A;  4J5H A;  2NXA A;  3KNS A;  5A87 A;  3T3O A;  2Q42 A;  2FU9 A;  5LM6 A;  2BG7 A;  5B1U A;  3KL7 A;  1VJN A;  3DHA A;  3KNR A;  2FHX B;  5EHT A;  3RKK A;  4UA4 A;  5ACT A;  2OHH A;  4Z7R A;  2P1E A;  1YCG A;  1E5D A;  3BC2 A;  2WRS A;  2Q0I A;  5AXO A;  1BC2 A;  3ZQ4 A;  4UAM A;  5A0T A;  3PY5 A;  3ADR A;  4Z5Y A;  3A4Y A;  2UYX A;  4C1H A;  4EXY A;  3DHC A;  4AD9 A;  2GKL A;  5B3R A;  3IE0 A;  4TZB A;  2I7T A;  4ZEJ A;  5AHR A;  4GYQ A;  4AWZ A;  5HH6 A;  4WD6 A;  1WUP A;  2DKF A;  3MD7 A;  4Z67 A;  1M2X A;  4P62 A;  5ACW A;  2BR6 A;  5LLD A;  4ZNB A;  4B87 A;  4YSL A;  4UBQ A;  2WYL A;  2BC2 A;  2GFK A;  3SW3 A;  4FSB A;  4GYU A;  5AYA A;  1K07 A;  4D02 A;  1HLK A;  2XR1 A;  5KIK A;  1WW1 A;  5EW0 A;  4C1F A;  5K4M A;  4UWR B;  2Q9U A;  3QH8 A;  2FK6 A;  2BMI A;  4EYB A;  2BG6 A;  4RM5 A;  2P4Z A;  5LSC A;  5FQB A;  3JXP A;  5ACU A;  4YSB A;  4D1W A;  4ZO3 A;  1BVT A;  3Q6V A;  2BG8 B;  3BV6 A;  4V0H A;  3FAI A;  5EV8 A;  2NZE A;  3IOF A;  1SML A;  2QED A;  5EH9 A;  3SRX A;  3IE2 A;  2YNV B;  3H3E A;  1KO3 A;  3RKJ A;  2E7Y A;  2BG8 A;  5HH5 A;  1VGN A;  5HIQ A;  4TYT A;  4XUK A;  4HL1 A;  2AIO A;  3P2U A;  3ZWF A;  4AWY B;  2H6A A;  5EWA A;  4BZ3 A;  2YNV A;  4PVT A;  4HKY A;  2QJS A;  3X2X A;  2ZO4 A;  2BIB A;  2ZWR A;  4RL2 A;  5LS3 A;  3R2U A;  2YCB A;  3SPU A;  4ZO2 A;  3IEL A;  2I7V A;  5HIO A;  4O98 A;  5HIP A;  2FU6 A;  1JJT A;  3LVZ A;  1A8T A;  3I13 A;  4DIL A;  3I11 A;  5KIL A;  4TZF A;  2I7X A;  2P97 A;  1WRA A;  1X8G A;  3S0Z A;  3IOG A;  3X2Z A;  5ACP A;  4FEK A;  2R2D A;  1KR3 A;  2QIN A;  1KO2 A;  5EVB A;  3SD9 A;  3X30 A;  1X8H A;  2Q0J A;  4NQ4 A;  4AX0 B;  4Z6X A;  4D1U A;  4RBS A;  4TZE A;  2CBN A;  4RL0 A;  1WUO A;  3IEK A;  4UWS B;  2YZ3 A;  5AHO A;  5LCA A;  4F6Z A;  3L6N A;  2GCU A;  4BP0 A;  2QDS A;  5ACS A;  4DIK A;  5ACX A;  4NQ6 A;  5HIS A;  4RAW A;  5K4N A;  1ZTC A;  2BFK A;  3BK2 A;  5DPX A;  1P9E A;  4C1E A;  1ZNB A;  3IEM A;  4HL2 A;  3AJ3 A;  4TZ9 A;  3FCZ A;  2Y8B A;  2BFZ B;  2GFJ A;  4EY2 A;  3T3N A;  1Y44 A;  3IDZ A;  3PG4 A;  2VW8 A;  4F6H A;  4C1G A;  1QH5 A;  2DOO A;  5LE1 A;  2WYM A;  2YNW A;  4YSK A;  4KEQ A;  3ZNB A;  4NQ2 A;  4C1D A;  2A7M A;  4U4L A;  5FQC A;  1DD6 A;  2NYP A;  3ZR9 A;  5A5Z A;  2P18 A;  3RPC A;  2FU8 A;  5K0W A;  1QH3 A;  4C09 A;  3PY6 A;  1XTO A;  1L9Y A;  3VQZ A;  1DXK A;  3VPE A;  2FU7 A;  4UWP B;  3DHB A;  1JT1 A;  5ACR A;  5LCF A;  4PVO A;  2NZF A;  1MQO A;  4UWO B;  3IE1 A;  4CHL A;  2FM6 A;  2BFZ A;  3I14 A;  2ZZI A;  3SBL A;  5ACV A;  5AXR A;  3AF5 A;  4EXS A;  2BTN A;  5EVK A;  1BMC A;  3DH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...