2Q9UA

Crystal structure of the flavodiiron protein from giardia intestinalis
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
409
structure length
409
Chain Sequence
KPKYVQDQEMIPGVYWVGIVDWMVRIFHGYHTDEGSSYNSYFIDDECPTVIDSVKYPFAEEWLSRIAACCPLDKIKYVVMNHAEGDHASSLKDHYHKFTNATFVCTKKCQEHLKILYGMEKATWLIVDDKYTLKIGKRTLKFIPVPLLHWPDSTFTYCPEDKILFSNDGFGQHYATSRRWADECDVSHVMHLFKEYTANILGLFSAQMRKALEVASTVEIKYILSAHGVSWRGDAMGLAIAEYDRWSKGQHCQKKVTVVLDSMYGTTHRMALALLDGARSTGCETVLLEMTSSDITKVALHTYDSGAVAFASPTLNNTMMPSVAAALNYVRGLTLIKGKPAFAFGAFGWSNRAVPDIVAELRDGCKADVYDEKGITFKFNYTEELLEQAYNAGVDLGKRAIAYCEKNAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords A-type flavoprotein
publication title The O2-scavenging flavodiiron protein in the human parasite Giardia intestinalis
pubmed doi rcsb
source organism Giardia intestinalis
molecule tags Oxidoreductase
total genus 157
structure length 409
sequence length 409
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2q9uA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2q9uA01
4UBQA 4FGKA 2YNVA 5EAIA 2M5CA 4U7FA 2FAXA 2MWMA 4EYBA 3JSXA 2FM6A 2X2OA 5B3KA 1CZRA 2Q0IA 5DPXA 2YNTA 2Z9DA 5EVBA 4QOHA 1FLVA 3N39C 1T0IA 1QH5A 1JA0A 4NLLA 2NZFA 2A7MA 4BP0A 1MQOA 5ACTA 1P9EA 1K07A 5AXRA 4Z67A 5LM6A 2GMNA 3RPCA 1RTTA 2E7YA 4UA4A 3D7NA 3ESXA 3G5MA 2WHGA 3VPEA 3KEGA 1J9GA 5EV8A 4ZEJA 4Z5ZA 2M5DA 2H6AA 5EW0A 4ZO3A 3RKKA 1WUPA 4PTZA 3I11A 3S0ZA 2BC2A 4Z6XA 4Z7RA 2P4ZA 3VQZA 2FU9A 2AIOA 4RM5A 4DY4A 4WD6A 1RLIA 2X2PA 3W77A 4EFZA 4ZVLA 3SD9A 3OJWA 2BFZA 4C0XA 4KEQA 3PY5A 3ZHOA 4XDHA 4GYQA 2AMJA 1C7EA 4UWSB 2FVXA 4GI5A 4H6PA 5B3LA 2ZZIA 3KL7A 2WYLA 4CF6A 3IOGA 5LLDA 3DHBA 4NQ2A 1FX1A 3FJOA 1M2XA 3EDOA 4ZVMA 1BC2A 2GKLA 2P18A 3LVZA 5K0WA 4KEPA 2HNBA 2MT9A 4NULA 5EH9A 2QX6A 3O73A 3HLYA 2RG1A 5EMNA 2KLBA 4AWZA 4C14A 1FLNA 5HH5A 3FAIA 3GFQA 1WSBA 1XYYA 3K1YA 2BG6A 2BG2A 2QX9A 1ZWKA 4N9QA 1E5DA 2DKFA 4HL1A 2QR2A 4J5FA 2VW8A 2QMYA 3LCMA 4F6HA 4LE6A 5ACVA 1AKTA 5AYAA 3K20A 4ICIA 3GFRA 2Q0JA 3ZWFA 4U7HA 3ESZA 5EHTA 1F4PA 2XOEA 4Z60A 4ZNBA 3SRXA 5A0VA 3NHYA 2FLVA 4OXXA 1DXKA 3U7RA 2FHXA 1AKUA 4UAMA 1AHNA 3G1PA 4ZVKA 4FGJA 4FEKA 4J5HA 3X2ZA 5ACXA 1CZLA 4N65A 3H3EA 1JT1A 3L9XA 2CBNA 3UXHA 1XI2A 1XM8A 3FCZA 4D1VA 2UYXA 1SG0A 4D1UA 1WUOA 4BZ3A 5HH4A 4PVTA 5ACWA 2QJSA 2FZ5A 5K4MA 2FU6A 1NNI1 1FVXA 2HB9A 1QRDA 1ZWLA 2GSWA 4XUKA 2FX2A 4LTDA 4GQIA 4EXSA 3F90A 2M6SA 1VMEA 5HH6A 2YNUA 3U7IA 3NHKA 5LBTA 3N3AC 1TLLA 2HNAA 1XTOA 3IELA 3OX3A 1DXQA 5BUCA 2BR6A 3FW1A 1X77A 2NYPA 4P62A 5JROA 5ACSA 3KNSA 1FUEA 3AF6A 4Y9UA 3PY6A 1KBOA 2FOXA 5F4BA 3SPUA 4AX0B 1AKRA 4JO0A 3X2XA 1BU5A 3OX1A 4GYUA 1Y44A 3MD7A 3TP9A 3B6KA 1VGNA 3P0RA 2FU8A 1BVTA 1QR2A 3QFCA 5IQKA 5LJIA 1OBOA 3NHUA 2M6RA 1D04A 1AKWA 3ZQ4A 3ES9A 4BMPB 3R2UA 5K4KA 2QEDA 4XWWA 3BC2A 3DH8A 2KQUA 4ZO2A 2Y8AA 5EWAA 2FK6A 4NQ6A 4YALA 3F6RA 5KIKA 2BZSA 4EYLA 5B1UA 4D1WA 1HLKA 2NXAA 4YAUA 1KO3A 4EXYA 2I7VA 4HKYA 3NHFA 4TYTA 4B87A 1WW1A 3NHWA 4QOEA 2BFLA 1X8IA 2Q62A 2Q9UA 5EA2A 5LCAA 5FA6A 5HIQA 4GCWA 5AHRA 5HIOA 3I0VA 1QHEA 3ZR9A 4C0WA 2BG8B 1DXOA 1CZOA 3DHAA 3IE0A 5FQBA 3F2VA 5ACPA 4RAWA 3O2NA 1D4AA 4YSBA 4EY2A 3ADRA 5AHOA 2Z9CA 1B1CA 3LT5A 4FGLA 5LS3A 2BGAA 3B6JA 4DIKA 1D03A 1CZKA 1ZKPA 3GAMA 3AF5A 2XF4A 5AEBA 2V5UA 4YAFA 2I7TA 1FLDA 5A4KA 4EYFA 4AD9A 1DDKA 1AKVA 3AJ3A 4QOFA 2WYMA 3SW3A 2B3DA 3B6IA 3IEKA 2ZO4A 3QFRA 2OHJA 4F8YA 2Y87A 3KNRA 4AX1B 2QWXA 3FNIA 3X30A 1QBGA 4Y9RA 1J9EA 3NHJA 2V5VA 2GFJA 2WRSA 4XDGA 4PU0A 3FVWA 2P97A 2Y8BA 4FSBA 1OFVA 4C1GA 1ZX1A 3KAQA 1GG5A 3L9WA 4ZVNA 4RAMA 2A5LA 5ACQA 4LTMA 5NLLA 4O98A 1RLJA 3HR4A 3W78A 5K4NA 4RBSA 4HEQA 3W79A 1VJNA 4TZFA 2XR1A 4U4LA 1XT6A 3NLLA 3R6WA 4R81A 2YCBA 3ESYA 4TZ9A 3N3BC 4YSLA 4UWPB 4QODA 1KO2A 3OWHA 1X8HA 1J9ZA 4GR9A 4PTYA 5TGZA 1A8TA 3PG4A 1L9YA 2FZVA 1J8QA 1I1OA 3SBLA 2R2DA 1TIKA 2QMZA 4FR7A 2YNVB 5ACUA 1T5BA 3ESHA 5LSCA 3OX2A 2BMVA 1H69A 3T3OA 4H2DA 2QX8A 3F9OA 5FQAA 4M0CA 3B6MA 4LTNA 2YNTB 3TZBA 1XYVA 1KBQA 3IEMA 3I15A 4CHLA 3HA2A 3BV6A 5F12A 3NHLA 1YCGA 1YOBA 5F51A 2Z98A 5LJLA 1SQSA 1JA1A 1AG9A 1YCFA 4YAOA 1QH3A 5B15A 1RCFA 3OJXA 2D5IA 3QE2A 3OVMA 1YCHA 1BMCA 4C09A 2Q42A 2FDXA 3TE7A 2QX4A 3FX2A 5FX2A 3ZNBA 2WYMC 5EV6A 4C1DA 4YQEA 4C1HA 4HS4A 3NHPA 3EYWA 3RKJA 3JXPA 3NFRA 2BFKA 1YKGA 2ZWRA 3IDZA 4D1TA 1CZHA 1AKQA 4ESEA 2N1MA 1OBVA 5FUQA 2OYSA 5LVAA 2BFZB 4QOJA 2FU7A 2YZ3A 4UWOB 2BIBA 3I14A 4UWRB 2F1OA 4N82A 4NQ5A 4C1CA 3BK1A 2FCRA 4YSKA 4YAWA 2BMIA 2HPVA 2OHHA 5NULA 5KILA 1WRAA 3DHCA 1JJTA 4PVOA 3X2YA 1X8GA 4BMOB 5B3RA 2ARKA 5A87A 1ZNBA 3IE1A 2YNWA 1DD6A 2ZNBA 1JJEA 4LAFA 1AZLA 3BK2A 4XWTA 3W7AA 2QDSA 3WXCA 4QOIA 5HISA 1H66A 2NZEA 2BG8A 4QOGA 1KR3A 2BTNA 1A7TA 4U7GA 4F6ZA 4RL0A 2DOOA 5FQCA 1DX9A 3SFPA 4C1FA 2GCUA 1V4BA 3Q6VA 4NQ4A 3IE2A 5LE1A 4TZBA 4FX2A 3TEMA 2FHXB 2QINA 1C7FA 2R96A 4HL2A 1CZUA 5LCHA 4S24A 2P1EA 2I7XA 3A4YA 2BF4A 3KAPA 2QDTA 3NHSA 2Z9BA 4Y7CA 3S2YA 1FLAA 4TZEA 2ZKIA 3GFSA 4Z5YA 1FTGA 3UXEA 3IOFA 2MOKA 2V9CA 4V0HA 2OHIA 3F6SA 4DILA 3SVLA 3QH8A 5LCFA 2BN4A 1WSWA 5LMCA 3L6NA 1YRHA 4TYFA 1SMLA 5ACRA 3T9MA 1BVYF 4C1EA 4J8PA 2GFKA 1CZNA 4C76A 3NHRA 3I13A 4AWYB 3RPEA 1ZTCA 5A5ZA 1AMOA 5HIPA 3OWXA 3T3NA 2MTBA 3KLBA 5AXOA 1YDGA 4LA4A 2BG7A 2BPOA 2XODA 4H0DA 2R97A 5LBUA 2AZ4A 5EVDA 4D02A 5A0TA 6NULA 5EVKA 2WC1A 3P2UA 4RL2A 5ULLA 2W5UA 4CETA
chains in the Genus database with same CATH superfamily
1C8VB 1CJCA 3FDFA 4QWWA 3I30X 3N0TA 5JS1A 1JJBA 5LB4A 4DPLA 1N9KA 2CYCA 3HR8A 1MC8A 1L7EA 3KAJA 1M2VB 2EZ9A 2ZEJA 2JFGA 1D0SA 1NOKA 5B3JC 3C24A 2OENG 3OJOA 3OOEA 2N3ZA 2ZUCA 2RGYA 3CNLA 5ILQA 1KEZA 1YBFA 3TLEA 2J0QA 1HF3A 1MG0A 2ZBEA 4IIDA 2C4MA 2Q3EA 2AHOA 4TUYF 3L49A 3ZS9A 3G8AA 4D3SA 2XA9A 1PWEA 4NLLA 1RQRA 5D7BA 1X9HA 3NC4A 1QYCA 2YVUA 2G4VA 4GOND 2VR1A 5AK4A 5TQ0B 3VH3A 3QFSA 4ZAYA 1J33A 4DRXB 3N8NA 5H0IA 4L8VA 2AI2A 2DBZA 1AHPA 1L1EA 2WJWA 3BM5A 3RLFA 3EFOA 4NCNA 4B3SB 1Z7YA 1PU2A 3KU4A 3IALA 4IIHA 5BQXA 1NF8A 5EEGA 2C0CA 3BVPA 3PDWA 1L4EA 4IIFA 5GIPE 1AQNA 1FU8A 1PT7A 4PSUA 1H6DA 2H6AA 4KNYA 1B0AA 2F4NA 1D1PA 1JX6A 1H93A 3CH6A 3DEIA 3EVDA 3K8QA 1B4DA 4RKQA 5AW3A 1PSDA 1WL8A 2PMBA 5EJAA 5J2TB 5JANA 3CZ4A 4Z7RA 4YUXA 3SWWA 1SBZA 3GT4A 3PD7A 2XZOA 3CJQA 4YRLA 1GTZA 4PSAA 3O47A 2JW5A 4MUEA 1MOSA 3AF4A 3E3MA 3WNVA 4FINA 3KXPA 5IAOA 3ROPA 3LT0A 1G0OA 4XI9A 3HJRA 3GJ8A 5D1NA 3AUYA 5JRZA 2C1EA 4AN1A 1KY2A 1QJ4A 1C7EA 1OLOA 1ZMBA 2RGAA 4LSWA 1AT1A 2CB9A 4PZDA 5ELMA 3RJZA 4BY9E 2WYLA 3IOGA 4TXLA 2FUEA 4F11A 3PDHA 3G2LA 1QKKA 4ZK6A 4BNWA 3O38A 1XRPA 3HGQA 1NQXA 1XE3A 4I9HA 3K0HA 2Y93A 4KSBA 1FFAA 4RY9A 2OM6A 1WPXA 2HNBA 1P5JA 1WXHA 2ZITA 4N0DA 1XZQA 3LZCA 1E99A 2Q8QA 1LPNA 4KUHA 4Z0TA 3HJAA 2Y0PA 3BJRA 5BSRA 5TRTA 2WUEA 2QU8A 4YUVA 3L1VA 1YRBA 2F90A 2PXAA 5LQUA 3LWBA 2JLRA 3QVOA 4M1KA 2A3NA 3K1YA 1F48A 1EAMA 4HAXA 4NYJR 3BFJA 5AVJA 1NUHA 4F96A 2XBMA 2NVBA 2UAGA 3L7AA 4FC7A 4IO0A 4OJYA 5B1DA 2GEUA 3RF7A 4QLOA 1Z88A 3URMA 2WZQA 1XAGA 3KJEA 4V0RA 3C6ZA 4EX7A 4J5FA 1NDHA 1U0RA 4HH3C 4BU0A 1FUUA 3T1HB 1G9TA 5ACVA 4R7TA 1IXKA 1KR5A 1VL1A 4BNIA 2HQ1A 1ZI9A 3H2KA 4KVAA 3B1FA 5IW8A 4Z4HA 2AEMA 3KKMA 3U62A 2Q0JA 4DB2A 4I2VA 1YQWA 1V9CA 2PD6A 2H1FA 1CEXA 4PNPA 4ZVQA 1V2GA 3T54A 3I2IA 2IXEA 1G55A 4YFVA 3MZ0A 4CKWB 2VAWA 4RLHA 2O1WA 3BH7A 2C3PA 5C53B 3AETA 2HSGA 4W1PA 5HF6A 4ZODA 1Y89A 3BT7A 3IQFA 2DZDA 2X0NA 4G2TA 4YONB 5AYVA 1T6XA 4RHCA 3AHCA 1ORRA 4M98A 1QUEA 4FEKA 3IURA 4G01B 1B2LA 1NW7A 4UARA 2H16A 3N8IA 1L5HB 1K7FB 2I2DA 3TINA 1PD0A 4LWPA 2YW9A 3FYDA 4PZCA 2ZB2A 5BV1A 1BRMA 2L17A 3R5JA 1Y81A 2F3UA 3HUFA 1IOVA 4X7PA 3ZJVA 3W0LB 2EBFX 4CCYA 4EECA 2X9VA 2P0YA 4FYWA 4J0HA 5FTMA 4KLZA 1W29A 3E7FA 5JAQA 3QEBZ 1E2PA 3B78A 4X8MA 1RT9A 4IJQA 4JBLA 3TOVA 5C9ZA 3QVGB 3C3JA 5EWLA 4JA2A 5BN3B 1JIXA 1PNOA 2PKQO 4FIZA 3U9TA 3UHPA 1KFEB 1T2UA 1DIRA 1Y6FA 1XMOB 4WZBB 5THQA 4IDEA 3NO4A 1OFUA 4KX3A 2GAOA 1YRAA 2GBGA 2O5VA 2HBYA 2WE7A 3ECCA 4GQIA 2OUIA 4JS0A 2ANCA 4LTDA 1N2IA 4S1NA 4BZQA 3DBLA 4K9KA 1XRNA 1UBHS 4O59O 5HMMA 1NI5A 2VQDA 4JEIA 1LB1B 3PUHA 2C5EA 1RRKA 2WIKA 3N74A 5EEHA 3LU1A 4LVCA 4HZUB 1KZYC 1SKBA 1T2DA 3D5QA 4RSGA 3TMKA 4B33A 1T9KA 1YS6A 4UOEA 3FYUA 4BNUA 3S8YA 4HFMA 4ROTA 3SEFA 2Q3CA 4WINA 1KI6B 1WQ1R 3ZHRA 3IELA 3NKFA 1U11A 1ES9A 3PA8A 1EKXA 2P4HX 2OP1A 4BZXA 2B37A 1X77A 3P9NA 2RGGA 4RHEA 5JTUA 1VMAA 2OHXA 3ASZA 2JAHA 3OIFA 4R3WA 1QH9A 4AZ0B 1CE8B 5CW2A 3K71B 3ZGXA 2Z6UA 3HU1A 4BE9A 5C18A 4OBWA 4LY9A 3ZNPA 4YMGA 4JO0A 3EXEB 3OF5A 3V8MA 5GVSA 5CIYA 4GLBA 1PEAA 2JB9A 2R1VA 3F0TA 3KEQA 4X66B 1UQRA 1WAMA 1R4MA 2YHAA 2YZMA 2XNSA 2IOFA 3RVLA 2OLKA 4Y67A 5D3MA 3EG5A 1KSGA 3G02A 2GHRA 4URFA 5CB4B 4FGZA 1UPAA 3LCRA 4HPJB 2ZUFA 5DNWA 1NT2A 3KSMA 4LE0A 2W4IA 1E20A 1EAYA 3G59A 4KNVA 4CU2A 5DYWA 2B4TO 1ZXXA 2BRUC 1XWWA 2WBLC 4BNGA 4UEKA 1ABFA 1VJRA 1AKEA 1O5OA 1S0UA 4HBZA 4RPLA 2PPVA 1QGDA 3TKLA 5E0OA 2FWBA 2CLEB 2WJVA 1W35A 3RIEA 2BZSA 4UBKA 7MHTA 3P97A 5ELXA 1JEOA 1KTVA 3VHXB 2NXJA 3W6ZA 3I5YA 2E4VA 4NARA 4CI9A 1LK7A 1YGPA 4JUBA 4FGUA 3TTUA 2EFEB 1OLSA 3ONWA 1GFZA 2O6LA 2WT8A 3MJTA 4FKZA 3GP3A 4WOBA 5CG1A 1US8B 1QDLB 2JD0A 2YHIB 3IOYA 1SUWA 4QG7A 5BWCA 1WW1A 1RWBA 2XUAA 4EELA 5ENDA 4HNSA 3THYA 4RV9A 3ASYA 1I6LA 4FJ0A 4HI0E 1PR3A 2J6BA 3V7WA 5FA6A 4B4WA 2EEPA 4YRTA 3MGBA 3I0VA 3SKYA 3HXQA 4G36A 3KXDA 2V7BA 1SD1A 3O8CA 2C7GA 4YJ3F 1O5TA 1PQUA 2WU8A 4FUTA 1TYEB 3U6KA 1YC5A 2FFJA 4N5DA 1CUVA 1EHYA 2O2HA 2EAUA 1F6WA 2J30A 2Z9CA 3IEPA 4BGEA 4F97A 2VHUA 4FM9A 3W9UA 5BMVB 2D4HA 3IUMA 1KK2A 2JZCA 3CZCA 3LA8A 2JFZA 2QAGA 3LF2A 1ZKPA 5G0UA 2FPPB 1DDOA 1QM5A 2ZAYA 5IVDA 3TRIA 2BC9A 1FFEA 1NR5A 2V54A 5M34A 3A6JA 5D6OA 5KYWA 5DM0A 1FQWA 3RI3A 3KQHA 5DULA 4MPRA 3GQBB 2XVXA 4EYFA 3TGPA 2WIJA 3UJDA 2HK8A 4ZI3A 2HD4A 3B8EA 3K0KA 3MYRA 2O2JA 4QD3A 5J5VA 2WJJA 5KQLA 4GICA 2KI5A 5DSTA 3SBXA 5A7GA 3F7TA 5LLTA 1EYZA 5CT8A 5JCJD 1QIKA 1G3QA 1TU4A 1HTBA 3T4UA 3AW9A 3F8TA 1T25A 3FFXA 1MEOA 1STOA 4NQZA 1E7MA 4PU0A 4WHMA 3BGWA 3KSDO 4YV0A 2ONKA 4ZWNA 4AKGA 1P7VA 2XTNA 5C7YA 4F9GA 4JT4A 4LI0A 4KQ9A 5EWJA 4ZVNA 3HYSA 4RVCA 1UZUA 5ACQA 4Q4HB 3F98A 4OQXA 5KDOA 4I55F 1BX3A 2GRUA 4QAQA 4O98A 1VJ0A 1IWOA 4N76A 2OFPA 1XZIA 1M1NB 2PKRA 3OIDA 1X1SA 3IAHA 4H4DA 5G1PA 4CG1A 3PC6A 5C1PA 3ZPXA 3DE4X 2JFQA 3FCSB 2IPMA 3ND6A 3W79A 3WIOA 3EXIA 1EIZA 1UFQA 2FRDA 3UA4A 2QOEA 3EE6A 3PKIA 4AU1A 3KD3A 4N7JA 1JMYA 2C4KA 4G24A 3KO8A 5JHGB 4DR5B 2OHOA 2OP0A 1JLRA 2W6ZA 4DIFA 5J2UA 1DAPA 4QGSA 1QFSA 3O8NA 4I7EA 1BWRA 3OO0A 3UK0A 2Z2KA 2AFHE 3E23A 4GLJA 4RHFA 4FXPA 5EOVA 3GJ0A 4EY4A 4YREA 3THOA 2PUVA 1XJCA 3HRHA 2CD7A 3B38A 1IY2A 1TGVA 4QAJA 3JZFA 5REQA 3DWIA 3HUDA 5TPZA 1L8QA 1Q0ZA 4G5OA 2JS7A 2EW1A 2ZANA 1HL7A 5HTOA 3EVFA 4REQA 5FQAA 3OPVA 4X45A 1YVRA 1EXNA 3HBFA 2OK7A 1DMSA 2X4DA 3EVTA 3B7PA 1HETA 1NAIA 1DV2A 2VK8A 2CLMB 2X7HA 3CUEF 4U39A 5DM4A 1EFKA 2D5LA 2PSEA 3TE6A 4KW7A 1EE1A 1C4KA 3KOUA 1EWTA 3H1BA 5HIAA 1WETA 1J97A 1Z74A 2F3PA 1DV1A 2YXNA 3H17A 4FR5A 1ORDA 4UBIA 5AXAA 1YOBA 1ZQ1A 2CLFB 1U9IC 4C1EA 3E7XA 1JZQA 3KLOA 4IOKA 3WRXC 2QAGC 1ZK0A 1YCFA 2PTHA 5FOXA 4IOLA 3V4PB 1GSOA 2H1SA 2QD1A 1G63A 1RCFA 2HGSA 2Q0HA 3EHEA 4YAJA 3V4OA 2LTAA 3D02A 3EQ7A 3H5VA 3PUYA 1BMCA 2QUIA 1Y34E 1Z4PX 3ELYA 1ISIA 2ZTSA 3DZGA 1L8LA 2NP7A 1HDXA 1YO6A 3HO1A 1JLKA 1NI3A 2GAAA 3RSHA 3N6VA 2P75A 5TJ9A 4Q4AA 1Y98A 1XKQA 3MCAA 2NXWA 2WB2A 1RQNA 4WMLA 3V1NA 3RTAA 4E2FA 4RJTA 5FUQA 2VUUA 1OVGA 1NN3A 1U2PA 5LD2C 3PUWA 4FOOA 4P4GA 1ZUD1 5TSDA 2HMWA 4DV0B 5DHFA 1H8HA 2GPJA 4YJGB 2EFHB 4S35A 2ACWA 2FCRA 4P0QB 3I9V6 4MX8A 4NU6A 2AC4A 2VP9A 2UU9B 1ELOA 2XD9A 4PHFA 4D99A 4LVNA 2WJHA 2PNJA 5JNTA 3C8HA 1CJUC 1YSCA 2P9JA 4FTWA 5K20A 2Q9AA 2BY4A 3C87A 1V4VA 3BTSA 4ZU3A 3OMLA 4EIWA 5HZMA 1N2BA 1FTSA 3RYHA 3UWDA 2P2YA 2OD9A 2BCJQ 4FKMA 1PTKA 1YJAA 4KI0A 1XVIA 2FRDC 2AMYA 3IEVA 2QX7A 4OI1A 4IHJA 3IIMA 2Q0XA 1ZK2A 4O2BB 5K7SA 1PK9A 2VCEA 3H0KA 4HRXA 3BSWA 4BNTA 5KKCA 5A4IS 1ICIA 1LBQA 2O0HA 4JDPA 4NRDA 1V41E 1XDBA 2LUOA 2NVUA 2XAAA 3K2BA 5BNIA 4D6XA 4GZ6A 5J9FA 1Q7CA 3UWSA 3BMOA 5AK6A 1QRTA 4I9NA 2OMEA 1XQYA 3QHAA 4UM5A 5DO9A 1SCAA 4E12A 5C4GB 2VXBA 1ZM4A 4G23A 1SVKA 2XRMA 1YHZA 4LVUA 4RL0A 1WB6A 3NIGB 4XR4A 3HJTA 1YQXA 1BWQA 3TKAA 3ELDA 3WHLA 3A27A 1ZJ4A 5DCWA 5FI1B 2A2ZA 2HCFA 3IYLW 1GDHA 3MBOA 2ZWPA 1NI4B 4RFSB 4LYEA 1C4OA 2Q6OA 5AOBA 5A4DA 1YQEA 2BGNA 2GDZA 1PGOA 5EZYA 3L82B 5EKSA 5IYZF 1FS6A 2GM5A 5AWFC 4GMXA 2GZ1A 2WWFA 1U1GA 2JJ2D 3PVSA 4UBNA 3I83A 1WBDA 2GJ9A 4O2AF 2OORA 1BFKA 1SAYA 3ZXXA 5GOTA 1TEXA 3QU2A 2VAXA 3RJ9A 4DJDC 4UULA 4TVSA 1BXRA 4XTRA 2LRHA 3MMXA 3AM1A 2MOKA 2V9CA 2ZJ1A 2HDHA 2SICE 1KORA 5BWLA 2L19A 3D3JA 5AI6A 5DWVA 1QP4A 4JT9A 3IKJA 1ZRSA 4ZICA 1YRHA 2QD5A 3DUFA 5CU7A 3C70A 3IVCA 5HDBB 5ITZB 4LEIA 3TCXB 4CV2A 4JUCA 1A8UA 4C4ZA 3T9MA 1XHEA 2CLDX 1YFLA 1LZKA 1QTRA 4HEJA 1XLVA 3EEYA 3IDSA 1VXOA 1ZJZA 2IOYA 3JPYA 2N75A 1L4LA 4OHKA 4I5GA 4OHUA 1IUOA 4RZQA 1YDHA 1DJQA 4WGGA 3WNDA 1DC6A 2O2YA 3VSAA 4D9KA 3UN1A 1EX9A 1U7WA 3C14C 5IVPA 1ECBA 2OK8A 3THRA 4EGCB 5EHZA 2CVFA 3JR3A 3CR8A 1A9PA 2OC9A 2VDJA 2E21A 3EQ9A 4IDQA 4YP1A 1N36B 4K9NA 2QXTA 3ILSA 3M4ZA 4OFZA 4ZAVA 4J49A 1TAHA 1MOZA 3EVGA 4BBAA 4M0LA 4PC7A 4C5BA 3ET4A 2CWDA 2PJDA 2PXHA 2YWFA 1RM0A 3AESB 3D7RA 3IQZA 3KOZA 4JU8A 4MVJG 3ZWVA 2VP4A 4FHDA 1E9SA 3GA7A 2P68A 4WKGA 2XRZA 4UBQA 5F3RA 3R0JA 1K06A 1RD4A 1V7QA 2VF8A 1JU3A 2G0NA 2CKMA 2P9HA 2Y8EA 3EYAA 4Q21A 1DJLA 1TLTA 3N86A 5HG0A 2OCGA 5BVGB 5FPTA 2FGJA 3LKBA 4GOJA 4C0AC 4FE4A 3INRA 3EGCA 3PKZA 4YJKA 3PDIA 1P0CA 1V1RA 1NSTA 1NJ2A 2ID8A 3GPDG 4KYUA 4I3HA 3IQGX 1OFGA 1GLVA 5EJ4A 2WD7A 2YIJA 3BICA 3JQRA 2WNHA 3QXJA 4E08A 2DPMA 4K9MA 3T9EA 3BIXA 1IMOA 4Q1VA 1O6CA 3UF0A 4LOHA 4ZVTA 2XJ9A 5L95A 3MCZA 4FEGA 4QXRA 3UJHA 5JARA 2AK2A 2BF7A 3K0FB 4IGAA 4U7PB 3T1NA 3WO0A 4B31A 1AU9A 3X0DA 1F2VA 4A0QA 4W82A 1Z7WA 2ZRFA 1JHVA 1KP9A 1WP4A 4OAQA 3GHHA 4XARA 4ARSA 4DBZA 4Z51A 2HDNB 2NM0A 3I9KA 1XZCA 4LYGA 4MKIA 4QHYA 1QLHA 4Y0NA 2C3YA 1H2EA 1YZFA 4B82A 1GTSA 1O08A 3AONB 3EXHB 3U1BA 4FFBB 5LA6F 3AVXA 1ZOIA 3D0KA 4L74A 1NVWQ 4OKSA 3NPMA 1SWWA 2FU9A 4B4OA 1VIMA 1KSHA 4LJ7A 2X2PA 4Q9LA 1Q0UA 1YZNA 2FW8A 1R5BA 2AJCA 1MABB 1QGOA 4H0FA 4KR0A 2LP4Y 4UEJA 3DEHA 5CA1B 4L78A 4RA9A 4LV5B 4DNFA 5ERYA 1E5VA 1L5WA 1RTKA 1VPEA 1XV5A 3M6LA 1P2FA 4C5CA 1HNNA 1NJSA 1T4CA 2XUKA 5BO5A 1DCTA 3P4UA 5LP1A 3LPCA 3Q7RA 4JL8A 4PX3A 3PXEA 2WKWA 3TDMA 1TQ4A 4NJEA 2ZETA 3DEZA 4ZI7F 1HE4A 1BC2A 3PG5A 1U5AA 4C04A 1IUNA 1JSXA 2E87A 5HIOA 4Q19A 1KZ7B 3FZGA 1GQRA 1RPZA 1NR1A 2FETA 4FDUA 3D7MA 2YV4A 3MGCA 3LYUA 4L6IA 3M7IA 3HU3A 3ROQA 4EYOA 4KREA 5CK4A 3SLRA 4MYSA 4Q5IA 3KQMA 1D7OA 2D1YA 3O7WA 1SOAA 4PSDA 2R4QA 3I9OA 4C3UA 1E1QA 4F92B 2FMIA 3M6IA 3TNLA 4FDLA 4EPVA 4UDNA 3ICOA 3S2SA 1GY8A 5IBPA 2BUBA 1ZOOA 1VSBA 2VT7A 1C5KA 1N8TA 3V1KA 1CR1A 5I7UA 3DL4A 1LU9A 2REBA 2PSSA 2IPXA 3OLCX 5DCLA 4DV2B 5B6JA 5AOCA 4BQOA 3INYA 1WXWA 2Q41A 4L9AA 4UTOA 3BD6A 4QQ8A 2NYAA 5EXEA 4RTJA 5AVVA 1A8PA 1X14A 1U8FO 2JF0A 3WZ2A 4LRSB 3D6NB 1QRUA 4HH0A 4QQKA 3RUFA 3MT8A 1GDTA 2GD1O 3U7JA 3AR9A 2A0WA 1X1TA 1JL3A 4L8GA 1KZ9A 2HQSA 2C4VA 5FNVF 4DUYB 1MX5A 5ESWA 2C03A 3AOEC 1T36A 1S2OA 1ECLA 4JOQA 5HUQA 1CUSA 1GVNB 4HEA6 4MH0R 1MJNA 3EBLA 3ZIUA 2P35A 1CUBA 1U8CB 2NU7A 4JP8A 4ND1A 1JLLA 1MQSA 3RSOA 4E2XA 1GCAA 2RCYA 2YXLA 3RAGA 1LBSA 3G2OA 3CGGA 3DMGA 1B6TA 5DGIA 3A4TA 1XXHE 2W2KA 2D3TA 3H87A 3WY9A 3QBVA 4MGKR 3ZD9A 3ABRB 1OIXA 3BZBA 3RREA 4ERXA 3B6ZA 3PHBE 1W7AA 4ENPA 1A3CA 5FUYA 3GD7A 2BFDB 3JAKB 4BFYA 3GRZA 2IS4A 1RI3A 1P0FA 2FZLA 2I55A 4QYWA 4L9WA 4V3CA 1QTQA 1MC1A 2AKEA 4B80A 3QBTA 4GVLA 1NC3A 1K2VN 4IF4A 2YINC 2XNCA 1XF9A 4FWIB 3RVDA 2DPHA 5KJEA 1QHHA 1UMKA 2HNAA 3PQ2A 4ZQGA 3FTNA 3W5AA 2D5CA 1JTVA 3GFBA 3R9XB 2IU3A 4GXNA 5THXA 4PW0A 2Q8PA 3DVQX 5CCDA 5KQGA 4P62A 1WR8A 3SJZA 3KNSA 3B3GA 3R5XA 3AYXB 4CLXA 1WSAA 3HN6A 4P35A 3CSDA 5AH0A 3STVA 3A1FA 1WKBA 2EJCA 3KYJB 1KBOA 1YA4A 4AQ7A 1I80A 4LGMA 1HOTA 1ND5A 1M3SA 3BAFA 5LP6A 1H65A 1K98A 2P90A 5ALFA 3ZDDA 1QONA 2I4IA 3HKBA 1M2OB 2VTEA 4FMCF 4M46A 4EJ6A 5A5EA 1OV4A 1IK6A 4OB7A 2WJYA 3G17A 4WIAA 3D81A 4YP6A 2PMWB 4CM7A 4DA8A 2H2WA 3N70A 1UT6A 3TVTA 4CF7A 1BVTA 1SXIA 4J0DA 1X8XA 4TV9B 3VU9B 3NHUA 1AV7A 3B70A 4G84A 4HAOA 4PYNA 3PEUA 4KDEA 5KNDD 4KK4A 4EI2A 1H9CA 1Z0JA 3INTA 1SHKA 3HV2A 3MQFA 5CVVA 4YT5A 5E2IA 4XWWA 1ZM2A 4FQ8A 3VI3B 1C9KA 2RGRA 5CCXA 3S2UA 1GA6A 5I7AA 2OKGA 3O3OB 1PFVA 4D9EA 2ZUWA 5DLYA 4DS3A 2YL2A 4BMNA 5IXJA 5EWAA 3RC1A 2AR0A 3CMMA 5DTQA 5H02A 1V1MA 4MUMA 2X13A 5DM70 4ZDJA 1IHPA 3KV1A 4HBGA 4MGHA 4P2GA 4D1WA 3K15A 3R5SA 1N2CA 3H86A 2MYUA 4GDMA 4DLWA 1WBJB 3MTDA 5KJCA 4D97A 4ZZ2A 5IN5A 1OY1A 1VLZA 2FMFA 2G1AA 3CLUC 3O1LA 3I2GA 4O4IA 2ZCJA 1UMCB 3G2NA 4L95C 4Q3AA 4RDXA 1KPIA 4FWBA 2QL7A 3TLZA 1GG2A 2IU4A 2VWGA 2AZXA 3SE0A 2D6FA 2Q50A 5GPBA 4BVAA 3WQSB 2WU4A 4BVJA 2P9QA 3FKSA 4FOLA 4N7MA 4RACA 3VAYA 3OTOB 1DRVA 2I1VB 4CIXA 4PQFA 3CA8A 1UBUS 5JATA 1NPTO 4QDTA 1LI7A 3MWYW 2NSLA 4R51A 1S2DA 2FFRA 1R0YA 3AHHA 2WWYA 1T6YA 2Z5FA 3CB4A 3JASB 3PR2B 4DDKA 4DCOA 2BBSA 3RUDA 5AHOA 2FNAA 3L1JA 3PCRB 4DBLE 4INJA 1SO8A 2F67A 2BCGY 1HFEL 2DFTA 2V6MA 4Q9HA 4G25A 3Q9NA 1UIMA 3SDBA 4COKA 1DC4A 2EF1A 1MRZA 2QYOA 3L8DA 3PZBA 2XKJE 2WM9B 2IH4A 4D9MA 4GVXA 2JGJA 3KT6A 4BGDA 5D3QA 1PS0A 2ZBFA 1QGAA 3W1EA 2V5UA 4UOQA 1FTYA 4O1HA 3PICA 5F35A 5FRDA 1I9GA 1U80A 1WDMA 1YR9A 2GN0A 2MSDB 3E18A 3A9VA 3PTLA 3IEXA 3HJBA 1NVKA 3FPJA 3PNQA 1Q0TA 3LDGA 3NBMA 2DMRA 5DW0A 3M70A 4R7ZA 2C5FA 3O4RA 3WGVA 4S1WA 1CK4A 1M75A 1H6CA 2H5JA 4WLOA 5BYAA 4JJFA 1I01A 1XTBA 2XHZA 3TQHA 5LP6C 3HSSA 4WXPA 1RHMA 3V3TA 3HYLA 4MV8A 3VR5H 2JGRA 5EESA 3GRKA 4BAZA 4RTKA 1XTJA 1OFVA 4JIMA 4NV1A 4X6YA 3TD9A 4FSBA 4JH0A 1C1DB 4CIYA 1NKVA 2WF5A 2H06A 4FU0A 5DGDA 5KSPA 5T4BA 1KDVA 1QP7A 3O93A 2Q7OE 1LV8A 2FHSA 3DBOB 4IIVA 4MS1A 4JQZA 3NM4A 2AMFA 2O1EA 2HRRA 3HVIA 1DG1G 4Z3KA 1JEYA 2A59A 3BULA 4KBYA 4WCFB 4CKBB 4D56A 1TTQB 3A7EA 5TT1A 4BJ6A 4RIIA 1RHUA 1W4RA 1X7HA 4EA9A 1ADFA 5A3RA 5JV5A 1KY5A 2KWIA 1EWKA 4RTOA 4TZFA 3F78A 2KMLA 2AG0A 4IBOA 1HYBA 1ZNYA 4J07A 4MDYA 4FUQA 5D51S 5H5JA 4R81A 3W2FA 3ZBTA 1U9JA 3ZIDA 2P11A 1UBTS 5A1JA 2WDPA 3L2OB 1D2EA 3IULA 2ASVA 1AMNA 1CX9B 3KJZA 1I30A 1SEVA 1Z8HA 4QVKA 1GUYA 1OWPA 4LBYA 2W42A 4WXEA 5K0ZA 4ME6A 1G3MA 3K0BA 4QYMA 2OD2A 3WLLA 2N9UA 1EHIA 1YONA 3H8VA 4GRDA 5A04A 3SBLA 4QNNA 4FR7A 5IVIA 4DPMA 3DOFA 4R3NA 3T1VA 4BASA 3ENNA 1CWUA 2ZPAA 2EQBA 3LFHA 3KYCA 3NALA 3PRJA 4NS1A 5KTNA 2DLNA 2DTXA 2DR0A 2Y0CA 4BFVA 4DG5A 3T3OA 5LSCA 3LCVB 3TOXA 4UDXX 2E4XA 1SBQA 3S0JA 2DBQA 5FAXA 1E1YA 1NUTA 2QTVB 4C7JA 4KFSA 4YT4A 7MDHA 4QVGA 4Y18A 2W93A 4A23A 1T0BA 3M9WA 1HE1C 1UJ4A 2GCIA 1SMKA 1X1RA 3KJXA 3WWEA 3ZHUA 1QE5A 3TZKA 3L6CA 1K5DA 1Z6AA 3MWEB 1N2XA 5F12A 5HF8A 2GD2A 6ADHA 1H8HD 1PRYA 2IBSA 2OGZA 1JA1A 1K7SN 3AVWA 1PJRA 3UXYA 3VV2A 3KE9A 1H85A 1PFQA 1TOAA 2Q5EA 4C07A 3ADBA 1E0DA 2XHEA 1EUZA 1X7WB 4ODIA 1WHSB 4GIBA 3X2SA 5LZ8A 4YCLA 1KC1A 1SRRA 1IQUA 3PE4A 9ABPA 1LFAA 4MKXA 2J41A 3ROKA 4PYRA 4ZQEA 1ZH8A 3AY6A 4OHWA 4NX2A 2IEZA 1YJ8A 4N5LA 2OBYA 2QW0X 2PX5A 4AJPA 4YRAA 5AKLA 1LY1A 5EPOA 5AW9A 4KR7A 2GZSA 3R0ZA 2VP5A 5ARDA 2E4UA 3KKQA 1CQXA 2PGOA 1KP3A 5K3FA 3DMHA 5IF9A 2BFZB 4F4DA 3M5PA 3JD4A 4CM5A 3QXXA 4G8JA 4P7BA 3MRVA 4YUYA 1Y5NA 2VSQA 3RASA 3JRNA 2Q6KA 1LTHR 1SC1A 4QJBA 4RU1A 1ZGZA 1E7SA 4C08A 4EEXA 2YMPA 1DOHA 4TLCA 5KCMA 4KO2S 1ZEJA 2ENUA 1JEDA 1CNEA 1HYGA 4IDNA 4RVOA 3ZCRA 1V7ZA 1ZR4A 3C3AA 1NY5A 3CLSC 3PQ8A 5IDVA 3QOYA 5COQA 3VKVA 1JJTA 1JR2A 1USGA 4EHIA 1WUIS 1EXVA 1DPFA 4LQCA 2XQJA 4U63A 3W6UA 2HPHA 3VR4H 2C29D 1M8PA 1YZLA 5KOIA 2BP7A 2W43A 3QEOA 4OP2A 1TU0A 3DOOA 1APBA 2G71A 2QAJA 4TMZA 3R8CA 1IZ7A 5FPHA 4EL5A 2QTWB 2AJBA 4LFBB 3WYEA 2RMKA 1FVOA 5J4HA 4GXRA 1OI7A 2JLVA 2N47A 1T8PA 1OI3A 4K0KB 1QP8A 1RXEA 2VBCA 1NKSA 3UG6A 2HSZA 7ADHA 3OPYB 5LPNA 4ZEXA 5JI2E 3TGWA 4WQMA 3MHTA 4HDRA 3HCAA 4ZIRB 3NRJA 4J7UA 1Z45A 2I1WA 1RWOA 3UXMA 4URYR 3VNSA 1DFHA 1RKQA 1OXSC 3MJHA 1FP4B 1S8NA 2P9BA 3AERB 4L50A 1KDZA 4F6ZA 1AB5A 2BMJA 5KTPA 2NU6B 3VZSA 2XNDA 2PPLA 4AD8A 4QJ3A 1E4YA 2ESRA 2R8RA 1BOOA 4XX0A 2DWOA 4YJ2B 3W9YA 4BQFA 1NXPA 3DMNA 3WQQA 1E6UA 1NZFA 2QM7A 3BGVA 1FCJA 4GEKA 3S40A 4NQ2A 4M0PA 1NRJB 1ZD1A 5F78A 1JEAA 3HO8A 4E5KA 5BNZA 1HQYE 2I91A 1Y63A 4PXAA 1O3YA 3H65A 1ONSA 3W4KA 3KSBC 1I8TA 3LFUA 1RAEA 1X7YA 2IE0A 1XWIA 1FJXA 2GNOA 4Q93A 2ZU0C 4GYWA 4DMRA 4ER7A 3OQBA 3B3AA 5JJLA 1CUAA 4ZYXA 4ZJYA 4EYGA 5DDIP 2B82A 3O3NB 2OHIA 4MKRA 1ZM3A 3ZXUB 5JUWA 2V7UA 1DAGA 1HSZA 4HTFA 1W96A 5LMCA 1W59A 2H9AA 4LMRA 4W1QA 2APJA 1UM9A 1REQB 3FDZB 1M10A 1J0AA 4ZA2A 2A0FA 1CERA 4I3FA 1KY3A 3W2HA 3K6RA 5IC5A 1WF3A 2IA5A 2FZCA 3QYPA 3F6EX 2PUCA 1N34B 1M1YA 5H7XA 4KITB 2AQKA 1E62A 2NYUA 2VDVE 1U2ZA 4H7IA 2H7YA 3QW2A 4GXTA 4UHBA 1Q16A 1JT9A 2ORYA 3KHTA 5EKTA 3R4VA 1DS6A 4J4BA 2OV6A 5H3HA 3VC2A 2PXXA 5CH5A 1EB8A 2WHQA 2ZOSA 4TTQA 4FMDF 3RSSA 2AZ4A 3DZBA 2I4TA 3BRCA 4HWGA 5T4HA 3R40A 4DNOA 5EVKA 3TQTA 1MX9A 1TYZA 1UP7A 2YASA 3PD0A 1OWOA 2R8PA 3R4CA 3IVAA 4QOFA 4PYJA 1P4RA 5IC6A 1K07A 1BVRA 2DUWA 3EARA 5JO9A 1NU6A 3SZMA 4FCWA 4GDFA 3NJRA 2GA8A 2NADA 2PL5A 3KAKA 5IWCA 4Q4JB 5ALKA 4UNNA 1H23A 1ODKA 4UM7A 3V1LA 4CIAA 3QEKA 1TM1E 1CF9A 2BM1A 5I3CA 4MSUA 4AYTA 4DBVO 4BEJA 2QR5A 1BXKA 4OAOA 3U1TA 5AVOA 9LDBA 4RPGA 4LWZA 4NMXB 5GAJA 4Z4IA 2P3OA 1KJWA 3OQIA 4OQQA 4OREX 4XCVA 4B2PA 3N39C 3WBJA 2VH2A 3KUKA 1V96A 4YPFA 1I2ZA 1BFDA 1K8ZB 2JHAA 3CW8X 3TSYA 4BAGA 1EVZA 3EQ6A 5B12A 4CKEB 1IVYA 1UJ6A 3E9QA 3I3OA 4J9UE 3MT7A 3THSA 1W8IA 4DLUA 3BQ9A 3FCUB 2C8LA 2TMKA 4YBRA 4ZHQB 2ATVA 2FK7A 1EGHA 3F5QA 5MHTA 4OA8A 2HYIC 5CYFA 2M5DA 5ITVA 2V7XA 4D8XA 4MPJA 3RRZA 1QVRA 1V0JA 2Q7XA 3PFCA 1LVGA 4B2YA 4M9XA 1GITA 1TVEA 4GWLA 4JHLA 1C0LA 3PGA1 1ID8A 4XJVA 3RIHA 2O7SA 4P92A 1GARA 3TXYA 2FXIA 2E55A 3I5UA 2YFKA 4C5AA 1GNTA 1OLXB 3O8OA 3R0IA 4P4SA 4EEKA 5JJCA 1GCGA 1OXBB 6REQB 1E92A 4KUGA 4ZQBA 1C8LA 4LKOA 4DWOA 3RTGA 1W93A 4HLUC 2A0KA 1F6BA 3S99A 1WSDA 4LXHA 3GUZA 3JYNA 1VMDA 4XASA 2JGFA 4DA4A 5EGSA 1VI6A 3BJMA 3EDOA 4GBED 2A92A 2ERYA 2VK1A 1EVYA 2GJAA 2W6JA 2H5EA 4XOUA 4YJDA 1D1SA 1VHWA 1SZCA 1W88A 3NC1C 2QX6A 1GT91 1D1TA 1RBQA 1D2AA 4JMPA 2QL9A 4R7GA 4F8EA 2H2AA 3HZHA 4WBNB 4GSKA 5IRCD 1XMQB 1XLTA 1AJEA 4XX1A 4FEYA 1KAQA 5KYXA 1IL0A 3S29A 2VQEB 4ZTBA 1YBHA 5KTSA 3EQZA 1SXJA 2EHDA 2GWHA 2JVJA 5A9RA 2BG2A 1T5OA 1E8NA 3N2YA 2H3HA 1KEEB 4AJLA 2PKQP 1XFDA 4RS3A 1W46A 4NEHB 3A10A 4IVRA 1IBLB 3KQQA 2EZUA 2QMYA 3CLUD 3P0FA 1DWPA 1DRJA 1PJAA 3I58A 5G41A 4F5WA 3HHEA 3FZNA 1GNRA 1JG1A 1AKTA 1BKYA 2VC2B 2WUGA 3OCXA 3OOYA 5JD6A 1T4DA 3PWSA 1D2MA 5ARCA 1EGVB 3BJZA 5DYIA 2GM4A 4B3FX 1ZLYA 1I1HA 2C31A 2ODTX 2Q3FA 2QVXX 2C2BA 3LVRE 4N9WA 1GILA 1A2OA 5B1IA 4RWEA 4CG0A 3HO6A 1L5KA 2IX3A 4KXYA 2BLLA 2QDKA 3OQMA 3C7KA 3CT4A 5ACXA 4LYDA 1KH3A 1OBCA 3C1OA 3I45A 2C2OA 4H35A 4RCVA 4S1VA 3QLEA 4TZ0A 2Q5HA 2OXFA 1JAHA 1ZUIA 3BKWA 3MS2A 5H68A 1TVKA 1YTUA 1YR1A 2D0IA 4G5GA 1FX0A 3EXG1 1ZCZA 4ITVA 2VUTA 1RRMA 1YB7A 1I0LA 1JHXA 4NG5A 3S8MA 3A6PC 1NYQA 3HKCA 2B0JA 4HUQA 4UREA 1DTEA 4Q3CA 4YT2A 1N75A 1Y4DE 4ALMA 1OX5A 4FNOA 3FLBA 4RSHA 4M53A 1SUIA 1JYFA 1MD9A 2V6BA 4MVYA 3NDPA 3VOTA 1U8ZA 3BDIA 1JHAA 4N8EA 3TOZA 1H6AA 3MFQA 4Y2HA 1KETA 3TZQA 1KDYA 4EKEA 5EXXA 1IIBA 1YT5A 3E9RA 1MXHA 2HB6A 3IHKA 2HW8A 2YXBA 2C3UA 2FF7A 5FH9A 1CIJA 2WK1A 2ZGVA 5EMJA 4BO0A 2O3UA 4R5MA 3ZDXB 3KXLA 4M54A 1XXHB 4CQMD 1KDTA 3IKVA 4LHXA 3G49A 4OI4A 3SIWA 2W2LA 1EDOA 1KJZA 1TYBE 3VPBA 1Z4KA 3IAM1 5HEKA 3D1VA 1BGVA 3NXSA 1XZMA 1FMFA 1I7QB 4ZREA 2JD1A 4UU7A 3NB0A 4Q7JB 3WB9A 2H8KA 1L4BA 2WJZB 1DBQA 3I4FA 2OE2A 4D5EA 3VNUA 3RIXA 1ECJA 3MERA 4GP7A 3RG2A 3V2IA 4FHCA 2LPMA 3AV0B 5AI8A 1FUEA 2ZJ0A 5HTKA 5BUQA 4NOJA 3FTEA 1YKSA 1XLTC 2RGXA 3ADKA 3MOIA 1S3IA 2QRNA 5EUBA 1M83A 2FOXA 4YAKA 1FZQA 3DBIA 2A5DA 4NFYA 3QUQA 4BVGA 4J75A 1ULSA 2YH2A 2R6R1 3PFKA 3RFTA 1E3EA 4EA7A 4JMLA 5JH7F 3MUFA 1QGYA 3G1WA 1KQFA 1J23A 3BDVA 1GNSA 1C3LA 4R1QA 2YX1A 2C8VA 2ZSDA 4BYGA 4EB8A 4YY3B 4AYWA 4U7DA 2ADMA 3TP9A 3DVAA 1T0UA 3V97A 5CBPB 4LHZA 1HM5A 1OAOA 4MIYA 4JKIA 3KQTA 1VGNA 5G53C 2X7XA 3EIHA 4IKPA 4N01A 2Q4DA 3JYPA 5CJPA 4C6RA 1LW7A 2JFXA 3A1NA 4HR7A 3AV3A 4ITUA 3U17A 2YWDA 3EH1A 3HLKA 3RS8A 3L4JA 3R2UA 3GYBA 5GV8A 3RJTA 4E7PA 4QUGA 2YRWA 4GBJA 1E7YA 4MTLA 3QY9A 4ZO2A 1L7RA 2Q1SA 4YV2A 2RBKA 1HUQA 2SCUA 4KQHA 5AKYA 4I36A 2FU5C 4E1VA 4HN2A 4KVFA 5LZ2A 2XXAA 1TECE 2QS9A 4ZZ3A 4QSMA 3TR0A 4OAPA 3LPNA 1U2SA 3Q87B 4UCXA 1E9VA 1N1MA 3A05A 4RAQA 3IEUA 4BCDA 5I8ZA 4B46A 2D5AA 3G5LA 3HBMA 1RBZA 4DCTA 3KRTA 1XR3A 2Y1DA 3T3DA 1F7UA 3VNVA 4F4IA 1HGXA 3FAKA 3LX4A 1ULBA 4QOEA 1Q1GA 1SG9A 1KKUA 1TIPA 2XE6A 3K2EA 4FHGA 1MBZA 2FEOA 3WXBA 1NBHA 2ZXFA 1Z2OX 4UC0A 1D6MA 1YS2X 4LRUA 1FS5A 2PSJA 4MPDA 5FOVA 4EG3A 3ZR9A 1G20A 1WF6A 2BFEA 1KO1A 1X8JA 1Y9ZA 3AG5A 1FSGA 3DO6A 4UHCA 3I0MA 5K8UA 2ZJOA 1UANA 1IOWA 3IE0A 2H1IA 3URKA 3WRWA 2DOKA 1UAGA 2AC2A 2ZUDA 3O2NA 4MP8A 1ILEA 4EG6A 3TLJA 3WWPA 4AP5A 1BROA 1DINA 4CU5A 1P9NA 2XMQA 1I6WA 1MT0A 3MJEA 4D4HA 1HSOA 5SY9A 5IZCA 3RANA 1ISJA 2D2EA 3ETLA 3RH0A 1M54A 4JQSA 2I6UA 1E5TA 3P19A 3K70C 2GKGA 3HNPA 3ZI0A 2PJZA 3CLSD 4MQFA 5FWYB 3ORRA 1UDXA 3ZKWB 5HIKA 4YAFA 3Q3GE 4IHQA 1IZYA 1MNAA 2YWJA 3FTCA 3JU3A 4QTXA 3DO5A 4BP9A 4CKCA 2AXEA 3OUUA 4M8IA 1AKVA 3SAJA 1P77A 1CY1A 2IEBA 3GLSA 4M1OA 4N3GA 2UVDA 3VTAA 4EG1A 1DARA 4GP9A 4OVKA 4URXR 5JNWA 5L4LA 3H42B 4TLDA 2WM8A 4D0GA 2Y87A 3PPVA 3P5BA 4X1OA 1C80A 4RMIA 4B3IA 2VJNA 3PJDA 3O31A 1OASA 3ETEA 2P40A 4Y9RA 5B3AA 2AVNA 1WXDA 4MYDA 3UJPA 1F2UA 1FQJA 3DR3A 2VRCA 2WHYA 3E22B 4A6DA 3PPYA 1FF9A 2P97A 1J20A 3IXMA 3QBDA 3WYFA 1AZTA 2CNDA 2GTPA 4RPHA 3RBXA 1IG0A 4CDRA 1MQAA 3RC3A 4QEDA 2DQSA 2K4MA 1N5JA 3I2KA 3IBSA 3O4IA 1GZ4A 4XDZA 2OXTA 2FX3A 3ZU5A 1AUXA 5NLLA 2Q6IA 1SQGA 3ZWCA 4DMGA 4KQFA 4POOA 2PT5A 3OHMA 4KR9A 1O95A 3Q8LA 2FF5A 5LP6F 3W78A 3TLBA 3BMNB 4R8RA 4AIIA 4KHZA 2F4VB 3HBNA 1CYEA 4U2FA 1Q17A 4IDGA 2UUCB 1XKXA 4L4YA 4V0QA 2DJ5A 2BVNA 1JQJC 4PN3A 3ZVNA 3AZOA 3COVA 4O3MA 4NEQA 1JQ5A 2G8LA 4JODA 5KQRA 2GAFA 1OXXK 4PTYA 2IK8A 4C78A 4HT3B 1Y3CE 1CUIA 3JQ7B 2WUVA 4R1PA 3U16A 2PIDA 3M34A 3DXFA 3LI2A 4YASA 1DO8A 4YMIA 4HH4A 2QTZA 3TRFA 5B7NA 2QBYB 5BORA 3KXIA 3NATA 2QZ4A 2BKXA 2VBGA 3VR4A 1XBTA 3KKLA 4HB0A 4Q3LA 3CXUA 1OQAA 5TNXA 1N0HA 2GPAA 4HNTA 1AA6A 1WO8A 1LTKA 4OHVA 1RMQA 4RDHA 3JRWA 4ZC8A 1UJCA 4MHTA 3H9GA 1WUYA 5ADVA 1SHZA 3FSGD 4D4MA 4LE1A 1V26A 2XQKA 3QVKA 4PRKA 5ALLA 3D5EA 3FB1A 3L8YA 4HGZA 4PQEA 2G5CA 3IEMA 1X1DA 4I4CA 5ESXA 4GKVA 5CR9A 3AUKA 3QKUA 1EJ0A 4Z7QB 1YB2A 4O4IF 3PC4A 4ESOA 4ZYZA 2C78A 5KTYA 3RRNA 3G23A 2IYLD 3LPMA 4KAXA 5F51A 3ZTWA 1OV6A 4IIXA 4RTQA 1AGYA 2GXUA 2LE0A 3R24A 4MWDA 4IV0A 4U02A 5DNCA 2YJTD 4OM8A 4PQGA 4D8YA 3QQPA 2ASEA 4MQUA 4DDWA 3ZK8A 1WMFA 3IP5A 2JRCA 1E1RA 4FMPA 4LJKA 1ISHA 3OPNA 3FRJA 4QQRA 4X97A 1KI2A 3T06B 4Z0PA 1C3OA 1MOQA 3IQIX 3CLTC 4FEAA 4HN9A 2YV2A 5AP9A 3QVLA 5TGTA 4AZVA 2LVBA 4XUDA 1KFKB 1IFXA 1GQFA 3DMYA 1JVBA 1PJTA 4IH4A 3KDSE 2LDBA 2QA5A 3H16A 1Z15A 3NWBA 1X1EA 1J39A 2OC4A 3G0CA 2AN3A 5E3IA 3R9KA 3C8DA 1XU4A 3IOEA 3PWZA 3K6KA 1E9FA 1TTPB 2G28A 3G2QA 5B58T 3EVCA 1QAMA 1TNDA 2ZT8A 4GQBA 4H4CA 3BBLA 4IDBA 3RKRA 3VPXA 2HBRA 5AIBA 2O0JA 1I7DA 1G7TA 2NVOA 4BLWA 1Q2UA 1UF9A 3W9SA 2CXHA 1KMIY 1KJJA 3ZEIA 3IVMA 4P5DA 1E63A 4YAWA 2AN1A 2QRVB 3EVAA 2F9MA 3LS2A 1YA6A 3OWOA 4KODA 5EHQA 4OUDA 3IB6A 5CDHA 4BEVA 5KVCA 5TX7A 1O95C 1N5RA 2VTBA 1Z5GA 3BWDD 3IPYA 2NZWA 3M5CA 3HPQA 4XGNA 1PFUA 2II6A 2PH3A 5A7HA 1R6TA 4XQCA 4ZJUA 1GKYA 1VDMA 1A5TA 3CPEA 3EZFA 3HCRA 3QENA 1CUGA 1W4ZA 2I71A 1YUMA 4MINA 3GLTA 3N2KA 5I9NA 1ISRA 1RLUA 1Y3BE 1RPAA 3H4IA 3K73O 3MTIA 4NG4A 5CH8A 1FMTA 2Z3WA 2ZB7A 4RJ2A 1T5HX 4XB2A 5ADUS 2NZ8A 3N2ZB 2VO1A 2IBTA 1AZWA 2PWYA 4LSGA 3IO3A 1DKNA 2CFZA 2C2KA 4ID9A 1NVXQ 3ZJUA 3NUGA 5DZSA 1E7QA 2JGNA 2CVQA 2QUKA 3Q9SA 4MLPA 2AN4A 3UGKA 4P98A 2R6DA 4B3XA 1MR3F 1L5YA 3WK4A 3ITKA 3AYZB 2E7ZA 4YRJA 1Y33E 1WZUA 4IQ4A 3A3YA 2MINB 2QTAA 4BO1A 3NANA 1VMKA 5SZIA 1RYHA 4LF5B 4OIFA 5F1KA 2VZ8A 2DOOA 1O7JA 3P9PA 4QWMA 4IF6A 2H2IA 1Z0AA 2PQ2A 4MUHA 5CNMA 4YAEA 4OMUA 3W05A 4LF4B 3SFPA 5B4UA 2R6FA 2JAUA 2ZAOA 1RM4A 1CIVA 2FR1A 3MSXA 5A5DA 4NHOA 1BHJA 5ES4B 1O58A 3OZFA 5LE1A 3AETB 3D3WA 3IUPA 3O8LA 3TEMA 3Q7QA 3FOBA 1T8TA 1JDSA 3G0DA 2H4XA 3PE3A 1T5IA 4V0LA 1UM8A 4S12A 1NFRA 2NUPA 3SN6A 4RX1A 3UJ7A 3PXXA 2UZAA 3VM6A 1U8TA 2HJGA 2CNWA 2ZTMA 3H11B 3KL4A 1EK6A 1TA9A 3OT1A 4R5HA 1LSOA 2JK0A 2VLBA 3BF8A 4UAUA 2OA0A 4NI5A 4ECEA 2IYEA 4EPTA 4PF1A 3N8KA 1A8SA 1JR4A 3NJ4A 4OK5A 3TNJA 3UATA 4TZEA 3WGYA 2VJOA 3Q11A 4RGYA 4RPCA 3UXEA 2QQ0A 1H9AA 5B7GA 1JV2B 4V0HA 4H77A 1DO2A 1UFOA 3EAFA 5EWLB 4S2EA 5DLQC 1OH6A 3L6NA 4V0SA 1I4LD 4RF4A 1XVTA 4L1KA 2FP3A 2FW0A 3QV2A 3GAAA 1YE8A 2CDBA 4TYFA 1A5SB 2FPGA 3LBAA 2ZRQA 3ADPA 4X44A 4YQFA 1QAOA 1U1CA 3OO1A 4HQRA 2G1PA 1LRJA 4WJZA 3CURA 3DBLB 2GFKA 1MJHA 1DAFA 1EWRA 1XWFA 3JARA 4JBNA 3VPGA 1ZTCA 2XZPA 3QFFA 3EOZA 1M8KA 4GGOA 5SYNA 1RACA 4BNLA 1K5GA 2H11A 3RJ5A 1K0UA 2GARA 3BCRA 4BWGA 1AIPA 3H3JA 5MF6A 1SK9A 3ITDA 2WKPA 3FYUB 4LA4A 2C7PA 1SFRA 3IDQA 3U4AA 4DQVA 4EDFA 4KXLA 1MENA 1Z9BA 2I65A 4GAEA 3ZDFA 5EVJA 4D02A 4OJKA 3DQZA 2Y05A 3GU3A 2DFLA 4WOCA 3M1AA 1Y1SA 2Z8ZA 2J45A 3JR7A 1LSUA 3D31A 1LTQA 2BDUA 4OQNA 4Y2TA 3AB3A 3OZBA 2OHGA 5HBRA 3VNAA 2JBWA 3E82A 1BEZA 1QHFA 3EGIA 1W4BA 4R1UA 1A71A 1Q15A 2FSPA 3LDUA 4LDNA 4MV3A 1IHDA 5P8WA 4NBUA 1ZD4A 1H5UA 1UOOA 2R1VB 3FG9A 2ORWA 4MULA 4RBNA 1R4MB 3HL0A 3BG5A 3GGGA 4MVJI 4KE6A 2BI4A 5D3MB 3WOVA 1CDOA 4PLPA 2I2XB 3FI9A 4X20A 2IJGX 1RHKA 4NBSA 4CMIA 1JAZA 4DV1B 1WE2A 2IPNA 3QI2A 3ZNQA 5EIXA 3PT9A 4F6RA 4EGFA 1UBCA 1QV6A 3L92A 2CVPA 4U6QA 3EVZA 2AUTA 4ISCA 2EL9A 2LGJA 1KDPA 1SCQA 3FWKA 5DHUA 4DEVA 3N75A 1Z3CA 3I05A 5KHOC 2FSVA 3TPCA 3B2QA 5AW4A 3WIEA 2F64A 4BWYA 3SU8A 3SQNA 4Z5ZA 1PGQA 1V11A 3CNOA 3VPFA 4CV1A 2P2CA 4DXDA 1ML4A 2O54A 3S0ZA 2HU7A 2HO4A 3AXSA 3WIBA 1XL1A 1QV9A 2D5BA 3I12A 3QYFA 3AKDA 2H5LA 1OLSB 1RLIA 4WD6A 3OLZA 2X3FA 5HMLA 3MEQA 3LV8A 1E3MA 4OTZA 5E1BA 4I6JA 4PYMA 4W7SA 1YJCA 4EFKA 2XGOA 5FBLB 4WXHA 4KEQA 3KR2A 4TWZA 4YRDA 1EGMB 1OTHA 1X15A 1YR7A 3EUEA 4KLAA 3TPFA 3H9BA 1ADBA 1P6QA 2QZJA 1Q3KA 3G6WA 3LQQA 4RMNA 3SIXA 4BRWA 5JLJA 5K05A 1YRLA 1RQPA 2NO0A 3I04A 4XRRA 5GTDA 1JFFA 2AE1A 3QITA 2F8LA 2OZPA 5EP3A 1OZFA 3WB1A 2VUHB 4W5RA 1HR0B 2Y1FA 2P6UA 5DXJA 1JSZA 1TQDA 3CRQA 3VISA 421PA 2YR0A 3I2JA 4LNAA 2I1LA 2G9UA 1DT5A 1L5RA 2QAGB 4D3XA 1B16A 2BAGA 1OX6A 1XROA 2FWMX 2H65A 1UMBA 1ZG3A 2WUDA 1AZSC 1SUCA 1ZINA 3GRFA 5K45A 4LF6B 5KYWB 4C29A 1IULA 1YZQA 3OIUA 3O91A 4CKYA 4WZAE 5CFLA 1CRWG 1T2VA 1N78A 1HYEA 4X85A 1IVNA 2VW8A 1V7CA 3SXPA 2EBHX 4B76A 4FYIA 1CYDA 2BKAA 3FUCA 4GLLA 4N5NA 5DFAA 1XQ6A 5LQNA 4YCJA 4L22A 4RJKA 4AY3A 1Y1KE 1QIIA 4H18A 5IASA 2P5UA 5AM2A 3REGA 1ZVKA 4JVLA 4ENSA 5LD2B 4DQLA 3PKJA 4QIHA 2IU0A 2X0JA 1F4PA 3ZQ6A 3AH8A 3DD5A 3SRXA 3WI7A 4CTKA 3HA3A 2FLVA 1T1RA 3HZZA 3MILA 1OC2A 2KS6A 1TK9A 1H0RA 3HE3A 3N0WA 4XGKA 5EWJB 4KPFC 3V7NA 5SZJA 4DA9A 3UIEA 2YDXA 1H6BA 2CW5A 2OMKA 3FCAA 1OAKA 4G0YA 3SBEA 3SHOA 2V1UA 3OF2A 4DSTA 2EP7A 4OK3A 1J42A 1XDDA 4KRFA 4F86A 3K30A 3ZYCA 5DTJA 5EJ6A 1JMVA 1XQVA 3AC0A 2RJNA 2YFHA 1RQXA 3A70A 3HMQA 1XM8A 3K70D 3EXIB 4W5JA 5CFRA 2WKSA 4PVCA 2HWXA 4KXQA 4FE3A 2CZQA 1ZRHA 3OEWA 1ORVA 3FWZA 5H3CA 4YUWA 1AQIA 2BTQA 2HFJA 3CE9A 2HT6A 1C7RA 5J2UB 1C8BA 1P9WA 3QYAA 1LQUA 4X6LA 1M1XB 4XM0A 3VH2A 3L7BA 1OI4A 2IYFA 1HQCA 1UPCA 4W8OA 1Z4MA 1N5MA 5I7FA 3AILA 2YY5A 4YRBA 4ETIA 5ED0A 3DDCA 1OX4A 4OSOA 4RA6A 5REQB 4TWAA 4EXSA 3BWBA 4HDMA 4OJTA 3V2HA 1ETUA 4LOLA 2VVTA 4X5OA 5CX4A 3UUEA 1QRRA 4LXGA 4REQB 5TMBA 2R11A 3DOHA 2RHOA 3DP9A 3BHJA 3AFNA 1E2BA 2RHDA 1Z35A 4IDDA 1T3TA 3K8YA 1ODSA 2CUNA 4G4SO 3QWHA 1E69A 1XRSB 3BH0A 2IIVA 2Q3JA 3Q5GA 3OX3A 4EARA 4MQ6A 1G2IA 4LX0A 3WP1B 1XD9A 4YGYA 5CCEA 1EFDN 5LSAA 2PX2A 1KO8A 2E6UX 2GVDC 2ZI5A 4O4LB 5JAUA 3OY7A 4HNVA 3T7AA 1HRKA 4YH1A 3LPDA 3KB2A 3N0RA 4N3BA 5AUOB 2AC7A 4OD0A 4BFTA 1N6NA 3D6VA 3CZPA 3UBTA 1KH2A 2NZXA 3BBPA 2YS6A 3DT8A 3MCTA 4EABA 4A8JA 4EENA 3HCBA 1DBIA 2X41A 3MGGA 3LP5A 4JR0A 4G0OA 3UPDA 1FRVA 3RC7A 1Q21A 1O8BA 2NTJA 4NE9A 3O8BA 4JI1B 4UUPA 4ZJPA 2VAVA 2IF2A 5L8VA 3TNDA 2H00A 3KQKA 3VBCA 3KU1A 4QBGB 4R2LA 4JHXA 5E8JA 3U49A 4E13A 5TLSA 3CEAA 2GMWA 3GEBA 1KF0A 1FFXA 1B0ZA 2NYRA 2CZGA 5AI5A 3CUWA 1N6IA 5ALIA 1XEXA 3RHZA 4QZVA 1YB5A 1QCCA 5DNDA 9LDTA 5FWXA 2GR9A 3WICA 4AJ1A 1OU4A 1HNWB 5KIKA 1ZGHA 4PIPA 5FUXA 4TQAA 4C89A 1KI8A 2ZIXA 1ZI6A 1Q5PA 4Q0MA 2CLCX 1P44A 1U28C 3GMSA 3PI6A 1K92A 3E7PA 1LBIA 1VBMA 2Y2VA 3R3UA 4FR2A 5FI0B 4BKQA 3Q1KA 4DVGA 2FN4A 3PPIA 1KO3A 3EWSA 3O4VA 2V6IA 1ZEMA 3LQFA 3MTQA 1JJIA 4ILEA 1OHHA 5C5EA 2NLOA 3EGXA 4Z4GA 2BJHA 3CLTD 4IHJB 3VR6H 4TV8A 1U3VA 3CNEA 4P4NA 4UAGA 1N6LA 3DAPA 4W6QA 4I5EA 1PWYE 2GVZC 4EJMA 4ZI5A 5ALDA 1SB9A 2JDIA 5LDDC 1GTVA 2VKQA 1GZ3A 1UC8A 2RGBA 1J99A 2BI8A 3KBOA 2NVUB 5I4CA 2QE6A 2PVSA 3LYLA 3BMOB 1FXWA 2QDXA 2E9SA 2O0KA 5HQTA 4FXOA 2Y1OA 3PNVA 4F5EA 4JL6A 4V0MA 3D0QA 5C31A 4AQDA 2PMKA 2BGMA 3T9FA 4NYIQ 3D4NA 3F67A 4PBTA 3VQTA 5LS3A 3KSZO 4NOKA 5DNAA 1M2FA 1TYAE 1K2WA 3GVHA 2OYRA 1ZK1A 4DIKA 3KLNA 4KQ2A 3PC3A 4TMKA 1NKTA 4F2DA 3U4IA 1KFBB 1KYQA 2DUJA 2AOUA 3N59A 3H5TA 4HGNA 2ONJA 1PZFA 4WL0A 5JQGB 1O95D 5KSWB 4TZ6A 4INAA 1C1XA 3AUUA 3BSFA 1OUMA 4MS4A 2J09A 4BNDA 2VHQA 5EZYB 4UTPA 1PG0A 1DDKA 1MPTA 1L3CA 2HQOA 2CNLA 4ZVUA 5KWVA 3ZWYA 1Y3DE 2J4FA 5HFNA 4QEZA 1ZJJA 3CN7A 1Q1QA 3F1LA 1U04A 2D2VA 3GRPA 5CNKA 4CODB 1BXRB 3R9IA 1RHJA 3X1JA 2HLNA 3IB3A 3IL2A 1JZTA 2DPXA 2HHAA 4XDGA 2HI0A 4IRMA 2YFQA 3O9ZA 1SCBA 4CTMA 3HRKA 3ILYA 5KIAA 1DTWB 2B3TA 1M1YE 2VJLA 3F49S 3NGMA 4J76A 3NBKA 4US0R 3VJKA 3DUFB 3ZI4A 4P22A 3OE7D 4LTMA 2GUWA 1BQ4A 3LUGA 4LW8A 5EKDA 2YQ5A 3FVQA 3Q15C 4HN4B 4PC3A 1W581 4Q3EA 1GXSA 2RSLA 3DCNA 3WBKA 4Q7MB 1FYFA 1C3XA 1I7PA 2O48X 1RLTA 2EWVA 4ZO6A 5DBHX 2GJSA 3PGKA 4DANA 2J07A 3ZWWA 4HEQA 4AUKA 2LNDA 2PGIA 5JAMA 2OD7A 2QTLA 3R6WA 4P81A 4I1OA 2OEPA 3IR5A 1Z82A 1J7KA 1NYRA 4MGZR 4RQBA 4FONA 1N5DA 1SUEA 2V7EA 3H5RA 3SKVA 4OXRA 3FPCA 4Q03A 4JOBA 1JP7A 3KVRA 1A8TA 1A97A 1L9YA 3FLEA 3MCUA 2HSWA 1GPMA 4M89A 5D8DA 2VQ6A 4E3WA 3EY4A 1OLUA 3PSHA 3DFKA 4TKUA 4BJ1A 1TPYA 3KUXA 2XDYA 5AW8A 1HT1E 1EFTA 3O4HA 3B60A 2IS2A 4EG4A 1ECPA 2Q7DA 5B4TA 2YNVB 4YYZA 1E66A 2AHRA 2NYVA 3W5BA 3W5VA 3X1YA 1GEEA 3HPRA 3GO4A 4NNOA 3B6EA 2QX8A 1MP0A 5DMHA 4YPOA 3O1JC 1QHGA 2AWNA 3CZ5A 3KM0A 3PDIB 5ENZA 2Z3VA 4ALNA 1W6RA 5F21A 4F3KA 3T9AA 4KXNA 2JHCA 3H2JA 3ZZMA 5EJEA 5KU7A 2WD7B 3GI1A 4OFWA 3SJAA 3AJDA 4CM3A 4JJZA 3V33A 4GL2A 4CHLA 1T0JB 4IWXA 4PZ9A 3SHFA 1EXDA 2HCRA 1A9YA 4NK5A 2HKIA 1U0HC 4OXYA 2PWPA 3MPUA 2XLBA 4K88A 3D6HA 4TMTA 4CNBA 2DYKA 1K6MA 2O8DA 2IY7A 1JFRA 2G88A 3KCQA 3BXXA 1XK6A 1AG9A 2R5FA 3ZHVA 2CFRA 5F2NA 5CD1A 2BYTA 5DT2A 5EQDA 5HKLA 4MK4A 2ZRHA 1RZRA 2GXAA 1F5SA 2KLHA 3NT4A 2BGWA 1O0CA 1W36C 4B3RB 1RRPA 2NTNA 3ZNBA 1YS1X 1MCZA 4NJOA 1KNXA 2Q9BA 3LCUA 3AHDA 3HJUA 2IEDA 2O3RA 3N7TA 3OI7A 3P9XA 5HKKD 2BFKA 1YKGA 1SCIA 3HABA 4CHGA 1QOPB 3OU2A 1LI5A 4PLZA 2G76A 4OF4A 3RWMB 1AQUA 1CZHA 3U31A 4RA9B 3EDRA 5TS2A 4XM2A 3USES 2WSSD 2OBBA 4DDUA 2VH5R 3USZA 3FOAA 2C7BA 2GLUA 3UCFA 4BS9A 1T4CB 1GGJA 4I08A 1H2AS 1DHRA 3WWDA 4HSGA 4C1CA 4BLVA 3MRTA 1WW8A 4MGIR 2P4QA 3IAM6 2A9KA 1HTTA 1Z37A 3IQEA 4HNAA 5JXJA 2PUTA 3BHIA 4NJEB 3UEOA 4YLYA 2CJWA 1ZMXA 2CHEA 1UWCA 2VP3A 3JS5A 2BR3A 2INGX 3U7QB 1EIWA 4PVOA 5I5EA 3L4EA 4JQYA 1Z47A 4OH1A 4V2IA 2A5GA 3RBZA 4HVTA 1U0GA 1Z0UA 1JEYB 4LQ4A 2A9PA 4MYTA 4QX6A 3H3XA 1RI2A 1XN4A 2IEGA 4Y3UA 4QYSA 3LHSA 5GVRA 1N5IA 2CCGA 1NX6A 3QWBA 1JPVA 3ON5A 1TVCA 4LY6A 5BOVA 1YU6A 3UUWA 4EY2A 5HISA 1V4NA 5CJ2A 2DH6A 1QRSA 4YMSA 4AF6A 3IEIA 4DQ0A 4LVOA 4XEUA 4DKXA 4W5WA 5GM2A 3F6BX 1ZY2A 3E2PA 2FUG1 2ECPA 3I01A 1KAGA 4LGVA 4M6WA 4FMBB 3TFWA 2XTZA 3VMMA 2QB5A 5FQCA 2B8EA 3D2AA 4KJXA 3TLKA 4ZEMA 4KXFB 3SIPA 1Z18A 2VHXA 5BW5A 4QM6A 2WU3A 3IDAA 1YZKA 2X4LA 4FYXA 4C0BA 1CQJB 4NECA 4EB0A 1GU7A 1ZRNA 1BRTA 1FYEA 3G8BA 4TTTS 1LPAB 2IKQA 5K8JB 4DJEC 5K4AA 5A4AA 1G8JA 2P1EA 1CUYA 1DEOA 1M5UA 4ALIA 2CFCA 2R48A 3I72A 1Z4NA 3KYBA 2OFWA 5HK8A 1LPSA 5IM5A 3IP7A 4RGVA 2EARA 3PITA 3BWMA 4ONEA 4LFAB 4BRUA 4E1BA 3CUYA 3QELA 2FEMA 4DZTA 1Y7LA 2W2NA 1W6UA 3H5AA 3JALA 4AAYA 5MN5A 2BEWA 3CZRA 4EY8A 1T36B 1JJFA 2X3UA 1F12A 1KMCA 2X5KO 3DLPX 4EY6A 5GQSA 2AZDA 3GRRA 4QTUB 1FU7A 1L7OA 3GUYA 2NU7B 2ZAIA 4TRMA 3SVZA 3JRXA 3FMFA 3QH8A 2IDZA 3NKVA 1VI5A 2O3JA 2YYAA 4DCVA 1JWLA 1RWXA 1HKUA 3LNCA 4G5YA 2OV1A 2PRSA 2A9JA 2A4KA 3C15C 1T43A 1SC4A 2CVHA 2OG2A 1G5HA 2XDWA 3QXCA 3CH7A 4RK4A 2BGLA 2W2KB 1DKQA 3L05A 4HQLA 4C87A 4M83A 4DJ5X 1KS9A 3LW8A 3N9IA 2FSGA 4MI9A 3TAXA 1V39A 3DVRX 3VVLA 3GV0A 3NHRA 4FEEA 1UBLS 4WN9A 4Z0NA 3ZX4A 1YU9A 5K0EA 5KYYA 4YCSA 4BX3A 2W7TA 4K6OA 5JC1A 5CX1A 1Y5MA 4UU8A 1YR2A 4FW9A 3AI1A 4ZYYA 5CCBA 1RJEA 4RTMA 3T3NA 3GMDA 1C7QA 4U7WA 2JFUA 4XLTA 1Y8QA 3H97A 5BUZA 1MXFA 2OOSA 2PU7A 4IMRA 1PFYA 5JYDA 2Q3HA 1QHHB 5JMOA 3MXOA 1ZITA 3R5HA 5FHQA 4QBIA 1DI0A 1XQ9A 5CTJA 5FADA 5IXYA 5L3SA 4Z0HO 3AWIA 4C4AA 1MMFB 3WYAA 1KKLA 5DNYB 1NL3A 1U4OA 1PEKE 3DP7A 1RWKA 3QWAA 4CMGA 4EYKA 1CRZA 3UPTA 2IOQA 1HI9A 5JFGA 3I9JA 1QIDA 4RGQA 1D9ZA 5DE3A 3VU0A 4HAWA 4Q48A 2XQFA 5JZSA 1TYDE 3HKBB 3MMZA 2FPSA 1FUIA 4YACA 3L5KA 5K8VA 1OXTA 3SF0A 1DOZA 1I7LA 3J81A 1GFWA 3I52A 1ZUNA 4FD2A 1NFQA 4CTNA 2YWEA 2QJFA 2QPLA 2AX3A 3IMFA 3FOEC 5H16A 2Y9MB 1SRQA 3B82A 3IMGA 1RP7A 4IIJF 4QOHA 4WADA 5L53A 1BMDA 2EFDB 1TQ6A 2R4UA 3IP9A 4DHEA 5EJIA 2XEXA 5CBKA 4YN3A 5LXTA 4YRZA 1L7BA 3FY4A 5JO0A 3WLJA 5LM6A 3I4CA 2Z56A 2ZYVX 3QOWA 4C6HA 5BSGA 3I6QA 3D7NA 1BXGA 1GKUB 1K4KA 4WXYB 1NGSA 1R8XA 3DNMA 3MM4A 3PGMA 1V1MB 3ZTTA 4FNGA 1VJDA 1JPUA 3P45A 5JVDF 3FROA 4RF2A 4C3OB 5U4XA 3ISVA 2HA6A 4OHYA 2XCIA 5LZ9A 2WKQA 4Y1EA 1N2CB 5DPMA 4WLUA 5E38A 3DS8A 1PZMA 3NPAA 3QU9A 4OATA 4NOMA 5SZHB 1G20E 4J1NA 3THXA 4YAIA 4J29A 2HRCA 5AICA 4Y6SA 2X8WA 4P6VF 2HN9A 3AB7A 1G21E 1LBEA 5JJBA 5MGNA 4BDTA 3MTGA 2J0SA 1FY2A 2ISQA 3TQFA 1E1KA 2YY7A 3KT3A 1F5NA 4XYLA 1OFHA 2BJVA 1PR0A 1Z5UA 2Y1EA 2MMGA 5H3LA 4Z4EA 5C0OE 3KL7A 3FCEA 3QNUA 5IDYA 2GBIA 5D87A 3RT7A 2CNNA 1VB3A 3FDJA 4H7DA 4PBRA 1YRQA 3ROTA 4QKQA 4Z8XA 5BNWA 1GM5A 4B3HA 2JCYA 1FOEB 5FEUA 1UQTA 2OXIA 1ESZA 2EFCB 3COPA 1PWZA 3HZRA 2YXPX 3WYDA 1KZ4A 2W0MA 5FFNA 3SYNA 3LWNA 1P91A 2AZTA 5CH3A 4EY3A 1TO6A 1NATA 3B7WA 4C14A 3FAIA 3E9YA 2C9ZA 3I3SR 3JAWA 2J9GA 1AXEA 3DNPA 1LLFA 1NMSA 2ZIEA 2Z83A 3DKPA 3Q7PA 4GG1A 2XADA 5AKKA 1XEAA 2QX9A 3AIIA 1KQ3A 5BVHA 2B5OA 4G5QA 4PPNA 5CB8A 2AOXA 2O7QA 1V16A 2EXXA 3Q8MA 4E7OA 4FE7A 2AN5A 4LE6A 2DFDA 2V7WA 3OSUA 3FFAA 4TRJA 5CTAA 3SVTA 1U94A 4M8NE 3HV0A 3ZU3A 2CJFA 1ST2A 2P9TA 4PPYA 5I7EA 1O0BA 1Q3HA 1BO6A 1EXMA 1GPJA 4H7JA 1UMDA 3UJ6A 4CXMA 5LMUB 2AIRA 3JVUA 3MUNA 5T57A 1NZDA 5TF4A 5E7JA 2HHJA 1QXSA 1NP6A 2Q5FA 3L5OA 4MS1B 5J59A 2EDCA 2IIPA 3Q4GA 1CQPA 3EZ7A 3FUTA 3L1IA 4BNHA 1L4KA 4KDRA 2P0EA 2PKXA 1UBRS 3O74A 3QJ5A 4FGJA 1JKIA 3K2IA 1JDUA 4X71A 3CRZA 3NHMA 4ZVPA 4D57A 2B4AA 1UKYA 3PEVA 2JFVA 4FFRA 1XTZA 1QYRA 3AIMA 2CLKB 4D1VA 1U0OC 5GONF 3I0ZA 2R8BA 5A0FA 5TB5A 1SG0A 2NO9A 4G0XA 2L69A 3CLRC 1A50B 1JW9B 3MJCA 4PM4A 1II8A 4Q4DA 2Q2NA 3DDWA 2ZIGA 4BLTA 4IXWA 1I14A 2QJOA 4WCDA 2ODWA 5FL7D 2ISSD 2IUEA 3BIOA 1F8GA 4NS4A 3ABOB 4I8IA 3K9LA 3AMVA 3T7DA 4XRGA 5I51A 1WLYA 1ZWLA 2XCOA 2GSWA 2ODNA 3EEIA 4UDOA 3R8FA 3GLFA 1P2DA 5ILGA 2CV0A 4F4FA 3KYCB 4M8SA 5FBKA 5FKJA 1TL7C 2I9PA 4O08A 4JI6B 3ZV3A 4MKFA 4C0JA 1MVOA 1NV9A 1GTJ1 2NSDA 2V7GA 5F2KA 4AG3A 2I99A 3GH1A 5CA0F 3BMQA 2HHHB 3OT4A 3FPEA 4MA4A 4MW7A 4D79A 1U9YA 2PBFA 1Q7GA 2C9OA 4HCJA 5K8TA 3ZD8A 2YMMA 3RUAA 3RVMA 2J9XB 3OY2A 5ALOA 3S1SA 2VPYA 1GSAA 1QX4A 3D4PA 3RIMA 1RE0A 1A8HA 4HNRA 4IUBS 4CVNA 3TS1A 5BUCA 4ZCMA 4JB8A 1R5JA 3OD1A 1TJPB 1JALA 2GYUA 4E5MA 1LDEA 4XQGA 1J5PA 4BZPA 4P1ZA 1R5OA 1EDZA 4Q9DA 3VFDA 5KX5F 2NMVA 2YHSA 2IHJA 3NAMA 3QF7A 3VXKA 3KVNA 4HG2A 5C3MA 2OOKA 2FRXA 3STHA 3KETA 3EC2A 4QU5A 3BFPA 2FPXA 3T15A 1ACJA 3EIEA 1KDRA 5EPEA 1BU5A 5I47A 1A9RA 3B36A 5BOSA 4TTAA 3WISA 3B9RA 3NYQA 4DR7B 1L4GA 5FO0A 3EK2A 4QTYA 4CIBA 5I9LA 1IHXA 4AY6A 3VOSA 5IQKA 1PJ3A 3U4CA 2IZ1A 4RDIA 3GP8A 1PX2A 5AT1A 4UOZA 2WJAA 3GVXA 4M87A 5FBWB 5K3FB 5F33A 3LC0A 5JYEA 4LXUA 3DHWC 3E2IA 3P0IA 4ZCQA 1J2YA 2NO7A 5B30A 2Y27A 3SSMA 4PQRA 3PY6A 3FNRA 2XVZA 1QR6A 4I66A 2OCPA 3FPHA 5FJJA 5JJ5A 1HWYA 1D7AA 3QE0A 2J5QA 2RC5A 5BV0A 5IM4A 2FK6A 2CL6X 4YALA 1ZC4A 1OMOA 4L5JA 2D7DA 2C97A 3QX8A 2EW2A 3ENKA 4DLBA 2Y1KA 4NZPA 5BSMA 1T24A 4H7EA 4GFDA 2Q8NA 3DGFC 5FWAA 2RK6A 3CB2A 4YC7A 4YECA 3ZWXA 1QPZA 3RVQA 3SEQA 3S6JA 5H1YA 3TEFA 2G4LA 3AR3A 5DHAA 3U3DA 4GS5A 5CXUA 3LE8A 1KE1A 2BP7B 1NMZA 4TSFD 3PNBA 1QK4A 4JUAA 4A0SA 4HP8A 1CXZA 5DN6A 4B87A 3RT9A 1W36D 2Q62A 3W2GA 1IZ9A 1QHSA 3ANXA 1C41A 4KACA 2QD2A 3OH8A 2Y99A 4X94A 5K6RA 3CX4A 4EYQA 3UAGA 4Y7DA 2AGVA 1N2JA 3LOPA 4HDRB 2IYQA 1HE5A 2WJPA 1JI3A 2XUFA 4UE2A 3V1MA 3OP1A 1QVAA 4PWYA 4MWBA 1VG0B 3WNBA 3PNPA 1BD4A 2ZRKA 4WW0A 4MW4A 4NAVA 4DGSA 1MW8X 4JQOA 4CTJA 2BGJA 5J23A 1OKKD 3O83A 3C7AA 4NL4H 3EPRA 4RNCA 1BDJA 3UHJA 5HX7A 4IILA 3IBFA 4TTIA 3QKTA 4CJXA 5IJ0A 2J3QA 3WL3A 5JD3A 1BDIA 1Z29A 2ETXA 1VZ2A 4HJRA 4X90A 1MJGA 3B1JA 4A0FA 3KLPX 3V8NA 4BUZA 2B3DA 1X7YB 5M7EA 1I4TD 1QH1A 3WJ1A 1UT5A 3ADDA 3AHEA 1KVTA 3DEKA 2VL7A 4F8YA 1NW9B 4M22A 5A71A 1SXQA 1Z5ZA 2WG0A 2YCLA 3KOMA 3ZXYA 1QCDA 1BE6A 2WD8A 1NVMB 3DQPA 2WRZA 1NVBA 4QUIA 3LKDA 1KRXA 1X0VA 3EFBA 4UW9A 1HXHA 3FZYA 4GECA 4WUVA 1D6JA 1OYOA 5FWDA 5TJHA 3QXGA 2GPYA 3DTYA 3G79A 4HTFB 3CZ9A 4INOA 4BTLA 3FYSA 5ES3A 1ENOA 1WPQA 4RPIA 2ZK7A 3ZY5A 1UM9B 2A5LA 3KTOA 3EVNA 1VL0A 5DTEA 3N0XA 3CRW1 3H19A 1VE1A 2PUFA 1LLQA 1CJSA 3CVVA 1M1YB 4AWXA 5JZOA 2ZRMA 3BN3A 2BOVA 2ZATA 1D5CA 3CVOA 3V2UA 3ONFA 2X15A 3ME5A 4XQEA 4RBSA 4FK8A 4YEDA <