3ADRA

The first crystal structure of an archaeal metallo-beta-lactamase superfamily protein; st1585 from sulfolobus tokodaii
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
259
structure length
259
Chain Sequence
PCRGLHSIPAGPVEFPEIATVYVMCGEKLTVMIDAGVSNSIADFSFLDKLDYIVLTHLHIDHIGLLPELLQVYKAKVLVKSGFKKYLTSEDGLKKLNESAEKVLGDLYYVYGGLEKKLDQDKVIEVEGNEEFDLGGYRMRLIYTPGHARHHMSVLVDDFLFTGDSAGAYFNGVVIPTTPPVIDYKMYMESLKRQIELKPKVVGFAHGGLVSPKIMEEHLKQMLSKEEIQINVDIGGVAGEILRKQIEVNLRGLRESKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein ST1585
publication title The first crystal structure of an archaeal metallo-beta-lactamase superfamily protein; ST1585 from Sulfolobus tokodaii
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Signaling protein
total genus 76
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3adrA00
4UWRB 5A5ZA 5HH4A 2ZWRA 1DDKA 1BC2A 4KEQA 2GFKA 1ZKPA 4YSKA 5B15A 4NQ5A 3DHCA 1HLKA 2I7VA 2Y8BA 5AXOA 2YNVA 1P9EA 2FU8A 5AXRA 2YNTA 2M5CA 3PY5A 2GFJA 5FQBA 5EWAA 1VJNA 5LM6A 2ZO4A 5LSCA 5KIKA 1VMEA 3ZNBA 3IELA 3AF6A 3IOFA 4DILA 4GYQA 1WRAA 5LMCA 2NYPA 2WYMC 4HKYA 5K0WA 4V0HA 5HIOA 4FR7A 3KL7A 3Q6VA 3ZQ4A 4C09A 4C1HA 1BVTA 5K4MA 3KNSA 4XUKA 4D1TA 5ACXA 4BZ3A 2BG8B 3DHBA 1ZTCA 2QDSA 2WYMA 1YCGA 1YCFA 4RL2A 3FCZA 1K07A 2YZ3A 4XWTA 5HH5A 5ACTA 3PG4A 2WHGA 1JJTA 1L9YA 4UAMA 5A87A 3BK1A 2DKFA 3P2UA 3ZR9A 4Z6XA 5AHOA 1QH3A 3VQZA 2BG7A 1WUPA 2BFZA 4F6ZA 2Q0JA 4U4LA 4Z67A 3BV6A 2BC2A 4HL1A 4EFZA 2WYLA 1E5DA 4J5FA 4TZFA 1YCHA 4D1VA 3X30A 3DH8A 1KR3A 2QJSA 5HH6A 2GCUA 2BTNA 3H3EA 2FU9A 2AZ4A 4UWPB 5K4KA 4AWYB 5LE1A 2I7XA 4RL0A 2QEDA 4ZEJA 2XR1A 4C1FA 2P1EA 2YNUA 2NZFA 4C1GA 5EV6A 2BGAA 5ACPA 2YNTB 4UWSB 4EYFA 2R2DA 5KILA 2OHJA 5ACVA 5LLDA 4TZEA 2YNWA 2FHXA 4WD6A 3ADRA 4AX0B 5FQAA 4Z5ZA 5LS3A 4AD9A 2BG6A 4TYTA 3AF5A 3F9OA 2UYXA 5LCHA 4RM5A 5B1UA 2Q42A 3SFPA 5DPXA 2M5DA 4D02A 3IEKA 1Y44A 4RAWA 3A4YA 2BG2A 4LE6A 3FAIA 2Q9UA 5A0TA 4UA4A 4RAMA 4Z60A 4AX1B 1JJEA 3RPCA 1X8GA 3T3OA 5EVBA 5ACWA 1DXKA 2BFKA 2VW8A 3JXPA 2BIBA 2H6AA 3IE0A 2I7TA 3SD9A 5K4NA 1WW1A 2OHHA 4UWOB 2BFZB 4O98A 3PY6A 5FQCA 2A7MA 1BMCA 2HB9A 2FU6A 4P62A 2QINA 3KNRA 3X2XA 3T9MA 3BC2A 2GMNA 3I15A 4ZO3A 2P97A 2FM6A 5LCFA 3QH8A 4B87A 4ZNBA 5ACUA 5EV8A 2FK6A 3SBLA 4TZBA 4RBSA 5EH9A 3VPEA 3BK2A 2WRSA 3SPUA 4NQ4A 4GYUA 4BP0A 3R2UA 2YNVB 5EVDA 1X8IA 5B3RA 5AEBA 4TZ9A 3T3NA 2GKLA 3RKJA 3IE1A 1QH5A 2XF4A 4TYFA 3SW3A 1ZNBA 4FEKA 4DIKA 1A8TA 4JO0A 2OHIA 1VGNA 2P4ZA 4NQ6A 3L6NA 3ZWFA 4CHLA 3I14A 3G1PA 3I0VA 3MD7A 4HL2A 4PVTA 2FHXB 2DOOA 1XTOA 3I13A 3TP9A 2NZEA 2BMIA 4J5HA 1DD6A 3X2YA 4C1DA 4C1CA 4EXSA 2CBNA 5HIQA 2BG8A 3RKKA 4F6HA 3LVZA 5IQKA 1XM8A 3X2ZA 5HIPA 4XWWA 4EYLA 4PVOA 1X8HA 2ZNBA 4ZO2A 2AIOA 3AJ3A 2P18A 5LCAA 1M2XA 3ESHA 4C1EA 4GCWA 4NQ2A 4KEPA 2BR6A 1SMLA 5EVKA 2FU7A 3SRXA 4EXYA 5ACQA 3WXCA 4D1WA 1A7TA 4FSBA 2E7YA 4AWZA 5EHTA 4EYBA 3IDZA 5HISA 3DHAA 2Q0IA 2QDTA 5AHRA 2Y87A 1KO3A 3IEMA 1JT1A 5ACRA 4D1UA 5A0VA 2Y8AA 2BFLA 4YSBA 2YCBA 4Z7RA 4UBQA 1KO2A 5AYAA 2NXAA 3I11A 1WUOA 1MQOA 5EW0A 5ACSA 4EY2A 4YSLA 3S0ZA 3IE2A 4H0DA 4Z5YA 2ZZIA 3IOGA
chains in the Genus database with same CATH superfamily
4UWRB 5A5ZA 5A23A 5HH4A 2ZWRA 1DDKA 1BC2A 4KEQA 2GFKA 1ZKPA 4YSKA 5B15A 4NQ5A 3DHCA 1HLKA 2I7VA 2Y8BA 5AXOA 2YNVA 1P9EA 2FU8A 5AXRA 2YNTA 2M5CA 3PY5A 2GFJA 5FQBA 5EWAA 1VJNA 5LM6A 2ZO4A 5LSCA 5KIKA 1VMEA 3ZNBA 3IELA 3AF6A 3IOFA 4DILA 4GYQA 1WRAA 5LMCA 2NYPA 2WYMC 4HKYA 5K0WA 4V0HA 5HIOA 4FR7A 3KL7A 3Q6VA 3ZQ4A 4C09A 4C1HA 1BVTA 5K4MA 3KNSA 4XUKA 4D1TA 5ACXA 4BZ3A 2BG8B 3DHBA 1ZTCA 2QDSA 2CFUA 2WYMA 1YCGA 1YCFA 4RL2A 3FCZA 1K07A 2YZ3A 4XWTA 5HH5A 5ACTA 3PG4A 2WHGA 1JJTA 1L9YA 4UAMA 5A87A 3BK1A 2DKFA 3P2UA 3ZR9A 4Z6XA 5AHOA 1QH3A 3VQZA 2BG7A 1WUPA 2BFZA 4F6ZA 2CG3A 2Q0JA 4U4LA 4Z67A 3BV6A 2BC2A 4HL1A 4EFZA 2WYLA 1E5DA 4J5FA 4TZFA 1YCHA 4D1VA 3X30A 3DH8A 1KR3A 2QJSA 5HH6A 2GCUA 2BTNA 3H3EA 2FU9A 2AZ4A 4UWPB 5K4KA 4AWYB 5LE1A 2I7XA 4RL0A 2QEDA 4ZEJA 2XR1A 4C1FA 2P1EA 2YNUA 2NZFA 4C1GA 5EV6A 2BGAA 5ACPA 2YNTB 4NURA 4UWSB 4EYFA 2R2DA 5KILA 2OHJA 5ACVA 5LLDA 4TZEA 2YNWA 2FHXA 4WD6A 3ADRA 4AX0B 5FQAA 4Z5ZA 5LS3A 4AD9A 2BG6A 4TYTA 3AF5A 3F9OA 2UYXA 5LCHA 4RM5A 5B1UA 2Q42A 3SFPA 5DPXA 2M5DA 4D02A 3IEKA 1Y44A 4RAWA 3A4YA 2BG2A 4LE6A 3FAIA 2Q9UA 5A0TA 4UA4A 4RAMA 4Z60A 4AX1B 1JJEA 3RPCA 1X8GA 3T3OA 4PDXA 5EVBA 5ACWA 1DXKA 2BFKA 2VW8A 3JXPA 2BIBA 2H6AA 3IE0A 2I7TA 3SD9A 5AIJA 5K4NA 1WW1A 2OHHA 4UWOB 2BFZB 4O98A 3PY6A 5FQCA 2A7MA 1BMCA 2HB9A 2FU6A 4P62A 2QINA 3KNRA 3X2XA 3T9MA 3BC2A 2GMNA 3I15A 4ZO3A 2P97A 2FM6A 5LCFA 3QH8A 4B87A 4ZNBA 5ACUA 5EV8A 2FK6A 3SBLA 4TZBA 4RBSA 5EH9A 3VPEA 3BK2A 2WRSA 3SPUA 4NQ4A 4GYUA 2YHEA 4BP0A 3R2UA 2YNVB 5EVDA 1X8IA 5B3RA 5AEBA 4TZ9A 3T3NA 2GKLA 3RKJA 3IE1A 1QH5A 2XF4A 4TYFA 3SW3A 1ZNBA 4FEKA 4DIKA 1A8TA 4JO0A 2OHIA 1VGNA 2P4ZA 4NQ6A 3L6NA 3ZWFA 4CHLA 3I14A 3G1PA 3I0VA 3MD7A 4HL2A 2CG2A 4AV7A 4PVTA 2FHXB 2DOOA 1XTOA 3I13A 3TP9A 2NZEA 4AXHA 2BMIA 4J5HA 1DD6A 3X2YA 4C1DA 4C1CA 4EXSA 2CBNA 5HIQA 2BG8A 3RKKA 4F6HA 3LVZA 5IQKA 1XM8A 3X2ZA 5HIPA 4XWWA 4EYLA 4PVOA 1X8HA 2ZNBA 4ZO2A 2AIOA 3AJ3A 2P18A 5LCAA 1M2XA 3ESHA 4C1EA 4GCWA 4NQ2A 4KEPA 5AJLA 2BR6A 1SMLA 5EVKA 2FU7A 3SRXA 4EXYA 5ACQA 3WXCA 4D1WA 1A7TA 4FSBA 2E7YA 4AWZA 5EHTA 4EYBA 3IDZA 5HISA 3DHAA 2Q0IA 2QDTA 2CFZA 5AHRA 2Y87A 1KO3A 3IEMA 1JT1A 5ACRA 4D1UA 5A0VA 2Y8AA 2BFLA 4YSBA 2YCBA 4Z7RA 4UBQA 1KO2A 5AYAA 2NXAA 3I11A 1WUOA 1MQOA 5EW0A 5ACSA 4EY2A 4YSLA 3S0ZA 3IE2A 4H0DA 4Z5YA 2ZZIA 3IOGA
chains in the Genus database with same CATH topology
4UWRB 5A5ZA 5HH4A 2ZWRA 1DDKA 1BC2A 4KEQA 2GFKA 1ZKPA 4YSKA 5B15A 4NQ5A 3DHCA 1HLKA 2I7VA 2Y8BA 5AXOA 2YNVA 1P9EA 2FU8A 5AXRA 2YNTA 2M5CA 3PY5A 2GFJA 5FQBA 5EWAA 1VJNA 5LM6A 2ZO4A 5LSCA 5KIKA 1VMEA 3ZNBA 3IELA 3AF6A 3IOFA 4DILA 4GYQA 1WRAA 5LMCA 2NYPA 2WYMC 4HKYA 5K0WA 4V0HA 5HIOA 4FR7A 3KL7A 3Q6VA 3ZQ4A 4C09A 4C1HA 1BVTA 5K4MA 3KNSA 4XUKA 4D1TA 5ACXA 4BZ3A 2BG8B 3DHBA 1ZTCA 2QDSA 2WYMA 1YCGA 1YCFA 4RL2A 3FCZA 1K07A 2YZ3A 4XWTA 5HH5A 5ACTA 3PG4A 2WHGA 1JJTA 1L9YA 4UAMA 5A87A 3BK1A 2DKFA 3P2UA 3ZR9A 4Z6XA 5AHOA 1QH3A 3VQZA 2BG7A 1WUPA 2BFZA 4F6ZA 2Q0JA 4U4LA 4Z67A 3BV6A 2BC2A 4HL1A 4EFZA 2WYLA 1E5DA 4J5FA 4TZFA 1YCHA 4D1VA 3X30A 3DH8A 1KR3A 2QJSA 5HH6A 2GCUA 2BTNA 3H3EA 2FU9A 2AZ4A 4UWPB 5K4KA 4AWYB 5LE1A 2I7XA 4RL0A 2QEDA 4ZEJA 2XR1A 4C1FA 2P1EA 2YNUA 2NZFA 4C1GA 5EV6A 2BGAA 5ACPA 2YNTB 4UWSB 4EYFA 2R2DA 5KILA 2OHJA 5ACVA 5LLDA 4TZEA 2YNWA 2FHXA 4WD6A 3ADRA 4AX0B 5FQAA 4Z5ZA 5LS3A 4AD9A 2BG6A 4TYTA 3AF5A 3F9OA 2UYXA 5LCHA 4RM5A 5B1UA 2Q42A 3SFPA 5DPXA 2M5DA 4D02A 3IEKA 1Y44A 4RAWA 3A4YA 2BG2A 4LE6A 3FAIA 2Q9UA 5A0TA 4UA4A 4RAMA 4Z60A 4AX1B 1JJEA 3RPCA 1X8GA 3T3OA 5EVBA 5ACWA 1DXKA 2BFKA 2VW8A 3JXPA 2BIBA 2H6AA 3IE0A 2I7TA 3SD9A 5K4NA 1WW1A 2OHHA 4UWOB 2BFZB 4O98A 3PY6A 5FQCA 2A7MA 1BMCA 2HB9A 2FU6A 4P62A 2QINA 3KNRA 3X2XA 3T9MA 3BC2A 2GMNA 3I15A 4ZO3A 2P97A 2FM6A 5LCFA 3QH8A 4B87A 4ZNBA 5ACUA 5EV8A 2FK6A 3SBLA 4TZBA 4RBSA 5EH9A 3VPEA 3BK2A 2WRSA 3SPUA 4NQ4A 4GYUA 4BP0A 3R2UA 2YNVB 5EVDA 1X8IA 5B3RA 5AEBA 4TZ9A 3T3NA 2GKLA 3RKJA 3IE1A 1QH5A 2XF4A 4TYFA 3SW3A 1ZNBA 4FEKA 4DIKA 1A8TA 4JO0A 2OHIA 1VGNA 2P4ZA 4NQ6A 3L6NA 3ZWFA 4CHLA 3I14A 3G1PA 3I0VA 3MD7A 4HL2A 4PVTA 2FHXB 2DOOA 1XTOA 3I13A 3TP9A 2NZEA 2BMIA 4J5HA 1DD6A 3X2YA 4C1DA 4C1CA 4EXSA 2CBNA 5HIQA 2BG8A 3RKKA 4F6HA 3LVZA 5IQKA 1XM8A 3X2ZA 5HIPA 4XWWA 4EYLA 4PVOA 1X8HA 2ZNBA 4ZO2A 2AIOA 3AJ3A 2P18A 5LCAA 1M2XA 3ESHA 4C1EA 4GCWA 4NQ2A 4KEPA 2BR6A 1SMLA 5EVKA 2FU7A 3SRXA 4EXYA 5ACQA 3WXCA 4D1WA 1A7TA 4FSBA 2E7YA 4AWZA 5EHTA 4EYBA 3IDZA 5HISA 3DHAA 2Q0IA 2QDTA 5AHRA 2Y87A 1KO3A 3IEMA 1JT1A 5ACRA 4D1UA 5A0VA 2Y8AA 2BFLA 4YSBA 2YCBA 4Z7RA 4UBQA 1KO2A 5AYAA 2NXAA 3I11A 1WUOA 1MQOA 5EW0A 5ACSA 4EY2A 4YSLA 3S0ZA 3IE2A 4H0DA 4Z5YA 2ZZIA 3IOGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UWR B;  5A5Z A;  5HH4 A;  2ZWR A;  1DDK A;  1BC2 A;  4KEQ A;  2GFK A;  1ZKP A;  4YSK A;  5B15 A;  4NQ5 A;  3DHC A;  1HLK A;  2I7V A;  2Y8B A;  5AXO A;  2YNV A;  1P9E A;  2FU8 A;  5AXR A;  2YNT A;  2M5C A;  3PY5 A;  2GFJ A;  5FQB A;  5EWA A;  1VJN A;  5LM6 A;  2ZO4 A;  5LSC A;  5KIK A;  1VME A;  3ZNB A;  3IEL A;  3AF6 A;  3IOF A;  4DIL A;  4GYQ A;  1WRA A;  5LMC A;  2NYP A;  2WYM C;  4HKY A;  5K0W A;  4V0H A;  5HIO A;  4FR7 A;  3KL7 A;  3Q6V A;  3ZQ4 A;  4C09 A;  4C1H A;  1BVT A;  5K4M A;  3KNS A;  4XUK A;  4D1T A;  5ACX A;  4BZ3 A;  2BG8 B;  3DHB A;  1ZTC A;  2QDS A;  2WYM A;  1YCG A;  1YCF A;  4RL2 A;  3FCZ A;  1K07 A;  2YZ3 A;  4XWT A;  5HH5 A;  5ACT A;  3PG4 A;  2WHG A;  1JJT A;  1L9Y A;  4UAM A;  5A87 A;  3BK1 A;  2DKF A;  3P2U A;  3ZR9 A;  4Z6X A;  5AHO A;  1QH3 A;  3VQZ A;  2BG7 A;  1WUP A;  2BFZ A;  4F6Z A;  2Q0J A;  4U4L A;  4Z67 A;  3BV6 A;  2BC2 A;  4HL1 A;  4EFZ A;  2WYL A;  1E5D A;  4J5F A;  4TZF A;  1YCH A;  4D1V A;  3X30 A;  3DH8 A;  1KR3 A;  2QJS A;  5HH6 A;  2GCU A;  2BTN A;  3H3E A;  2FU9 A;  2AZ4 A;  4UWP B;  5K4K A;  4AWY B;  5LE1 A;  2I7X A;  4RL0 A;  2QED A;  4ZEJ A;  2XR1 A;  4C1F A;  2P1E A;  2YNU A;  2NZF A;  4C1G A;  5EV6 A;  2BGA A;  5ACP A;  2YNT B;  4UWS B;  4EYF A;  2R2D A;  5KIL A;  2OHJ A;  5ACV A;  5LLD A;  4TZE A;  2YNW A;  2FHX A;  4WD6 A;  3ADR A;  4AX0 B;  5FQA A;  4Z5Z A;  5LS3 A;  4AD9 A;  2BG6 A;  4TYT A;  3AF5 A;  3F9O A;  2UYX A;  5LCH A;  4RM5 A;  5B1U A;  2Q42 A;  3SFP A;  5DPX A;  2M5D A;  4D02 A;  3IEK A;  1Y44 A;  4RAW A;  3A4Y A;  2BG2 A;  4LE6 A;  3FAI A;  2Q9U A;  5A0T A;  4UA4 A;  4RAM A;  4Z60 A;  4AX1 B;  1JJE A;  3RPC A;  1X8G A;  3T3O A;  5EVB A;  5ACW A;  1DXK A;  2BFK A;  2VW8 A;  3JXP A;  2BIB A;  2H6A A;  3IE0 A;  2I7T A;  3SD9 A;  5K4N A;  1WW1 A;  2OHH A;  4UWO B;  2BFZ B;  4O98 A;  3PY6 A;  5FQC A;  2A7M A;  1BMC A;  2HB9 A;  2FU6 A;  4P62 A;  2QIN A;  3KNR A;  3X2X A;  3T9M A;  3BC2 A;  2GMN A;  3I15 A;  4ZO3 A;  2P97 A;  2FM6 A;  5LCF A;  3QH8 A;  4B87 A;  4ZNB A;  5ACU A;  5EV8 A;  2FK6 A;  3SBL A;  4TZB A;  4RBS A;  5EH9 A;  3VPE A;  3BK2 A;  2WRS A;  3SPU A;  4NQ4 A;  4GYU A;  4BP0 A;  3R2U A;  2YNV B;  5EVD A;  1X8I A;  5B3R A;  5AEB A;  4TZ9 A;  3T3N A;  2GKL A;  3RKJ A;  3IE1 A;  1QH5 A;  2XF4 A;  4TYF A;  3SW3 A;  1ZNB A;  4FEK A;  4DIK A;  1A8T A;  4JO0 A;  2OHI A;  1VGN A;  2P4Z A;  4NQ6 A;  3L6N A;  3ZWF A;  4CHL A;  3I14 A;  3G1P A;  3I0V A;  3MD7 A;  4HL2 A;  4PVT A;  2FHX B;  2DOO A;  1XTO A;  3I13 A;  3TP9 A;  2NZE A;  2BMI A;  4J5H A;  1DD6 A;  3X2Y A;  4C1D A;  4C1C A;  4EXS A;  2CBN A;  5HIQ A;  2BG8 A;  3RKK A;  4F6H A;  3LVZ A;  5IQK A;  1XM8 A;  3X2Z A;  5HIP A;  4XWW A;  4EYL A;  4PVO A;  1X8H A;  2ZNB A;  4ZO2 A;  2AIO A;  3AJ3 A;  2P18 A;  5LCA A;  1M2X A;  3ESH A;  4C1E A;  4GCW A;  4NQ2 A;  4KEP A;  2BR6 A;  1SML A;  5EVK A;  2FU7 A;  3SRX A;  4EXY A;  5ACQ A;  3WXC A;  4D1W A;  1A7T A;  4FSB A;  2E7Y A;  4AWZ A;  5EHT A;  4EYB A;  3IDZ A;  5HIS A;  3DHA A;  2Q0I A;  2QDT A;  5AHR A;  2Y87 A;  1KO3 A;  3IEM A;  1JT1 A;  5ACR A;  4D1U A;  5A0V A;  2Y8A A;  2BFL A;  4YSB A;  2YCB A;  4Z7R A;  4UBQ A;  1KO2 A;  5AYA A;  2NXA A;  3I11 A;  1WUO A;  1MQO A;  5EW0 A;  5ACS A;  4EY2 A;  4YSL A;  3S0Z A;  3IE2 A;  4H0D A;  4Z5Y A;  2ZZI A;  3IOG A; 
#chains in the Genus database with same CATH topology
 4UWR B;  5A5Z A;  5A23 A;  5HH4 A;  2ZWR A;  1DDK A;  1BC2 A;  4KEQ A;  2GFK A;  1ZKP A;  4YSK A;  5B15 A;  4NQ5 A;  3DHC A;  1HLK A;  2I7V A;  2Y8B A;  5AXO A;  2YNV A;  1P9E A;  2FU8 A;  5AXR A;  2YNT A;  2M5C A;  3PY5 A;  2GFJ A;  5FQB A;  5EWA A;  1VJN A;  5LM6 A;  2ZO4 A;  5LSC A;  5KIK A;  1VME A;  3ZNB A;  3IEL A;  3AF6 A;  3IOF A;  4DIL A;  4GYQ A;  1WRA A;  5LMC A;  2NYP A;  2WYM C;  4HKY A;  5K0W A;  4V0H A;  5HIO A;  4FR7 A;  3KL7 A;  3Q6V A;  3ZQ4 A;  4C09 A;  4C1H A;  1BVT A;  5K4M A;  3KNS A;  4XUK A;  4D1T A;  5ACX A;  4BZ3 A;  2BG8 B;  3DHB A;  1ZTC A;  2QDS A;  2CFU A;  2WYM A;  1YCG A;  1YCF A;  4RL2 A;  3FCZ A;  1K07 A;  2YZ3 A;  4XWT A;  5HH5 A;  5ACT A;  3PG4 A;  2WHG A;  1JJT A;  1L9Y A;  4UAM A;  5A87 A;  3BK1 A;  2DKF A;  3P2U A;  3ZR9 A;  4Z6X A;  5AHO A;  1QH3 A;  3VQZ A;  2BG7 A;  1WUP A;  2BFZ A;  4F6Z A;  2CG3 A;  2Q0J A;  4U4L A;  4Z67 A;  3BV6 A;  2BC2 A;  4HL1 A;  4EFZ A;  2WYL A;  1E5D A;  4J5F A;  4TZF A;  1YCH A;  4D1V A;  3X30 A;  3DH8 A;  1KR3 A;  2QJS A;  5HH6 A;  2GCU A;  2BTN A;  3H3E A;  2FU9 A;  2AZ4 A;  4UWP B;  5K4K A;  4AWY B;  5LE1 A;  2I7X A;  4RL0 A;  2QED A;  4ZEJ A;  2XR1 A;  4C1F A;  2P1E A;  2YNU A;  2NZF A;  4C1G A;  5EV6 A;  2BGA A;  5ACP A;  2YNT B;  4NUR A;  4UWS B;  4EYF A;  2R2D A;  5KIL A;  2OHJ A;  5ACV A;  5LLD A;  4TZE A;  2YNW A;  2FHX A;  4WD6 A;  3ADR A;  4AX0 B;  5FQA A;  4Z5Z A;  5LS3 A;  4AD9 A;  2BG6 A;  4TYT A;  3AF5 A;  3F9O A;  2UYX A;  5LCH A;  4RM5 A;  5B1U A;  2Q42 A;  3SFP A;  5DPX A;  2M5D A;  4D02 A;  3IEK A;  1Y44 A;  4RAW A;  3A4Y A;  2BG2 A;  4LE6 A;  3FAI A;  2Q9U A;  5A0T A;  4UA4 A;  4RAM A;  4Z60 A;  4AX1 B;  1JJE A;  3RPC A;  1X8G A;  3T3O A;  4PDX A;  5EVB A;  5ACW A;  1DXK A;  2BFK A;  2VW8 A;  3JXP A;  2BIB A;  2H6A A;  3IE0 A;  2I7T A;  3SD9 A;  5AIJ A;  5K4N A;  1WW1 A;  2OHH A;  4UWO B;  2BFZ B;  4O98 A;  3PY6 A;  5FQC A;  2A7M A;  1BMC A;  2HB9 A;  2FU6 A;  4P62 A;  2QIN A;  3KNR A;  3X2X A;  3T9M A;  3BC2 A;  2GMN A;  3I15 A;  4ZO3 A;  2P97 A;  2FM6 A;  5LCF A;  3QH8 A;  4B87 A;  4ZNB A;  5ACU A;  5EV8 A;  2FK6 A;  3SBL A;  4TZB A;  4RBS A;  5EH9 A;  3VPE A;  3BK2 A;  2WRS A;  3SPU A;  4NQ4 A;  4GYU A;  2YHE A;  4BP0 A;  3R2U A;  2YNV B;  5EVD A;  1X8I A;  5B3R A;  5AEB A;  4TZ9 A;  3T3N A;  2GKL A;  3RKJ A;  3IE1 A;  1QH5 A;  2XF4 A;  4TYF A;  3SW3 A;  1ZNB A;  4FEK A;  4DIK A;  1A8T A;  4JO0 A;  2OHI A;  1VGN A;  2P4Z A;  4NQ6 A;  3L6N A;  3ZWF A;  4CHL A;  3I14 A;  3G1P A;  3I0V A;  3MD7 A;  4HL2 A;  2CG2 A;  4AV7 A;  4PVT A;  2FHX B;  2DOO A;  1XTO A;  3I13 A;  3TP9 A;  2NZE A;  4AXH A;  2BMI A;  4J5H A;  1DD6 A;  3X2Y A;  4C1D A;  4C1C A;  4EXS A;  2CBN A;  5HIQ A;  2BG8 A;  3RKK A;  4F6H A;  3LVZ A;  5IQK A;  1XM8 A;  3X2Z A;  5HIP A;  4XWW A;  4EYL A;  4PVO A;  1X8H A;  2ZNB A;  4ZO2 A;  2AIO A;  3AJ3 A;  2P18 A;  5LCA A;  1M2X A;  3ESH A;  4C1E A;  4GCW A;  4NQ2 A;  4KEP A;  5AJL A;  2BR6 A;  1SML A;  5EVK A;  2FU7 A;  3SRX A;  4EXY A;  5ACQ A;  3WXC A;  4D1W A;  1A7T A;  4FSB A;  2E7Y A;  4AWZ A;  5EHT A;  4EYB A;  3IDZ A;  5HIS A;  3DHA A;  2Q0I A;  2QDT A;  2CFZ A;  5AHR A;  2Y87 A;  1KO3 A;  3IEM A;  1JT1 A;  5ACR A;  4D1U A;  5A0V A;  2Y8A A;  2BFL A;  4YSB A;  2YCB A;  4Z7R A;  4UBQ A;  1KO2 A;  5AYA A;  2NXA A;  3I11 A;  1WUO A;  1MQO A;  5EW0 A;  5ACS A;  4EY2 A;  4YSL A;  3S0Z A;  3IE2 A;  4H0D A;  4Z5Y A;  2ZZI A;  3IOG A; 
#chains in the Genus database with same CATH homology
 4UWR B;  5A5Z A;  5HH4 A;  2ZWR A;  1DDK A;  1BC2 A;  4KEQ A;  2GFK A;  1ZKP A;  4YSK A;  5B15 A;  4NQ5 A;  3DHC A;  1HLK A;  2I7V A;  2Y8B A;  5AXO A;  2YNV A;  1P9E A;  2FU8 A;  5AXR A;  2YNT A;  2M5C A;  3PY5 A;  2GFJ A;  5FQB A;  5EWA A;  1VJN A;  5LM6 A;  2ZO4 A;  5LSC A;  5KIK A;  1VME A;  3ZNB A;  3IEL A;  3AF6 A;  3IOF A;  4DIL A;  4GYQ A;  1WRA A;  5LMC A;  2NYP A;  2WYM C;  4HKY A;  5K0W A;  4V0H A;  5HIO A;  4FR7 A;  3KL7 A;  3Q6V A;  3ZQ4 A;  4C09 A;  4C1H A;  1BVT A;  5K4M A;  3KNS A;  4XUK A;  4D1T A;  5ACX A;  4BZ3 A;  2BG8 B;  3DHB A;  1ZTC A;  2QDS A;  2WYM A;  1YCG A;  1YCF A;  4RL2 A;  3FCZ A;  1K07 A;  2YZ3 A;  4XWT A;  5HH5 A;  5ACT A;  3PG4 A;  2WHG A;  1JJT A;  1L9Y A;  4UAM A;  5A87 A;  3BK1 A;  2DKF A;  3P2U A;  3ZR9 A;  4Z6X A;  5AHO A;  1QH3 A;  3VQZ A;  2BG7 A;  1WUP A;  2BFZ A;  4F6Z A;  2Q0J A;  4U4L A;  4Z67 A;  3BV6 A;  2BC2 A;  4HL1 A;  4EFZ A;  2WYL A;  1E5D A;  4J5F A;  4TZF A;  1YCH A;  4D1V A;  3X30 A;  3DH8 A;  1KR3 A;  2QJS A;  5HH6 A;  2GCU A;  2BTN A;  3H3E A;  2FU9 A;  2AZ4 A;  4UWP B;  5K4K A;  4AWY B;  5LE1 A;  2I7X A;  4RL0 A;  2QED A;  4ZEJ A;  2XR1 A;  4C1F A;  2P1E A;  2YNU A;  2NZF A;  4C1G A;  5EV6 A;  2BGA A;  5ACP A;  2YNT B;  4UWS B;  4EYF A;  2R2D A;  5KIL A;  2OHJ A;  5ACV A;  5LLD A;  4TZE A;  2YNW A;  2FHX A;  4WD6 A;  3ADR A;  4AX0 B;  5FQA A;  4Z5Z A;  5LS3 A;  4AD9 A;  2BG6 A;  4TYT A;  3AF5 A;  3F9O A;  2UYX A;  5LCH A;  4RM5 A;  5B1U A;  2Q42 A;  3SFP A;  5DPX A;  2M5D A;  4D02 A;  3IEK A;  1Y44 A;  4RAW A;  3A4Y A;  2BG2 A;  4LE6 A;  3FAI A;  2Q9U A;  5A0T A;  4UA4 A;  4RAM A;  4Z60 A;  4AX1 B;  1JJE A;  3RPC A;  1X8G A;  3T3O A;  5EVB A;  5ACW A;  1DXK A;  2BFK A;  2VW8 A;  3JXP A;  2BIB A;  2H6A A;  3IE0 A;  2I7T A;  3SD9 A;  5K4N A;  1WW1 A;  2OHH A;  4UWO B;  2BFZ B;  4O98 A;  3PY6 A;  5FQC A;  2A7M A;  1BMC A;  2HB9 A;  2FU6 A;  4P62 A;  2QIN A;  3KNR A;  3X2X A;  3T9M A;  3BC2 A;  2GMN A;  3I15 A;  4ZO3 A;  2P97 A;  2FM6 A;  5LCF A;  3QH8 A;  4B87 A;  4ZNB A;  5ACU A;  5EV8 A;  2FK6 A;  3SBL A;  4TZB A;  4RBS A;  5EH9 A;  3VPE A;  3BK2 A;  2WRS A;  3SPU A;  4NQ4 A;  4GYU A;  4BP0 A;  3R2U A;  2YNV B;  5EVD A;  1X8I A;  5B3R A;  5AEB A;  4TZ9 A;  3T3N A;  2GKL A;  3RKJ A;  3IE1 A;  1QH5 A;  2XF4 A;  4TYF A;  3SW3 A;  1ZNB A;  4FEK A;  4DIK A;  1A8T A;  4JO0 A;  2OHI A;  1VGN A;  2P4Z A;  4NQ6 A;  3L6N A;  3ZWF A;  4CHL A;  3I14 A;  3G1P A;  3I0V A;  3MD7 A;  4HL2 A;  4PVT A;  2FHX B;  2DOO A;  1XTO A;  3I13 A;  3TP9 A;  2NZE A;  2BMI A;  4J5H A;  1DD6 A;  3X2Y A;  4C1D A;  4C1C A;  4EXS A;  2CBN A;  5HIQ A;  2BG8 A;  3RKK A;  4F6H A;  3LVZ A;  5IQK A;  1XM8 A;  3X2Z A;  5HIP A;  4XWW A;  4EYL A;  4PVO A;  1X8H A;  2ZNB A;  4ZO2 A;  2AIO A;  3AJ3 A;  2P18 A;  5LCA A;  1M2X A;  3ESH A;  4C1E A;  4GCW A;  4NQ2 A;  4KEP A;  2BR6 A;  1SML A;  5EVK A;  2FU7 A;  3SRX A;  4EXY A;  5ACQ A;  3WXC A;  4D1W A;  1A7T A;  4FSB A;  2E7Y A;  4AWZ A;  5EHT A;  4EYB A;  3IDZ A;  5HIS A;  3DHA A;  2Q0I A;  2QDT A;  5AHR A;  2Y87 A;  1KO3 A;  3IEM A;  1JT1 A;  5ACR A;  4D1U A;  5A0V A;  2Y8A A;  2BFL A;  4YSB A;  2YCB A;  4Z7R A;  4UBQ A;  1KO2 A;  5AYA A;  2NXA A;  3I11 A;  1WUO A;  1MQO A;  5EW0 A;  5ACS A;  4EY2 A;  4YSL A;  3S0Z A;  3IE2 A;  4H0D A;  4Z5Y A;  2ZZI A;  3IOG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...