3ADRA

The first crystal structure of an archaeal metallo-beta-lactamase superfamily protein; st1585 from sulfolobus tokodaii
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
259
structure length
259
Chain Sequence
PCRGLHSIPAGPVEFPEIATVYVMCGEKLTVMIDAGVSNSIADFSFLDKLDYIVLTHLHIDHIGLLPELLQVYKAKVLVKSGFKKYLTSEDGLKKLNESAEKVLGDLYYVYGGLEKKLDQDKVIEVEGNEEFDLGGYRMRLIYTPGHARHHMSVLVDDFLFTGDSAGAYFNGVVIPTTPPVIDYKMYMESLKRQIELKPKVVGFAHGGLVSPKIMEEHLKQMLSKEEIQINVDIGGVAGEILRKQIEVNLRGLRESKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Putative uncharacterized protein ST1585
publication title The first crystal structure of an archaeal metallo-beta-lactamase superfamily protein; ST1585 from Sulfolobus tokodaii
pubmed doi rcsb
source organism Sulfolobus tokodaii
total genus 76
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3adrA00
2BR6A 3IE2A 1YCHA 4RAMA 2FM6A 5EWAA 4Z6XA 3JXPA 4TZFA 1P9EA 2Y8AA 5EV8A 4H0DA 4EFZA 2OHHA 5EVKA 5ACQA 4GCWA 2OHIA 2BG2A 5A0TA 4FR7A 2BTNA 3IEKA 5A5ZA 3KNSA 4TYTA 4NQ4A 4XWWA 4D1VA 2FHXB 4LE6A 5HIOA 1WW1A 5K4MA 4F6ZA 4CHLA 2FHXA 3RKJA 5A87A 3SD9A 3VQZA 3ZWFA 2M5CA 4XUKA 1M2XA 1ZKPA 2YCBA 4Z60A 3R2UA 1YCGA 5B15A 4UWPB 2I7TA 4HL2A 4UBQA 4FSBA 5ACSA 4D1WA 2AZ4A 2Q9UA 4D02A 2BMIA 4Z5YA 4GYUA 1BMCA 4UA4A 3LVZA 3QH8A 2Y8BA 3X2YA 1WRAA 4C1CA 5AHOA 1DXKA 4NQ6A 5ACRA 5AYAA 4AX0B 5K4NA 4Z7RA 4RL2A 5LMCA 3T3OA 2YNVA 5AHRA 4C1HA 2BFLA 2XR1A 4UWRB 5LS3A 5ACUA 5ACVA 4ZO2A 3AJ3A 3SRXA 4J5FA 4RM5A 3SBLA 1MQOA 4DILA 4WD6A 5AEBA 1X8IA 4EXSA 5AXRA 2ZWRA 5ACWA 2CBNA 4AWYB 1XTOA 3PY5A 1YCFA 3IELA 5FQCA 4GYQA 5B3RA 1E5DA 3I15A 4UWSB 3SPUA 2DOOA 2BC2A 2QDTA 4EYBA 3IEMA 4P62A 2BG8B 3IE1A 1L9YA 3IDZA 2ZO4A 2QJSA 2WRSA 3BC2A 4EYLA 2GMNA 2BFZB 2FU7A 2WHGA 2BG8A 3SFPA 3P2UA 2BG6A 3DH8A 4C1GA 1JT1A 4JO0A 3RPCA 5K0WA 2BFZA 5LCFA 5EW0A 3ZR9A 4AD9A 5ACPA 4PVOA 2GFJA 3S0ZA 2WYMC 4ZO3A 5HH5A 2HB9A 3FCZA 4TZBA 3TP9A 1WUPA 2P4ZA 1DDKA 4V0HA 2WYLA 3H3EA 5EV6A 3MD7A 2BGAA 1XM8A 1KO3A 3KNRA 2BG7A 2P1EA 4YSBA 5DPXA 4KEQA 3X2XA 2QEDA 3IE0A 2DKFA 2YNVB 2YNTB 3DHBA 3T3NA 5LM6A 3WXCA 3X30A 4YSLA 1JJTA 4J5HA 1A8TA 2YNTA 2ZZIA 3L6NA 5IQKA 4DIKA 3BK2A 2NYPA 5ACTA 1X8HA 3X2ZA 4EXYA 1KO2A 3ZNBA 4D1UA 4AX1B 4C09A 5HISA 2QDSA 5LSCA 2Q0JA 5EVDA 3PG4A 2FU6A 5HIPA 5EVBA 3ESHA 1A7TA 2R2DA 4PVTA 1VMEA 4TYFA 5HH6A 4AWZA 5ACXA 3AF5A 4XWTA 2YNWA 2ZNBA 1DD6A 2GFKA 5A0VA 2FU8A 4HL1A 5KIKA 3A4YA 5LLDA 5LCAA 1QH3A 4Z5ZA 1VJNA 3IOGA 4ZEJA 1KR3A 3VPEA 3I11A 2UYXA 2M5DA 4RBSA 2Q0IA 2P18A 4FEKA 2P97A 4RL0A 5FQAA 3G1PA 5EHTA 1Y44A 3ZQ4A 4TZEA 2NZFA 2H6AA 1X8GA 5FQBA 2FK6A 2BFKA 4BP0A 4TZ9A 2BIBA 5KILA 3I14A 3FAIA 5HIQA 4F6HA 3AF6A 5K4KA 4YSKA 3KL7A 3PY6A 3SW3A 2XF4A 1BC2A 2FU9A 2GKLA 4EYFA 3I0VA 5HH4A 2WYMA 2GCUA 4UAMA 2YZ3A 3DHCA 5LE1A 1QH5A 3T9MA 4KEPA 2YNUA 1K07A 4O98A 2I7VA 1JJEA 1ZNBA 3ADRA 1BVTA 4UWOB 4NQ2A 3IOFA 4B87A 5AXOA 2I7XA 4D1TA 1VGNA 1HLKA 1SMLA 2A7MA 1WUOA 2AIOA 2OHJA 3BK1A 2NZEA 4NQ5A 3F9OA 4U4LA 5EH9A 2QINA 4C1DA 2E7YA 4ZNBA 3Q6VA 4C1FA 1ZTCA 2VW8A 4HKYA 4Z67A 2NXAA 2Y87A 3DHAA 4C1EA 3RKKA 2Q42A 4EY2A 4BZ3A 5B1UA 3I13A 3BV6A 4RAWA 5LCHA
chains in the Genus database with same CATH superfamily
2BR6A 3IE2A 1YCHA 4RAMA 2FM6A 5EWAA 4Z6XA 3JXPA 4TZFA 1P9EA 2Y8AA 5EV8A 4H0DA 4EFZA 2OHHA 5EVKA 5ACQA 4GCWA 2OHIA 2BG2A 5A0TA 4FR7A 2BTNA 3IEKA 5A5ZA 3KNSA 4TYTA 4NQ4A 4XWWA 4D1VA 2FHXB 4LE6A 5HIOA 1WW1A 5K4MA 4F6ZA 4CHLA 2FHXA 3RKJA 5A87A 3SD9A 3VQZA 3ZWFA 2M5CA 4XUKA 1M2XA 1ZKPA 2YCBA 4Z60A 3R2UA 1YCGA 5B15A 4UWPB 2I7TA 4HL2A 4UBQA 4FSBA 5ACSA 5AJLA 4D1WA 2AZ4A 2Q9UA 4D02A 2BMIA 4Z5YA 4GYUA 1BMCA 4UA4A 3LVZA 3QH8A 2Y8BA 3X2YA 1WRAA 4C1CA 5AHOA 1DXKA 4NQ6A 2CG3A 5ACRA 5AYAA 4AX0B 5K4NA 4Z7RA 4RL2A 5LMCA 2CG2A 3T3OA 2YNVA 5AHRA 4C1HA 2BFLA 2XR1A 4UWRB 5LS3A 5ACUA 5AIJA 5ACVA 4ZO2A 3AJ3A 3SRXA 4J5FA 4RM5A 3SBLA 1MQOA 4DILA 4WD6A 5AEBA 1X8IA 4EXSA 5AXRA 2ZWRA 5ACWA 2CBNA 4AWYB 2CFUA 1XTOA 3PY5A 1YCFA 3IELA 5FQCA 4GYQA 5B3RA 1E5DA 3I15A 4UWSB 3SPUA 2DOOA 2BC2A 2QDTA 4EYBA 3IEMA 4P62A 2BG8B 3IE1A 1L9YA 3IDZA 2ZO4A 2QJSA 2WRSA 3BC2A 4EYLA 2GMNA 2BFZB 2FU7A 2WHGA 2BG8A 3SFPA 3P2UA 2BG6A 3DH8A 4C1GA 1JT1A 4JO0A 3RPCA 5K0WA 2BFZA 5LCFA 5EW0A 3ZR9A 5A23A 4AD9A 5ACPA 4PVOA 2GFJA 3S0ZA 2WYMC 4ZO3A 5HH5A 2HB9A 3FCZA 4TZBA 3TP9A 1WUPA 2P4ZA 1DDKA 4V0HA 2WYLA 3H3EA 5EV6A 3MD7A 2BGAA 4AXHA 1XM8A 1KO3A 3KNRA 2BG7A 2P1EA 4YSBA 5DPXA 4KEQA 3X2XA 2QEDA 3IE0A 2DKFA 2YNVB 4NURA 2YNTB 3DHBA 3T3NA 5LM6A 3WXCA 3X30A 4YSLA 1JJTA 4J5HA 1A8TA 2YNTA 2ZZIA 3L6NA 5IQKA 4DIKA 3BK2A 2CFZA 2NYPA 5ACTA 1X8HA 3X2ZA 4EXYA 1KO2A 3ZNBA 4D1UA 4AX1B 4C09A 5HISA 2QDSA 5LSCA 2Q0JA 4PDXA 5EVDA 3PG4A 2FU6A 5HIPA 5EVBA 3ESHA 1A7TA 2R2DA 4PVTA 1VMEA 4TYFA 5HH6A 4AWZA 5ACXA 3AF5A 4XWTA 2YNWA 2ZNBA 1DD6A 2GFKA 5A0VA 2FU8A 4HL1A 5KIKA 3A4YA 5LLDA 5LCAA 1QH3A 4Z5ZA 1VJNA 3IOGA 4ZEJA 1KR3A 3VPEA 3I11A 2UYXA 2M5DA 4RBSA 2Q0IA 2P18A 4FEKA 2P97A 4RL0A 5FQAA 4AV7A 3G1PA 5EHTA 1Y44A 3ZQ4A 4TZEA 2NZFA 2H6AA 1X8GA 5FQBA 2FK6A 2BFKA 4BP0A 4TZ9A 2BIBA 5KILA 3I14A 3FAIA 5HIQA 4F6HA 3AF6A 5K4KA 4YSKA 3KL7A 3PY6A 3SW3A 2XF4A 1BC2A 2FU9A 2GKLA 4EYFA 3I0VA 5HH4A 2WYMA 2GCUA 4UAMA 2YZ3A 3DHCA 5LE1A 1QH5A 3T9MA 4KEPA 2YNUA 1K07A 4O98A 2I7VA 1JJEA 1ZNBA 3ADRA 1BVTA 4UWOB 4NQ2A 3IOFA 4B87A 5AXOA 2I7XA 4D1TA 1VGNA 1HLKA 1SMLA 2A7MA 2YHEA 1WUOA 2AIOA 2OHJA 3BK1A 2NZEA 4NQ5A 3F9OA 4U4LA 5EH9A 2QINA 4C1DA 2E7YA 4ZNBA 3Q6VA 4C1FA 1ZTCA 2VW8A 4HKYA 4Z67A 2NXAA 2Y87A 3DHAA 4C1EA 3RKKA 2Q42A 4EY2A 4BZ3A 5B1UA 3I13A 3BV6A 4RAWA 5LCHA
chains in the Genus database with same CATH topology
2BR6A 3IE2A 1YCHA 4RAMA 2FM6A 5EWAA 4Z6XA 3JXPA 4TZFA 1P9EA 2Y8AA 5EV8A 4H0DA 4EFZA 2OHHA 5EVKA 5ACQA 4GCWA 2OHIA 2BG2A 5A0TA 4FR7A 2BTNA 3IEKA 5A5ZA 3KNSA 4TYTA 4NQ4A 4XWWA 4D1VA 2FHXB 4LE6A 5HIOA 1WW1A 5K4MA 4F6ZA 4CHLA 2FHXA 3RKJA 5A87A 3SD9A 3VQZA 3ZWFA 2M5CA 4XUKA 1M2XA 1ZKPA 2YCBA 4Z60A 3R2UA 1YCGA 5B15A 4UWPB 2I7TA 4HL2A 4UBQA 4FSBA 5ACSA 4D1WA 2AZ4A 2Q9UA 4D02A 2BMIA 4Z5YA 4GYUA 1BMCA 4UA4A 3LVZA 3QH8A 2Y8BA 3X2YA 1WRAA 4C1CA 5AHOA 1DXKA 4NQ6A 5ACRA 5AYAA 4AX0B 5K4NA 4Z7RA 4RL2A 5LMCA 3T3OA 2YNVA 5AHRA 4C1HA 2BFLA 2XR1A 4UWRB 5LS3A 5ACUA 5ACVA 4ZO2A 3AJ3A 3SRXA 4J5FA 4RM5A 3SBLA 1MQOA 4DILA 4WD6A 5AEBA 1X8IA 4EXSA 5AXRA 2ZWRA 5ACWA 2CBNA 4AWYB 1XTOA 3PY5A 1YCFA 3IELA 5FQCA 4GYQA 5B3RA 1E5DA 3I15A 4UWSB 3SPUA 2DOOA 2BC2A 2QDTA 4EYBA 3IEMA 4P62A 2BG8B 3IE1A 1L9YA 3IDZA 2ZO4A 2QJSA 2WRSA 3BC2A 4EYLA 2GMNA 2BFZB 2FU7A 2WHGA 2BG8A 3SFPA 3P2UA 2BG6A 3DH8A 4C1GA 1JT1A 4JO0A 3RPCA 5K0WA 2BFZA 5LCFA 5EW0A 3ZR9A 4AD9A 5ACPA 4PVOA 2GFJA 3S0ZA 2WYMC 4ZO3A 5HH5A 2HB9A 3FCZA 4TZBA 3TP9A 1WUPA 2P4ZA 1DDKA 4V0HA 2WYLA 3H3EA 5EV6A 3MD7A 2BGAA 1XM8A 1KO3A 3KNRA 2BG7A 2P1EA 4YSBA 5DPXA 4KEQA 3X2XA 2QEDA 3IE0A 2DKFA 2YNVB 2YNTB 3DHBA 3T3NA 5LM6A 3WXCA 3X30A 4YSLA 1JJTA 4J5HA 1A8TA 2YNTA 2ZZIA 3L6NA 5IQKA 4DIKA 3BK2A 2NYPA 5ACTA 1X8HA 3X2ZA 4EXYA 1KO2A 3ZNBA 4D1UA 4AX1B 4C09A 5HISA 2QDSA 5LSCA 2Q0JA 5EVDA 3PG4A 2FU6A 5HIPA 5EVBA 3ESHA 1A7TA 2R2DA 4PVTA 1VMEA 4TYFA 5HH6A 4AWZA 5ACXA 3AF5A 4XWTA 2YNWA 2ZNBA 1DD6A 2GFKA 5A0VA 2FU8A 4HL1A 5KIKA 3A4YA 5LLDA 5LCAA 1QH3A 4Z5ZA 1VJNA 3IOGA 4ZEJA 1KR3A 3VPEA 3I11A 2UYXA 2M5DA 4RBSA 2Q0IA 2P18A 4FEKA 2P97A 4RL0A 5FQAA 3G1PA 5EHTA 1Y44A 3ZQ4A 4TZEA 2NZFA 2H6AA 1X8GA 5FQBA 2FK6A 2BFKA 4BP0A 4TZ9A 2BIBA 5KILA 3I14A 3FAIA 5HIQA 4F6HA 3AF6A 5K4KA 4YSKA 3KL7A 3PY6A 3SW3A 2XF4A 1BC2A 2FU9A 2GKLA 4EYFA 3I0VA 5HH4A 2WYMA 2GCUA 4UAMA 2YZ3A 3DHCA 5LE1A 1QH5A 3T9MA 4KEPA 2YNUA 1K07A 4O98A 2I7VA 1JJEA 1ZNBA 3ADRA 1BVTA 4UWOB 4NQ2A 3IOFA 4B87A 5AXOA 2I7XA 4D1TA 1VGNA 1HLKA 1SMLA 2A7MA 1WUOA 2AIOA 2OHJA 3BK1A 2NZEA 4NQ5A 3F9OA 4U4LA 5EH9A 2QINA 4C1DA 2E7YA 4ZNBA 3Q6VA 4C1FA 1ZTCA 2VW8A 4HKYA 4Z67A 2NXAA 2Y87A 3DHAA 4C1EA 3RKKA 2Q42A 4EY2A 4BZ3A 5B1UA 3I13A 3BV6A 4RAWA 5LCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BR6 A;  3IE2 A;  1YCH A;  4RAM A;  2FM6 A;  5EWA A;  4Z6X A;  3JXP A;  4TZF A;  1P9E A;  2Y8A A;  5EV8 A;  4H0D A;  4EFZ A;  2OHH A;  5EVK A;  5ACQ A;  4GCW A;  2OHI A;  2BG2 A;  5A0T A;  4FR7 A;  2BTN A;  3IEK A;  5A5Z A;  3KNS A;  4TYT A;  4NQ4 A;  4XWW A;  4D1V A;  2FHX B;  4LE6 A;  5HIO A;  1WW1 A;  5K4M A;  4F6Z A;  4CHL A;  2FHX A;  3RKJ A;  5A87 A;  3SD9 A;  3VQZ A;  3ZWF A;  2M5C A;  4XUK A;  1M2X A;  1ZKP A;  2YCB A;  4Z60 A;  3R2U A;  1YCG A;  5B15 A;  4UWP B;  2I7T A;  4HL2 A;  4UBQ A;  4FSB A;  5ACS A;  4D1W A;  2AZ4 A;  2Q9U A;  4D02 A;  2BMI A;  4Z5Y A;  4GYU A;  1BMC A;  4UA4 A;  3LVZ A;  3QH8 A;  2Y8B A;  3X2Y A;  1WRA A;  4C1C A;  5AHO A;  1DXK A;  4NQ6 A;  5ACR A;  5AYA A;  4AX0 B;  5K4N A;  4Z7R A;  4RL2 A;  5LMC A;  3T3O A;  2YNV A;  5AHR A;  4C1H A;  2BFL A;  2XR1 A;  4UWR B;  5LS3 A;  5ACU A;  5ACV A;  4ZO2 A;  3AJ3 A;  3SRX A;  4J5F A;  4RM5 A;  3SBL A;  1MQO A;  4DIL A;  4WD6 A;  5AEB A;  1X8I A;  4EXS A;  5AXR A;  2ZWR A;  5ACW A;  2CBN A;  4AWY B;  1XTO A;  3PY5 A;  1YCF A;  3IEL A;  5FQC A;  4GYQ A;  5B3R A;  1E5D A;  3I15 A;  4UWS B;  3SPU A;  2DOO A;  2BC2 A;  2QDT A;  4EYB A;  3IEM A;  4P62 A;  2BG8 B;  3IE1 A;  1L9Y A;  3IDZ A;  2ZO4 A;  2QJS A;  2WRS A;  3BC2 A;  4EYL A;  2GMN A;  2BFZ B;  2FU7 A;  2WHG A;  2BG8 A;  3SFP A;  3P2U A;  2BG6 A;  3DH8 A;  4C1G A;  1JT1 A;  4JO0 A;  3RPC A;  5K0W A;  2BFZ A;  5LCF A;  5EW0 A;  3ZR9 A;  4AD9 A;  5ACP A;  4PVO A;  2GFJ A;  3S0Z A;  2WYM C;  4ZO3 A;  5HH5 A;  2HB9 A;  3FCZ A;  4TZB A;  3TP9 A;  1WUP A;  2P4Z A;  1DDK A;  4V0H A;  2WYL A;  3H3E A;  5EV6 A;  3MD7 A;  2BGA A;  1XM8 A;  1KO3 A;  3KNR A;  2BG7 A;  2P1E A;  4YSB A;  5DPX A;  4KEQ A;  3X2X A;  2QED A;  3IE0 A;  2DKF A;  2YNV B;  2YNT B;  3DHB A;  3T3N A;  5LM6 A;  3WXC A;  3X30 A;  4YSL A;  1JJT A;  4J5H A;  1A8T A;  2YNT A;  2ZZI A;  3L6N A;  5IQK A;  4DIK A;  3BK2 A;  2NYP A;  5ACT A;  1X8H A;  3X2Z A;  4EXY A;  1KO2 A;  3ZNB A;  4D1U A;  4AX1 B;  4C09 A;  5HIS A;  2QDS A;  5LSC A;  2Q0J A;  5EVD A;  3PG4 A;  2FU6 A;  5HIP A;  5EVB A;  3ESH A;  1A7T A;  2R2D A;  4PVT A;  1VME A;  4TYF A;  5HH6 A;  4AWZ A;  5ACX A;  3AF5 A;  4XWT A;  2YNW A;  2ZNB A;  1DD6 A;  2GFK A;  5A0V A;  2FU8 A;  4HL1 A;  5KIK A;  3A4Y A;  5LLD A;  5LCA A;  1QH3 A;  4Z5Z A;  1VJN A;  3IOG A;  4ZEJ A;  1KR3 A;  3VPE A;  3I11 A;  2UYX A;  2M5D A;  4RBS A;  2Q0I A;  2P18 A;  4FEK A;  2P97 A;  4RL0 A;  5FQA A;  3G1P A;  5EHT A;  1Y44 A;  3ZQ4 A;  4TZE A;  2NZF A;  2H6A A;  1X8G A;  5FQB A;  2FK6 A;  2BFK A;  4BP0 A;  4TZ9 A;  2BIB A;  5KIL A;  3I14 A;  3FAI A;  5HIQ A;  4F6H A;  3AF6 A;  5K4K A;  4YSK A;  3KL7 A;  3PY6 A;  3SW3 A;  2XF4 A;  1BC2 A;  2FU9 A;  2GKL A;  4EYF A;  3I0V A;  5HH4 A;  2WYM A;  2GCU A;  4UAM A;  2YZ3 A;  3DHC A;  5LE1 A;  1QH5 A;  3T9M A;  4KEP A;  2YNU A;  1K07 A;  4O98 A;  2I7V A;  1JJE A;  1ZNB A;  3ADR A;  1BVT A;  4UWO B;  4NQ2 A;  3IOF A;  4B87 A;  5AXO A;  2I7X A;  4D1T A;  1VGN A;  1HLK A;  1SML A;  2A7M A;  1WUO A;  2AIO A;  2OHJ A;  3BK1 A;  2NZE A;  4NQ5 A;  3F9O A;  4U4L A;  5EH9 A;  2QIN A;  4C1D A;  2E7Y A;  4ZNB A;  3Q6V A;  4C1F A;  1ZTC A;  2VW8 A;  4HKY A;  4Z67 A;  2NXA A;  2Y87 A;  3DHA A;  4C1E A;  3RKK A;  2Q42 A;  4EY2 A;  4BZ3 A;  5B1U A;  3I13 A;  3BV6 A;  4RAW A;  5LCH A; 
#chains in the Genus database with same CATH topology
 2BR6 A;  3IE2 A;  1YCH A;  4RAM A;  2FM6 A;  5EWA A;  4Z6X A;  3JXP A;  4TZF A;  1P9E A;  2Y8A A;  5EV8 A;  4H0D A;  4EFZ A;  2OHH A;  5EVK A;  5ACQ A;  4GCW A;  2OHI A;  2BG2 A;  5A0T A;  4FR7 A;  2BTN A;  3IEK A;  5A5Z A;  3KNS A;  4TYT A;  4NQ4 A;  4XWW A;  4D1V A;  2FHX B;  4LE6 A;  5HIO A;  1WW1 A;  5K4M A;  4F6Z A;  4CHL A;  2FHX A;  3RKJ A;  5A87 A;  3SD9 A;  3VQZ A;  3ZWF A;  2M5C A;  4XUK A;  1M2X A;  1ZKP A;  2YCB A;  4Z60 A;  3R2U A;  1YCG A;  5B15 A;  4UWP B;  2I7T A;  4HL2 A;  4UBQ A;  4FSB A;  5ACS A;  5AJL A;  4D1W A;  2AZ4 A;  2Q9U A;  4D02 A;  2BMI A;  4Z5Y A;  4GYU A;  1BMC A;  4UA4 A;  3LVZ A;  3QH8 A;  2Y8B A;  3X2Y A;  1WRA A;  4C1C A;  5AHO A;  1DXK A;  4NQ6 A;  2CG3 A;  5ACR A;  5AYA A;  4AX0 B;  5K4N A;  4Z7R A;  4RL2 A;  5LMC A;  2CG2 A;  3T3O A;  2YNV A;  5AHR A;  4C1H A;  2BFL A;  2XR1 A;  4UWR B;  5LS3 A;  5ACU A;  5AIJ A;  5ACV A;  4ZO2 A;  3AJ3 A;  3SRX A;  4J5F A;  4RM5 A;  3SBL A;  1MQO A;  4DIL A;  4WD6 A;  5AEB A;  1X8I A;  4EXS A;  5AXR A;  2ZWR A;  5ACW A;  2CBN A;  4AWY B;  2CFU A;  1XTO A;  3PY5 A;  1YCF A;  3IEL A;  5FQC A;  4GYQ A;  5B3R A;  1E5D A;  3I15 A;  4UWS B;  3SPU A;  2DOO A;  2BC2 A;  2QDT A;  4EYB A;  3IEM A;  4P62 A;  2BG8 B;  3IE1 A;  1L9Y A;  3IDZ A;  2ZO4 A;  2QJS A;  2WRS A;  3BC2 A;  4EYL A;  2GMN A;  2BFZ B;  2FU7 A;  2WHG A;  2BG8 A;  3SFP A;  3P2U A;  2BG6 A;  3DH8 A;  4C1G A;  1JT1 A;  4JO0 A;  3RPC A;  5K0W A;  2BFZ A;  5LCF A;  5EW0 A;  3ZR9 A;  5A23 A;  4AD9 A;  5ACP A;  4PVO A;  2GFJ A;  3S0Z A;  2WYM C;  4ZO3 A;  5HH5 A;  2HB9 A;  3FCZ A;  4TZB A;  3TP9 A;  1WUP A;  2P4Z A;  1DDK A;  4V0H A;  2WYL A;  3H3E A;  5EV6 A;  3MD7 A;  2BGA A;  4AXH A;  1XM8 A;  1KO3 A;  3KNR A;  2BG7 A;  2P1E A;  4YSB A;  5DPX A;  4KEQ A;  3X2X A;  2QED A;  3IE0 A;  2DKF A;  2YNV B;  4NUR A;  2YNT B;  3DHB A;  3T3N A;  5LM6 A;  3WXC A;  3X30 A;  4YSL A;  1JJT A;  4J5H A;  1A8T A;  2YNT A;  2ZZI A;  3L6N A;  5IQK A;  4DIK A;  3BK2 A;  2CFZ A;  2NYP A;  5ACT A;  1X8H A;  3X2Z A;  4EXY A;  1KO2 A;  3ZNB A;  4D1U A;  4AX1 B;  4C09 A;  5HIS A;  2QDS A;  5LSC A;  2Q0J A;  4PDX A;  5EVD A;  3PG4 A;  2FU6 A;  5HIP A;  5EVB A;  3ESH A;  1A7T A;  2R2D A;  4PVT A;  1VME A;  4TYF A;  5HH6 A;  4AWZ A;  5ACX A;  3AF5 A;  4XWT A;  2YNW A;  2ZNB A;  1DD6 A;  2GFK A;  5A0V A;  2FU8 A;  4HL1 A;  5KIK A;  3A4Y A;  5LLD A;  5LCA A;  1QH3 A;  4Z5Z A;  1VJN A;  3IOG A;  4ZEJ A;  1KR3 A;  3VPE A;  3I11 A;  2UYX A;  2M5D A;  4RBS A;  2Q0I A;  2P18 A;  4FEK A;  2P97 A;  4RL0 A;  5FQA A;  4AV7 A;  3G1P A;  5EHT A;  1Y44 A;  3ZQ4 A;  4TZE A;  2NZF A;  2H6A A;  1X8G A;  5FQB A;  2FK6 A;  2BFK A;  4BP0 A;  4TZ9 A;  2BIB A;  5KIL A;  3I14 A;  3FAI A;  5HIQ A;  4F6H A;  3AF6 A;  5K4K A;  4YSK A;  3KL7 A;  3PY6 A;  3SW3 A;  2XF4 A;  1BC2 A;  2FU9 A;  2GKL A;  4EYF A;  3I0V A;  5HH4 A;  2WYM A;  2GCU A;  4UAM A;  2YZ3 A;  3DHC A;  5LE1 A;  1QH5 A;  3T9M A;  4KEP A;  2YNU A;  1K07 A;  4O98 A;  2I7V A;  1JJE A;  1ZNB A;  3ADR A;  1BVT A;  4UWO B;  4NQ2 A;  3IOF A;  4B87 A;  5AXO A;  2I7X A;  4D1T A;  1VGN A;  1HLK A;  1SML A;  2A7M A;  2YHE A;  1WUO A;  2AIO A;  2OHJ A;  3BK1 A;  2NZE A;  4NQ5 A;  3F9O A;  4U4L A;  5EH9 A;  2QIN A;  4C1D A;  2E7Y A;  4ZNB A;  3Q6V A;  4C1F A;  1ZTC A;  2VW8 A;  4HKY A;  4Z67 A;  2NXA A;  2Y87 A;  3DHA A;  4C1E A;  3RKK A;  2Q42 A;  4EY2 A;  4BZ3 A;  5B1U A;  3I13 A;  3BV6 A;  4RAW A;  5LCH A; 
#chains in the Genus database with same CATH homology
 2BR6 A;  3IE2 A;  1YCH A;  4RAM A;  2FM6 A;  5EWA A;  4Z6X A;  3JXP A;  4TZF A;  1P9E A;  2Y8A A;  5EV8 A;  4H0D A;  4EFZ A;  2OHH A;  5EVK A;  5ACQ A;  4GCW A;  2OHI A;  2BG2 A;  5A0T A;  4FR7 A;  2BTN A;  3IEK A;  5A5Z A;  3KNS A;  4TYT A;  4NQ4 A;  4XWW A;  4D1V A;  2FHX B;  4LE6 A;  5HIO A;  1WW1 A;  5K4M A;  4F6Z A;  4CHL A;  2FHX A;  3RKJ A;  5A87 A;  3SD9 A;  3VQZ A;  3ZWF A;  2M5C A;  4XUK A;  1M2X A;  1ZKP A;  2YCB A;  4Z60 A;  3R2U A;  1YCG A;  5B15 A;  4UWP B;  2I7T A;  4HL2 A;  4UBQ A;  4FSB A;  5ACS A;  4D1W A;  2AZ4 A;  2Q9U A;  4D02 A;  2BMI A;  4Z5Y A;  4GYU A;  1BMC A;  4UA4 A;  3LVZ A;  3QH8 A;  2Y8B A;  3X2Y A;  1WRA A;  4C1C A;  5AHO A;  1DXK A;  4NQ6 A;  5ACR A;  5AYA A;  4AX0 B;  5K4N A;  4Z7R A;  4RL2 A;  5LMC A;  3T3O A;  2YNV A;  5AHR A;  4C1H A;  2BFL A;  2XR1 A;  4UWR B;  5LS3 A;  5ACU A;  5ACV A;  4ZO2 A;  3AJ3 A;  3SRX A;  4J5F A;  4RM5 A;  3SBL A;  1MQO A;  4DIL A;  4WD6 A;  5AEB A;  1X8I A;  4EXS A;  5AXR A;  2ZWR A;  5ACW A;  2CBN A;  4AWY B;  1XTO A;  3PY5 A;  1YCF A;  3IEL A;  5FQC A;  4GYQ A;  5B3R A;  1E5D A;  3I15 A;  4UWS B;  3SPU A;  2DOO A;  2BC2 A;  2QDT A;  4EYB A;  3IEM A;  4P62 A;  2BG8 B;  3IE1 A;  1L9Y A;  3IDZ A;  2ZO4 A;  2QJS A;  2WRS A;  3BC2 A;  4EYL A;  2GMN A;  2BFZ B;  2FU7 A;  2WHG A;  2BG8 A;  3SFP A;  3P2U A;  2BG6 A;  3DH8 A;  4C1G A;  1JT1 A;  4JO0 A;  3RPC A;  5K0W A;  2BFZ A;  5LCF A;  5EW0 A;  3ZR9 A;  4AD9 A;  5ACP A;  4PVO A;  2GFJ A;  3S0Z A;  2WYM C;  4ZO3 A;  5HH5 A;  2HB9 A;  3FCZ A;  4TZB A;  3TP9 A;  1WUP A;  2P4Z A;  1DDK A;  4V0H A;  2WYL A;  3H3E A;  5EV6 A;  3MD7 A;  2BGA A;  1XM8 A;  1KO3 A;  3KNR A;  2BG7 A;  2P1E A;  4YSB A;  5DPX A;  4KEQ A;  3X2X A;  2QED A;  3IE0 A;  2DKF A;  2YNV B;  2YNT B;  3DHB A;  3T3N A;  5LM6 A;  3WXC A;  3X30 A;  4YSL A;  1JJT A;  4J5H A;  1A8T A;  2YNT A;  2ZZI A;  3L6N A;  5IQK A;  4DIK A;  3BK2 A;  2NYP A;  5ACT A;  1X8H A;  3X2Z A;  4EXY A;  1KO2 A;  3ZNB A;  4D1U A;  4AX1 B;  4C09 A;  5HIS A;  2QDS A;  5LSC A;  2Q0J A;  5EVD A;  3PG4 A;  2FU6 A;  5HIP A;  5EVB A;  3ESH A;  1A7T A;  2R2D A;  4PVT A;  1VME A;  4TYF A;  5HH6 A;  4AWZ A;  5ACX A;  3AF5 A;  4XWT A;  2YNW A;  2ZNB A;  1DD6 A;  2GFK A;  5A0V A;  2FU8 A;  4HL1 A;  5KIK A;  3A4Y A;  5LLD A;  5LCA A;  1QH3 A;  4Z5Z A;  1VJN A;  3IOG A;  4ZEJ A;  1KR3 A;  3VPE A;  3I11 A;  2UYX A;  2M5D A;  4RBS A;  2Q0I A;  2P18 A;  4FEK A;  2P97 A;  4RL0 A;  5FQA A;  3G1P A;  5EHT A;  1Y44 A;  3ZQ4 A;  4TZE A;  2NZF A;  2H6A A;  1X8G A;  5FQB A;  2FK6 A;  2BFK A;  4BP0 A;  4TZ9 A;  2BIB A;  5KIL A;  3I14 A;  3FAI A;  5HIQ A;  4F6H A;  3AF6 A;  5K4K A;  4YSK A;  3KL7 A;  3PY6 A;  3SW3 A;  2XF4 A;  1BC2 A;  2FU9 A;  2GKL A;  4EYF A;  3I0V A;  5HH4 A;  2WYM A;  2GCU A;  4UAM A;  2YZ3 A;  3DHC A;  5LE1 A;  1QH5 A;  3T9M A;  4KEP A;  2YNU A;  1K07 A;  4O98 A;  2I7V A;  1JJE A;  1ZNB A;  3ADR A;  1BVT A;  4UWO B;  4NQ2 A;  3IOF A;  4B87 A;  5AXO A;  2I7X A;  4D1T A;  1VGN A;  1HLK A;  1SML A;  2A7M A;  1WUO A;  2AIO A;  2OHJ A;  3BK1 A;  2NZE A;  4NQ5 A;  3F9O A;  4U4L A;  5EH9 A;  2QIN A;  4C1D A;  2E7Y A;  4ZNB A;  3Q6V A;  4C1F A;  1ZTC A;  2VW8 A;  4HKY A;  4Z67 A;  2NXA A;  2Y87 A;  3DHA A;  4C1E A;  3RKK A;  2Q42 A;  4EY2 A;  4BZ3 A;  5B1U A;  3I13 A;  3BV6 A;  4RAW A;  5LCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...