3ADRA

The first crystal structure of an archaeal metallo-beta-lactamase superfamily protein; st1585 from sulfolobus tokodaii
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
259
structure length
259
Chain Sequence
PCRGLHSIPAGPVEFPEIATVYVMCGEKLTVMIDAGVSNSIADFSFLDKLDYIVLTHLHIDHIGLLPELLQVYKAKVLVKSGFKKYLTSEDGLKKLNESAEKVLGDLYYVYGGLEKKLDQDKVIEVEGNEEFDLGGYRMRLIYTPGHARHHMSVLVDDFLFTGDSAGAYFNGVVIPTTPPVIDYKMYMESLKRQIELKPKVVGFAHGGLVSPKIMEEHLKQMLSKEEIQINVDIGGVAGEILRKQIEVNLRGLRESKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein ST1585
publication title The first crystal structure of an archaeal metallo-beta-lactamase superfamily protein; ST1585 from Sulfolobus tokodaii
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Signaling protein
total genus 76
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3adrA00
5ACRA 1E5DA 5ACXA 4D1VA 2HB9A 2VW8A 3VPEA 1YCFA 5EWAA 4GYQA 4HL1A 4AWZA 3AJ3A 3TP9A 2Y8BA 4D02A 4WD6A 1KO2A 3BC2A 5LE1A 3F9OA 5AYAA 5DPXA 2I7VA 3SRXA 2P97A 3PY6A 5FQAA 4TYTA 2A7MA 1DD6A 3IEKA 4UAMA 1MQOA 2BIBA 4ZO3A 2YNTA 4EXYA 1M2XA 4PVTA 2Q42A 2WHGA 1ZKPA 3PY5A 4LE6A 4XWWA 3KNRA 5A0VA 4TZFA 2ZZIA 3SBLA 2P18A 5A5ZA 2OHJA 3S0ZA 3G1PA 2GCUA 4EFZA 2M5DA 2OHHA 3A4YA 4RBSA 3ZQ4A 5LMCA 5AXRA 4C09A 4F6ZA 3X30A 2R2DA 4J5HA 1BC2A 2CBNA 4ZO2A 1QH3A 1WUOA 2FU8A 5ACUA 5ACVA 4EY2A 4XWTA 5LCFA 1BVTA 1QH5A 2GMNA 2WYMA 5AXOA 2QDSA 2WYMC 3BK2A 3X2YA 2BG7A 2Q0JA 4NQ6A 1P9EA 2NYPA 2I7XA 3T3NA 4UA4A 2BG8B 4Z6XA 1Y44A 3DHCA 1WUPA 3BV6A 4UWRB 3SFPA 3SW3A 2YNWA 4UWOB 1VJNA 1ZTCA 4UWSB 2P4ZA 2BFZA 5LCHA 4J5FA 2OHIA 4Z67A 3PG4A 1DXKA 4RL0A 4UWPB 2QEDA 5HIOA 2FU6A 2AIOA 4DIKA 3JXPA 5EVKA 3I0VA 4FSBA 4BZ3A 2NXAA 4AX1B 3ESHA 5FQBA 3IE0A 2YNVB 1WRAA 5ACPA 2Y87A 3T3OA 3IELA 3IEMA 3BK1A 5A0TA 4CHLA 2YNTB 4U4LA 2YNVA 4C1HA 3H3EA 5HH6A 4O98A 2FU9A 3FCZA 4C1FA 4YSLA 4TZEA 1YCHA 1WW1A 1ZNBA 3X2ZA 3IDZA 4V0HA 3LVZA 3VQZA 2FHXA 5KILA 5EW0A 2BTNA 4AX0B 3AF6A 4RAMA 2YCBA 5HIPA 5K4NA 1SMLA 4XUKA 3RKKA 4B87A 3ADRA 2BFKA 2YZ3A 2XF4A 4PVOA 5HIQA 5HH5A 3KNSA 3IOFA 2Q9UA 4HL2A 3RPCA 3SD9A 3I13A 2Q0IA 2ZO4A 1XM8A 1X8HA 1JJEA 4H0DA 3I14A 5ACSA 5ACWA 3QH8A 2NZFA 4Z5YA 2BGAA 3DHAA 5EV6A 2H6AA 4NQ4A 2BFZB 2BC2A 5B1UA 2P1EA 4NQ2A 4EYLA 2FM6A 5EVBA 4DILA 2WRSA 5ACTA 5AHOA 4EYBA 5HH4A 4KEPA 4YSKA 5A87A 4YSBA 1VGNA 3DH8A 2BMIA 5ACQA 1A8TA 1KO3A 2I7TA 1X8GA 2DOOA 3ZWFA 5LSCA 2GKLA 5FQCA 5EH9A 5B3RA 4TYFA 4HKYA 4P62A 2Y8AA 3WXCA 2DKFA 1VMEA 4ZNBA 3ZR9A 2AZ4A 2YNUA 5IQKA 2FHXB 2ZWRA 5K4MA 5LLDA 2BFLA 1YCGA 3RKJA 3AF5A 2GFKA 4AWYB 4C1GA 4AD9A 1KR3A 4D1TA 5LCAA 3ZNBA 4KEQA 3R2UA 4RL2A 2GFJA 1A7TA 4D1UA 3SPUA 4GYUA 3T9MA 5HISA 3Q6VA 3I15A 1HLKA 5AHRA 1JJTA 4C1CA 4FEKA 5EVDA 4JO0A 5KIKA 5EV8A 3IE2A 2NZEA 3L6NA 2QINA 4EXSA 2E7YA 5EHTA 2BG6A 3KL7A 4RM5A 4TZ9A 1L9YA 4NQ5A 4C1DA 4D1WA 3P2UA 2BG2A 3IOGA 4BP0A 3MD7A 2QDTA 3X2XA 2UYXA 2BR6A 3IE1A 4UBQA 5LM6A 1BMCA 4RAWA 5AEBA 2ZNBA 2XR1A 5K4KA 4Z7RA 4C1EA 5K0WA 2QJSA 5LS3A 3DHBA 1JT1A 2M5CA 4Z5ZA 2FU7A 4GCWA 4ZEJA 4EYFA 1DDKA 3I11A 2BG8A 1K07A 2FK6A 5B15A 4F6HA 2WYLA 1X8IA 4Z60A 4FR7A 3FAIA 1XTOA 4TZBA
chains in the Genus database with same CATH superfamily
5ACRA 1E5DA 5ACXA 4D1VA 2HB9A 2VW8A 3VPEA 1YCFA 5EWAA 4GYQA 4HL1A 4AWZA 3AJ3A 3TP9A 2Y8BA 4D02A 4WD6A 4PDXA 1KO2A 3BC2A 5LE1A 3F9OA 5AYAA 5DPXA 2I7VA 3SRXA 2P97A 3PY6A 5FQAA 4TYTA 2A7MA 1DD6A 2CG3A 3IEKA 4UAMA 1MQOA 2BIBA 4ZO3A 2YNTA 4EXYA 1M2XA 4PVTA 2Q42A 2WHGA 1ZKPA 3PY5A 4LE6A 4XWWA 3KNRA 5A0VA 4TZFA 2ZZIA 3SBLA 2P18A 2CFZA 5A5ZA 2OHJA 3S0ZA 3G1PA 2GCUA 4EFZA 2M5DA 2OHHA 3A4YA 4RBSA 3ZQ4A 5LMCA 5AXRA 4C09A 4F6ZA 3X30A 2R2DA 4J5HA 1BC2A 2CBNA 4ZO2A 1QH3A 1WUOA 2FU8A 5ACUA 5ACVA 4EY2A 4XWTA 5LCFA 1BVTA 1QH5A 2GMNA 2WYMA 5AXOA 2QDSA 2WYMC 3BK2A 3X2YA 2BG7A 2Q0JA 4NQ6A 1P9EA 2NYPA 2I7XA 3T3NA 4UA4A 2BG8B 4Z6XA 1Y44A 3DHCA 1WUPA 3BV6A 4UWRB 3SFPA 3SW3A 2YNWA 4UWOB 1VJNA 1ZTCA 4UWSB 2P4ZA 2BFZA 5LCHA 4J5FA 2OHIA 4Z67A 3PG4A 1DXKA 4RL0A 4UWPB 2QEDA 5HIOA 2FU6A 2AIOA 4DIKA 3JXPA 5EVKA 5AIJA 3I0VA 4FSBA 4BZ3A 2NXAA 4AX1B 3ESHA 5FQBA 3IE0A 2YNVB 1WRAA 5ACPA 2Y87A 3T3OA 3IELA 3IEMA 3BK1A 5A0TA 4CHLA 2YNTB 4U4LA 2YNVA 4C1HA 3H3EA 5HH6A 4O98A 2FU9A 3FCZA 4C1FA 4YSLA 4TZEA 1YCHA 1WW1A 1ZNBA 3X2ZA 3IDZA 4V0HA 3LVZA 3VQZA 2FHXA 5KILA 5EW0A 2BTNA 4AX0B 3AF6A 4RAMA 2YCBA 5HIPA 5K4NA 1SMLA 4XUKA 3RKKA 4B87A 3ADRA 2BFKA 2YZ3A 2XF4A 4PVOA 5HIQA 5HH5A 3KNSA 3IOFA 2Q9UA 4HL2A 3RPCA 2CG2A 3SD9A 3I13A 2Q0IA 2ZO4A 1XM8A 1X8HA 1JJEA 4H0DA 3I14A 5ACSA 5ACWA 3QH8A 2NZFA 4Z5YA 2BGAA 3DHAA 5EV6A 2H6AA 4NQ4A 2BFZB 2BC2A 4NURA 5B1UA 2P1EA 4NQ2A 4EYLA 2FM6A 5EVBA 4DILA 2WRSA 5ACTA 5AHOA 4EYBA 5HH4A 4KEPA 4YSKA 5A87A 4YSBA 1VGNA 3DH8A 2BMIA 5ACQA 1A8TA 1KO3A 2I7TA 1X8GA 2DOOA 3ZWFA 5LSCA 2GKLA 5FQCA 5EH9A 5B3RA 4TYFA 2CFUA 4HKYA 4P62A 2Y8AA 3WXCA 5AJLA 2DKFA 1VMEA 4ZNBA 4AXHA 3ZR9A 2AZ4A 2YNUA 5IQKA 2FHXB 2ZWRA 5K4MA 5LLDA 2BFLA 1YCGA 3RKJA 3AF5A 2GFKA 4AWYB 4C1GA 4AD9A 1KR3A 4D1TA 5LCAA 3ZNBA 4KEQA 3R2UA 4RL2A 2GFJA 1A7TA 4D1UA 3SPUA 4GYUA 3T9MA 5HISA 3Q6VA 3I15A 1HLKA 5AHRA 1JJTA 4C1CA 4FEKA 5EVDA 4JO0A 5KIKA 5EV8A 3IE2A 2NZEA 3L6NA 2QINA 4EXSA 2E7YA 5EHTA 2BG6A 3KL7A 4RM5A 4TZ9A 1L9YA 4NQ5A 4C1DA 4D1WA 3P2UA 5A23A 2BG2A 3IOGA 4BP0A 3MD7A 2QDTA 3X2XA 2UYXA 2BR6A 3IE1A 4UBQA 5LM6A 1BMCA 4RAWA 5AEBA 2YHEA 2ZNBA 2XR1A 5K4KA 4Z7RA 4C1EA 5K0WA 2QJSA 5LS3A 3DHBA 1JT1A 2M5CA 4Z5ZA 2FU7A 4GCWA 4ZEJA 4EYFA 1DDKA 3I11A 2BG8A 1K07A 2FK6A 5B15A 4F6HA 4AV7A 2WYLA 1X8IA 4Z60A 4FR7A 3FAIA 1XTOA 4TZBA
chains in the Genus database with same CATH topology
5ACRA 1E5DA 5ACXA 4D1VA 2HB9A 2VW8A 3VPEA 1YCFA 5EWAA 4GYQA 4HL1A 4AWZA 3AJ3A 3TP9A 2Y8BA 4D02A 4WD6A 1KO2A 3BC2A 5LE1A 3F9OA 5AYAA 5DPXA 2I7VA 3SRXA 2P97A 3PY6A 5FQAA 4TYTA 2A7MA 1DD6A 3IEKA 4UAMA 1MQOA 2BIBA 4ZO3A 2YNTA 4EXYA 1M2XA 4PVTA 2Q42A 2WHGA 1ZKPA 3PY5A 4LE6A 4XWWA 3KNRA 5A0VA 4TZFA 2ZZIA 3SBLA 2P18A 5A5ZA 2OHJA 3S0ZA 3G1PA 2GCUA 4EFZA 2M5DA 2OHHA 3A4YA 4RBSA 3ZQ4A 5LMCA 5AXRA 4C09A 4F6ZA 3X30A 2R2DA 4J5HA 1BC2A 2CBNA 4ZO2A 1QH3A 1WUOA 2FU8A 5ACUA 5ACVA 4EY2A 4XWTA 5LCFA 1BVTA 1QH5A 2GMNA 2WYMA 5AXOA 2QDSA 2WYMC 3BK2A 3X2YA 2BG7A 2Q0JA 4NQ6A 1P9EA 2NYPA 2I7XA 3T3NA 4UA4A 2BG8B 4Z6XA 1Y44A 3DHCA 1WUPA 3BV6A 4UWRB 3SFPA 3SW3A 2YNWA 4UWOB 1VJNA 1ZTCA 4UWSB 2P4ZA 2BFZA 5LCHA 4J5FA 2OHIA 4Z67A 3PG4A 1DXKA 4RL0A 4UWPB 2QEDA 5HIOA 2FU6A 2AIOA 4DIKA 3JXPA 5EVKA 3I0VA 4FSBA 4BZ3A 2NXAA 4AX1B 3ESHA 5FQBA 3IE0A 2YNVB 1WRAA 5ACPA 2Y87A 3T3OA 3IELA 3IEMA 3BK1A 5A0TA 4CHLA 2YNTB 4U4LA 2YNVA 4C1HA 3H3EA 5HH6A 4O98A 2FU9A 3FCZA 4C1FA 4YSLA 4TZEA 1YCHA 1WW1A 1ZNBA 3X2ZA 3IDZA 4V0HA 3LVZA 3VQZA 2FHXA 5KILA 5EW0A 2BTNA 4AX0B 3AF6A 4RAMA 2YCBA 5HIPA 5K4NA 1SMLA 4XUKA 3RKKA 4B87A 3ADRA 2BFKA 2YZ3A 2XF4A 4PVOA 5HIQA 5HH5A 3KNSA 3IOFA 2Q9UA 4HL2A 3RPCA 3SD9A 3I13A 2Q0IA 2ZO4A 1XM8A 1X8HA 1JJEA 4H0DA 3I14A 5ACSA 5ACWA 3QH8A 2NZFA 4Z5YA 2BGAA 3DHAA 5EV6A 2H6AA 4NQ4A 2BFZB 2BC2A 5B1UA 2P1EA 4NQ2A 4EYLA 2FM6A 5EVBA 4DILA 2WRSA 5ACTA 5AHOA 4EYBA 5HH4A 4KEPA 4YSKA 5A87A 4YSBA 1VGNA 3DH8A 2BMIA 5ACQA 1A8TA 1KO3A 2I7TA 1X8GA 2DOOA 3ZWFA 5LSCA 2GKLA 5FQCA 5EH9A 5B3RA 4TYFA 4HKYA 4P62A 2Y8AA 3WXCA 2DKFA 1VMEA 4ZNBA 3ZR9A 2AZ4A 2YNUA 5IQKA 2FHXB 2ZWRA 5K4MA 5LLDA 2BFLA 1YCGA 3RKJA 3AF5A 2GFKA 4AWYB 4C1GA 4AD9A 1KR3A 4D1TA 5LCAA 3ZNBA 4KEQA 3R2UA 4RL2A 2GFJA 1A7TA 4D1UA 3SPUA 4GYUA 3T9MA 5HISA 3Q6VA 3I15A 1HLKA 5AHRA 1JJTA 4C1CA 4FEKA 5EVDA 4JO0A 5KIKA 5EV8A 3IE2A 2NZEA 3L6NA 2QINA 4EXSA 2E7YA 5EHTA 2BG6A 3KL7A 4RM5A 4TZ9A 1L9YA 4NQ5A 4C1DA 4D1WA 3P2UA 2BG2A 3IOGA 4BP0A 3MD7A 2QDTA 3X2XA 2UYXA 2BR6A 3IE1A 4UBQA 5LM6A 1BMCA 4RAWA 5AEBA 2ZNBA 2XR1A 5K4KA 4Z7RA 4C1EA 5K0WA 2QJSA 5LS3A 3DHBA 1JT1A 2M5CA 4Z5ZA 2FU7A 4GCWA 4ZEJA 4EYFA 1DDKA 3I11A 2BG8A 1K07A 2FK6A 5B15A 4F6HA 2WYLA 1X8IA 4Z60A 4FR7A 3FAIA 1XTOA 4TZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ACR A;  1E5D A;  5ACX A;  4D1V A;  2HB9 A;  2VW8 A;  3VPE A;  1YCF A;  5EWA A;  4GYQ A;  4HL1 A;  4AWZ A;  3AJ3 A;  3TP9 A;  2Y8B A;  4D02 A;  4WD6 A;  1KO2 A;  3BC2 A;  5LE1 A;  3F9O A;  5AYA A;  5DPX A;  2I7V A;  3SRX A;  2P97 A;  3PY6 A;  5FQA A;  4TYT A;  2A7M A;  1DD6 A;  3IEK A;  4UAM A;  1MQO A;  2BIB A;  4ZO3 A;  2YNT A;  4EXY A;  1M2X A;  4PVT A;  2Q42 A;  2WHG A;  1ZKP A;  3PY5 A;  4LE6 A;  4XWW A;  3KNR A;  5A0V A;  4TZF A;  2ZZI A;  3SBL A;  2P18 A;  5A5Z A;  2OHJ A;  3S0Z A;  3G1P A;  2GCU A;  4EFZ A;  2M5D A;  2OHH A;  3A4Y A;  4RBS A;  3ZQ4 A;  5LMC A;  5AXR A;  4C09 A;  4F6Z A;  3X30 A;  2R2D A;  4J5H A;  1BC2 A;  2CBN A;  4ZO2 A;  1QH3 A;  1WUO A;  2FU8 A;  5ACU A;  5ACV A;  4EY2 A;  4XWT A;  5LCF A;  1BVT A;  1QH5 A;  2GMN A;  2WYM A;  5AXO A;  2QDS A;  2WYM C;  3BK2 A;  3X2Y A;  2BG7 A;  2Q0J A;  4NQ6 A;  1P9E A;  2NYP A;  2I7X A;  3T3N A;  4UA4 A;  2BG8 B;  4Z6X A;  1Y44 A;  3DHC A;  1WUP A;  3BV6 A;  4UWR B;  3SFP A;  3SW3 A;  2YNW A;  4UWO B;  1VJN A;  1ZTC A;  4UWS B;  2P4Z A;  2BFZ A;  5LCH A;  4J5F A;  2OHI A;  4Z67 A;  3PG4 A;  1DXK A;  4RL0 A;  4UWP B;  2QED A;  5HIO A;  2FU6 A;  2AIO A;  4DIK A;  3JXP A;  5EVK A;  3I0V A;  4FSB A;  4BZ3 A;  2NXA A;  4AX1 B;  3ESH A;  5FQB A;  3IE0 A;  2YNV B;  1WRA A;  5ACP A;  2Y87 A;  3T3O A;  3IEL A;  3IEM A;  3BK1 A;  5A0T A;  4CHL A;  2YNT B;  4U4L A;  2YNV A;  4C1H A;  3H3E A;  5HH6 A;  4O98 A;  2FU9 A;  3FCZ A;  4C1F A;  4YSL A;  4TZE A;  1YCH A;  1WW1 A;  1ZNB A;  3X2Z A;  3IDZ A;  4V0H A;  3LVZ A;  3VQZ A;  2FHX A;  5KIL A;  5EW0 A;  2BTN A;  4AX0 B;  3AF6 A;  4RAM A;  2YCB A;  5HIP A;  5K4N A;  1SML A;  4XUK A;  3RKK A;  4B87 A;  3ADR A;  2BFK A;  2YZ3 A;  2XF4 A;  4PVO A;  5HIQ A;  5HH5 A;  3KNS A;  3IOF A;  2Q9U A;  4HL2 A;  3RPC A;  3SD9 A;  3I13 A;  2Q0I A;  2ZO4 A;  1XM8 A;  1X8H A;  1JJE A;  4H0D A;  3I14 A;  5ACS A;  5ACW A;  3QH8 A;  2NZF A;  4Z5Y A;  2BGA A;  3DHA A;  5EV6 A;  2H6A A;  4NQ4 A;  2BFZ B;  2BC2 A;  5B1U A;  2P1E A;  4NQ2 A;  4EYL A;  2FM6 A;  5EVB A;  4DIL A;  2WRS A;  5ACT A;  5AHO A;  4EYB A;  5HH4 A;  4KEP A;  4YSK A;  5A87 A;  4YSB A;  1VGN A;  3DH8 A;  2BMI A;  5ACQ A;  1A8T A;  1KO3 A;  2I7T A;  1X8G A;  2DOO A;  3ZWF A;  5LSC A;  2GKL A;  5FQC A;  5EH9 A;  5B3R A;  4TYF A;  4HKY A;  4P62 A;  2Y8A A;  3WXC A;  2DKF A;  1VME A;  4ZNB A;  3ZR9 A;  2AZ4 A;  2YNU A;  5IQK A;  2FHX B;  2ZWR A;  5K4M A;  5LLD A;  2BFL A;  1YCG A;  3RKJ A;  3AF5 A;  2GFK A;  4AWY B;  4C1G A;  4AD9 A;  1KR3 A;  4D1T A;  5LCA A;  3ZNB A;  4KEQ A;  3R2U A;  4RL2 A;  2GFJ A;  1A7T A;  4D1U A;  3SPU A;  4GYU A;  3T9M A;  5HIS A;  3Q6V A;  3I15 A;  1HLK A;  5AHR A;  1JJT A;  4C1C A;  4FEK A;  5EVD A;  4JO0 A;  5KIK A;  5EV8 A;  3IE2 A;  2NZE A;  3L6N A;  2QIN A;  4EXS A;  2E7Y A;  5EHT A;  2BG6 A;  3KL7 A;  4RM5 A;  4TZ9 A;  1L9Y A;  4NQ5 A;  4C1D A;  4D1W A;  3P2U A;  2BG2 A;  3IOG A;  4BP0 A;  3MD7 A;  2QDT A;  3X2X A;  2UYX A;  2BR6 A;  3IE1 A;  4UBQ A;  5LM6 A;  1BMC A;  4RAW A;  5AEB A;  2ZNB A;  2XR1 A;  5K4K A;  4Z7R A;  4C1E A;  5K0W A;  2QJS A;  5LS3 A;  3DHB A;  1JT1 A;  2M5C A;  4Z5Z A;  2FU7 A;  4GCW A;  4ZEJ A;  4EYF A;  1DDK A;  3I11 A;  2BG8 A;  1K07 A;  2FK6 A;  5B15 A;  4F6H A;  2WYL A;  1X8I A;  4Z60 A;  4FR7 A;  3FAI A;  1XTO A;  4TZB A; 
#chains in the Genus database with same CATH topology
 5ACR A;  1E5D A;  5ACX A;  4D1V A;  2HB9 A;  2VW8 A;  3VPE A;  1YCF A;  5EWA A;  4GYQ A;  4HL1 A;  4AWZ A;  3AJ3 A;  3TP9 A;  2Y8B A;  4D02 A;  4WD6 A;  4PDX A;  1KO2 A;  3BC2 A;  5LE1 A;  3F9O A;  5AYA A;  5DPX A;  2I7V A;  3SRX A;  2P97 A;  3PY6 A;  5FQA A;  4TYT A;  2A7M A;  1DD6 A;  2CG3 A;  3IEK A;  4UAM A;  1MQO A;  2BIB A;  4ZO3 A;  2YNT A;  4EXY A;  1M2X A;  4PVT A;  2Q42 A;  2WHG A;  1ZKP A;  3PY5 A;  4LE6 A;  4XWW A;  3KNR A;  5A0V A;  4TZF A;  2ZZI A;  3SBL A;  2P18 A;  2CFZ A;  5A5Z A;  2OHJ A;  3S0Z A;  3G1P A;  2GCU A;  4EFZ A;  2M5D A;  2OHH A;  3A4Y A;  4RBS A;  3ZQ4 A;  5LMC A;  5AXR A;  4C09 A;  4F6Z A;  3X30 A;  2R2D A;  4J5H A;  1BC2 A;  2CBN A;  4ZO2 A;  1QH3 A;  1WUO A;  2FU8 A;  5ACU A;  5ACV A;  4EY2 A;  4XWT A;  5LCF A;  1BVT A;  1QH5 A;  2GMN A;  2WYM A;  5AXO A;  2QDS A;  2WYM C;  3BK2 A;  3X2Y A;  2BG7 A;  2Q0J A;  4NQ6 A;  1P9E A;  2NYP A;  2I7X A;  3T3N A;  4UA4 A;  2BG8 B;  4Z6X A;  1Y44 A;  3DHC A;  1WUP A;  3BV6 A;  4UWR B;  3SFP A;  3SW3 A;  2YNW A;  4UWO B;  1VJN A;  1ZTC A;  4UWS B;  2P4Z A;  2BFZ A;  5LCH A;  4J5F A;  2OHI A;  4Z67 A;  3PG4 A;  1DXK A;  4RL0 A;  4UWP B;  2QED A;  5HIO A;  2FU6 A;  2AIO A;  4DIK A;  3JXP A;  5EVK A;  5AIJ A;  3I0V A;  4FSB A;  4BZ3 A;  2NXA A;  4AX1 B;  3ESH A;  5FQB A;  3IE0 A;  2YNV B;  1WRA A;  5ACP A;  2Y87 A;  3T3O A;  3IEL A;  3IEM A;  3BK1 A;  5A0T A;  4CHL A;  2YNT B;  4U4L A;  2YNV A;  4C1H A;  3H3E A;  5HH6 A;  4O98 A;  2FU9 A;  3FCZ A;  4C1F A;  4YSL A;  4TZE A;  1YCH A;  1WW1 A;  1ZNB A;  3X2Z A;  3IDZ A;  4V0H A;  3LVZ A;  3VQZ A;  2FHX A;  5KIL A;  5EW0 A;  2BTN A;  4AX0 B;  3AF6 A;  4RAM A;  2YCB A;  5HIP A;  5K4N A;  1SML A;  4XUK A;  3RKK A;  4B87 A;  3ADR A;  2BFK A;  2YZ3 A;  2XF4 A;  4PVO A;  5HIQ A;  5HH5 A;  3KNS A;  3IOF A;  2Q9U A;  4HL2 A;  3RPC A;  2CG2 A;  3SD9 A;  3I13 A;  2Q0I A;  2ZO4 A;  1XM8 A;  1X8H A;  1JJE A;  4H0D A;  3I14 A;  5ACS A;  5ACW A;  3QH8 A;  2NZF A;  4Z5Y A;  2BGA A;  3DHA A;  5EV6 A;  2H6A A;  4NQ4 A;  2BFZ B;  2BC2 A;  4NUR A;  5B1U A;  2P1E A;  4NQ2 A;  4EYL A;  2FM6 A;  5EVB A;  4DIL A;  2WRS A;  5ACT A;  5AHO A;  4EYB A;  5HH4 A;  4KEP A;  4YSK A;  5A87 A;  4YSB A;  1VGN A;  3DH8 A;  2BMI A;  5ACQ A;  1A8T A;  1KO3 A;  2I7T A;  1X8G A;  2DOO A;  3ZWF A;  5LSC A;  2GKL A;  5FQC A;  5EH9 A;  5B3R A;  4TYF A;  2CFU A;  4HKY A;  4P62 A;  2Y8A A;  3WXC A;  5AJL A;  2DKF A;  1VME A;  4ZNB A;  4AXH A;  3ZR9 A;  2AZ4 A;  2YNU A;  5IQK A;  2FHX B;  2ZWR A;  5K4M A;  5LLD A;  2BFL A;  1YCG A;  3RKJ A;  3AF5 A;  2GFK A;  4AWY B;  4C1G A;  4AD9 A;  1KR3 A;  4D1T A;  5LCA A;  3ZNB A;  4KEQ A;  3R2U A;  4RL2 A;  2GFJ A;  1A7T A;  4D1U A;  3SPU A;  4GYU A;  3T9M A;  5HIS A;  3Q6V A;  3I15 A;  1HLK A;  5AHR A;  1JJT A;  4C1C A;  4FEK A;  5EVD A;  4JO0 A;  5KIK A;  5EV8 A;  3IE2 A;  2NZE A;  3L6N A;  2QIN A;  4EXS A;  2E7Y A;  5EHT A;  2BG6 A;  3KL7 A;  4RM5 A;  4TZ9 A;  1L9Y A;  4NQ5 A;  4C1D A;  4D1W A;  3P2U A;  5A23 A;  2BG2 A;  3IOG A;  4BP0 A;  3MD7 A;  2QDT A;  3X2X A;  2UYX A;  2BR6 A;  3IE1 A;  4UBQ A;  5LM6 A;  1BMC A;  4RAW A;  5AEB A;  2YHE A;  2ZNB A;  2XR1 A;  5K4K A;  4Z7R A;  4C1E A;  5K0W A;  2QJS A;  5LS3 A;  3DHB A;  1JT1 A;  2M5C A;  4Z5Z A;  2FU7 A;  4GCW A;  4ZEJ A;  4EYF A;  1DDK A;  3I11 A;  2BG8 A;  1K07 A;  2FK6 A;  5B15 A;  4F6H A;  4AV7 A;  2WYL A;  1X8I A;  4Z60 A;  4FR7 A;  3FAI A;  1XTO A;  4TZB A; 
#chains in the Genus database with same CATH homology
 5ACR A;  1E5D A;  5ACX A;  4D1V A;  2HB9 A;  2VW8 A;  3VPE A;  1YCF A;  5EWA A;  4GYQ A;  4HL1 A;  4AWZ A;  3AJ3 A;  3TP9 A;  2Y8B A;  4D02 A;  4WD6 A;  1KO2 A;  3BC2 A;  5LE1 A;  3F9O A;  5AYA A;  5DPX A;  2I7V A;  3SRX A;  2P97 A;  3PY6 A;  5FQA A;  4TYT A;  2A7M A;  1DD6 A;  3IEK A;  4UAM A;  1MQO A;  2BIB A;  4ZO3 A;  2YNT A;  4EXY A;  1M2X A;  4PVT A;  2Q42 A;  2WHG A;  1ZKP A;  3PY5 A;  4LE6 A;  4XWW A;  3KNR A;  5A0V A;  4TZF A;  2ZZI A;  3SBL A;  2P18 A;  5A5Z A;  2OHJ A;  3S0Z A;  3G1P A;  2GCU A;  4EFZ A;  2M5D A;  2OHH A;  3A4Y A;  4RBS A;  3ZQ4 A;  5LMC A;  5AXR A;  4C09 A;  4F6Z A;  3X30 A;  2R2D A;  4J5H A;  1BC2 A;  2CBN A;  4ZO2 A;  1QH3 A;  1WUO A;  2FU8 A;  5ACU A;  5ACV A;  4EY2 A;  4XWT A;  5LCF A;  1BVT A;  1QH5 A;  2GMN A;  2WYM A;  5AXO A;  2QDS A;  2WYM C;  3BK2 A;  3X2Y A;  2BG7 A;  2Q0J A;  4NQ6 A;  1P9E A;  2NYP A;  2I7X A;  3T3N A;  4UA4 A;  2BG8 B;  4Z6X A;  1Y44 A;  3DHC A;  1WUP A;  3BV6 A;  4UWR B;  3SFP A;  3SW3 A;  2YNW A;  4UWO B;  1VJN A;  1ZTC A;  4UWS B;  2P4Z A;  2BFZ A;  5LCH A;  4J5F A;  2OHI A;  4Z67 A;  3PG4 A;  1DXK A;  4RL0 A;  4UWP B;  2QED A;  5HIO A;  2FU6 A;  2AIO A;  4DIK A;  3JXP A;  5EVK A;  3I0V A;  4FSB A;  4BZ3 A;  2NXA A;  4AX1 B;  3ESH A;  5FQB A;  3IE0 A;  2YNV B;  1WRA A;  5ACP A;  2Y87 A;  3T3O A;  3IEL A;  3IEM A;  3BK1 A;  5A0T A;  4CHL A;  2YNT B;  4U4L A;  2YNV A;  4C1H A;  3H3E A;  5HH6 A;  4O98 A;  2FU9 A;  3FCZ A;  4C1F A;  4YSL A;  4TZE A;  1YCH A;  1WW1 A;  1ZNB A;  3X2Z A;  3IDZ A;  4V0H A;  3LVZ A;  3VQZ A;  2FHX A;  5KIL A;  5EW0 A;  2BTN A;  4AX0 B;  3AF6 A;  4RAM A;  2YCB A;  5HIP A;  5K4N A;  1SML A;  4XUK A;  3RKK A;  4B87 A;  3ADR A;  2BFK A;  2YZ3 A;  2XF4 A;  4PVO A;  5HIQ A;  5HH5 A;  3KNS A;  3IOF A;  2Q9U A;  4HL2 A;  3RPC A;  3SD9 A;  3I13 A;  2Q0I A;  2ZO4 A;  1XM8 A;  1X8H A;  1JJE A;  4H0D A;  3I14 A;  5ACS A;  5ACW A;  3QH8 A;  2NZF A;  4Z5Y A;  2BGA A;  3DHA A;  5EV6 A;  2H6A A;  4NQ4 A;  2BFZ B;  2BC2 A;  5B1U A;  2P1E A;  4NQ2 A;  4EYL A;  2FM6 A;  5EVB A;  4DIL A;  2WRS A;  5ACT A;  5AHO A;  4EYB A;  5HH4 A;  4KEP A;  4YSK A;  5A87 A;  4YSB A;  1VGN A;  3DH8 A;  2BMI A;  5ACQ A;  1A8T A;  1KO3 A;  2I7T A;  1X8G A;  2DOO A;  3ZWF A;  5LSC A;  2GKL A;  5FQC A;  5EH9 A;  5B3R A;  4TYF A;  4HKY A;  4P62 A;  2Y8A A;  3WXC A;  2DKF A;  1VME A;  4ZNB A;  3ZR9 A;  2AZ4 A;  2YNU A;  5IQK A;  2FHX B;  2ZWR A;  5K4M A;  5LLD A;  2BFL A;  1YCG A;  3RKJ A;  3AF5 A;  2GFK A;  4AWY B;  4C1G A;  4AD9 A;  1KR3 A;  4D1T A;  5LCA A;  3ZNB A;  4KEQ A;  3R2U A;  4RL2 A;  2GFJ A;  1A7T A;  4D1U A;  3SPU A;  4GYU A;  3T9M A;  5HIS A;  3Q6V A;  3I15 A;  1HLK A;  5AHR A;  1JJT A;  4C1C A;  4FEK A;  5EVD A;  4JO0 A;  5KIK A;  5EV8 A;  3IE2 A;  2NZE A;  3L6N A;  2QIN A;  4EXS A;  2E7Y A;  5EHT A;  2BG6 A;  3KL7 A;  4RM5 A;  4TZ9 A;  1L9Y A;  4NQ5 A;  4C1D A;  4D1W A;  3P2U A;  2BG2 A;  3IOG A;  4BP0 A;  3MD7 A;  2QDT A;  3X2X A;  2UYX A;  2BR6 A;  3IE1 A;  4UBQ A;  5LM6 A;  1BMC A;  4RAW A;  5AEB A;  2ZNB A;  2XR1 A;  5K4K A;  4Z7R A;  4C1E A;  5K0W A;  2QJS A;  5LS3 A;  3DHB A;  1JT1 A;  2M5C A;  4Z5Z A;  2FU7 A;  4GCW A;  4ZEJ A;  4EYF A;  1DDK A;  3I11 A;  2BG8 A;  1K07 A;  2FK6 A;  5B15 A;  4F6H A;  2WYL A;  1X8I A;  4Z60 A;  4FR7 A;  3FAI A;  1XTO A;  4TZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...