2Q9UA

Crystal structure of the flavodiiron protein from giardia intestinalis
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
409
structure length
409
Chain Sequence
KPKYVQDQEMIPGVYWVGIVDWMVRIFHGYHTDEGSSYNSYFIDDECPTVIDSVKYPFAEEWLSRIAACCPLDKIKYVVMNHAEGDHASSLKDHYHKFTNATFVCTKKCQEHLKILYGMEKATWLIVDDKYTLKIGKRTLKFIPVPLLHWPDSTFTYCPEDKILFSNDGFGQHYATSRRWADECDVSHVMHLFKEYTANILGLFSAQMRKALEVASTVEIKYILSAHGVSWRGDAMGLAIAEYDRWSKGQHCQKKVTVVLDSMYGTTHRMALALLDGARSTGCETVLLEMTSSDITKVALHTYDSGAVAFASPTLNNTMMPSVAAALNYVRGLTLIKGKPAFAFGAFGWSNRAVPDIVAELRDGCKADVYDEKGITFKFNYTEELLEQAYNAGVDLGKRAIAYCEKNAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The O2-scavenging flavodiiron protein in the human parasite Giardia intestinalis
pubmed doi rcsb
source organism Giardia intestinalis
molecule tags Oxidoreductase
molecule keywords A-type flavoprotein
total genus 157
structure length 409
sequence length 409
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2q9uA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2q9uA01
1V4BA 4GQIA 4Y7CA 1AKQA 4N65A 3FAIA 5AHOA 4ZVLA 4V0HA 1T5BA 1CZKA 3LVZA 4ZVMA 1AKUA 1XTOA 1KO3A 2KLBA 3OX1A 3F6RA 3FNIA 4C14A 5LBTA 2FU8A 3AF6A 2B3DA 3NHPA 3VPEA 3BK2A 2WYMA 1M2XA 4J5HA 1AHNA 3B6KA 1SMLA 4AX1B 3S2YA 3T9MA 2BG7A 5ACTA 1YDGA 3H3EA 5LCAA 4N82A 1WRAA 1FUEA 2FVXA 3OJXA 4XDGA 2P1EA 1FTGA 4NULA 3TP9A 1C7EA 3O2NA 3DH8A 3Q6VA 1QR2A 3N3AC 2Y87A 1AG9A 4GYQA 2QDTA 2MT9A 3IOFA 3O73A 5B3RA 2QEDA 4EYBA 4F6ZA 2FU9A 4NQ5A 3DHAA 3B6JA 1DXQA 1RLJA 1YRHA 2FCRA 2Q0IA 3W78A 4F6HA 5ACQA 3ZR9A 2NYPA 1AKTA 4UWPB 2P18A 4HL1A 1A7TA 3RPCA 2N1MA 4YAUA 3IOGA 5HH6A 3I15A 4GCWA 4D1UA 2QJSA 1DX9A 1YCFA 1Y44A 4HKYA 3SBLA 2BF4A 5A5ZA 4UWOB 4HS4A 3D7NA 2WRSA 3X2XA 1CZLA 2ZKIA 4U7FA 4O98A 2FZVA 3NHFA 3ZNBA 1ZWLA 1ZWKA 1AZLA 1CZHA 4FX2A 4AWYB 5LM6A 3BV6A 5EVDA 3FVWA 2WYMC 1WW1A 3B6MA 1DD6A 4TZBA 2GFKA 1BC2A 2YZ3A 3I13A 5EV8A 4Z5YA 2YNTB 4PVOA 4U4LA 4YAWA 4ZNBA 4YAOA 2FM6A 4WD6A 2BIBA 2QDSA 1SQSA 3ESHA 3QFCA 5B1UA 3KAQA 3U7RA 2ZWRA 2M6RA 1WSWA 4ZO3A 2MWMA 4FGLA 2BN4A 1X8GA 2WHGA 3N3BC 4CHLA 3GFSA 4H0DA 3BK1A 2M5DA 3IE1A 3FJOA 5FUQA 2BFZA 3RKKA 1ZTCA 1D4AA 4C1CA 4D1WA 3NHLA 2CBNA 1MQOA 1BVTA 5F51A 3W7AA 5AHRA 2Q42A 5EAIA 3NHWA 3UXHA 3NHKA 1RTTA 4GR9A 4CF6A 3P2UA 3WXCA 2GCUA 1SG0A 3F9OA 5EVKA 1DXOA 1FX1A 5EWAA 2BR6A 2BGAA 3SW3A 2QX6A 4HEQA 2I7TA 4EXSA 1JA1A 2FLVA 1DDKA 4RAWA 3NHUA 4C1FA 2BFLA 4S24A 3W79A 3FW1A 3GFQA 3P0RA 4OXXA 4QODA 2ZO4A 3QE2A 2MTBA 2H6AA 5LS3A 1AKVA 2HNAA 5LJIA 4Z6XA 3EYWA 3FX2A 3IE0A 1CZRA 4QOIA 5NLLA 5HIQA 3NHSA 1JA0A 1JT1A 5KILA 4C0WA 1VJNA 2Y8AA 4Z60A 3QFRA 3OWHA 1F4PA 2OYSA 2FU7A 3RKJA 3TEMA 3RPEA 4UBQA 5ACSA 4LTMA 4RL0A 2ZNBA 5A4KA 1YCGA 3OX3A 3X2YA 2XODA 4NQ2A 3X2ZA 4YSLA 4LAFA 4XWWA 4TZEA 2HPVA 4C09A 1BU5A 4FSBA 1B1CA 3F6SA 5FQBA 5HISA 4C76A 5K4MA 2Q9UA 4J8PA 3ZHOA 3IEKA 1OBOA 4EFZA 5AYAA 2QWXA 2V5UA 3NHYA 2XOEA 5LMCA 3KLBA 6NULA 1OFVA 2F1OA 1YKGA 4QOJA 5LVAA 5LCHA 2GKLA 2A7MA 4PTYA 5EMNA 2X2OA 4YAFA 3MD7A 5A87A 1QHEA 2RG1A 4KEQA 5FA6A 2M5CA 1J8QA 3OWXA 4D02A 1KO2A 2P4ZA 2FK6A 4BMPB 1CZUA 5LBUA 4R81A 1BMCA 2BG2A 2XR1A 1RLIA 1T0IA 2OHIA 5EA2A 5B15A 5B3KA 3IE2A 1D03A 2FZ5A 4D1VA 5F4BA 1KBOA 3N39C 3A4YA 4UAMA 2Y8BA 5HIPA 1CZNA 4XUKA 3L6NA 4DILA 5DPXA 3KNRA 3S0ZA 1QH5A 4JO0A 3ESXA 4Y9UA 3SFPA 5BUCA 2ZZIA 3KAPA 2I7VA 3AF5A 1H69A 2BMVA 2QR2A 4EYFA 1ZX1A 4F8YA 4DIKA 4LE6A 1FVXA 3VQZA 3HLYA 4EXYA 1FLVA 1VMEA 2Z98A 4NQ6A 4FR7A 2BTNA 4YSKA 3I11A 4PVTA 3T3NA 4PTZA 2FHXA 4C0XA 2FAXA 1J9ZA 2D5IA 1CZOA 4LTNA 3IELA 4ZEJA 2NZEA 2FOXA 3SVLA 4M0CA 1XYVA 4LA4A 1X8HA 2UYXA 2QX8A 2BZSA 1XM8A 2XF4A 1I1OA 2KQUA 2Z9DA 4U7GA 1JJTA 3ES9A 5AEBA 3GAMA 2QMZA 2X2PA 4QOHA 3TZBA 4GI5A 2BG8B 1BVYF 2BPOA 1E5DA 4QOFA 5LSCA 3ESZA 4RBSA 4EY2A 2OHJA 1AKRA 1JJEA 1XYYA 2P97A 3IDZA 3DHCA 1QRDA 4YALA 4Z67A 4AD9A 5HH4A 4C1EA 2W5UA 1OBVA 1K07A 2Z9BA 2AMJA 3K1YA 4FEKA 5HH5A 2YNVB 1XT6A 1P9EA 2BG8A 4RAMA 4YQEA 1L9YA 4EYLA 4N9QA 2V9CA 5ACVA 5FQAA 5K4KA 4XDHA 2VW8A 4Y9RA 3SPUA 2GMNA 4C1DA 5LLDA 2R96A 1YCHA 4UWRB 1YOBA 5EV6A 2V5VA 2FDXA 3NFRA 3ZWFA 4NQ4A 1NNI1 4ZO2A 5ACWA 2I7XA 1KR3A 1J9GA 3X30A 4ESEA 3FCZA 4J5FA 1D04A 3NLLA 2YNVA 1FLNA 3AJ3A 5JROA 2WYLA 3F2VA 3LT5A 2QMYA 3BC2A 5K4NA 2NZFA 4RM5A 2OHHA 5IQKA 4QOEA 1WUOA 1TLLA 3NHJA 2FU6A 2WC1A 3ESYA 4RL2A 3DHBA 4BP0A 4GYUA 1FLAA 5AXRA 3TE7A 2NXAA 2AIOA 3U7IA 5EVBA 4CETA 2ARKA 4HL2A 5KIKA 4KEPA 4ZVKA 3HA2A 2GSWA 2AZ4A 3OVMA 1A8TA 5FX2A 3SD9A 3IEMA 3R6WA 1FLDA 2Z9CA 1WUPA 5NULA 3ZQ4A 1WSBA 5ACUA 1TIKA 5ACRA 1AMOA 1HLKA 3LCMA 5LJLA 3KL7A 3F90A 3GFRA 2GFJA 1X77A 3L9WA 3UXEA 3PY5A 4C1HA 3T3OA 2BMIA 5LCFA 4B87A 4AWZA 3K20A 4ICIA 4Z5ZA 1VGNA 4AX0B 3I0VA 2A5LA 2E7YA 5ACXA 4D1TA 1XI2A 2QX4A 5ULLA 5K0WA 2YCBA 1AKWA 3KNSA 3QH8A 4H2DA 2BFKA 1J9EA 3EDOA 4FGKA 4UWSB 4TZ9A 5LE1A 3NHRA 1GG5A 5HIOA 3I14A 4LTDA 5EH9A 4UA4A 2YNUA 5TGZA 4P62A 4QOGA 5B3LA 3L9XA 4TYTA 3OJWA 1X8IA 1DXKA 2BFZB 2FHXB 3PG4A 5A0VA 3KEGA 2YNTA 1C7FA 4Z7RA 3HR4A 3R2UA 2Q62A 5ACPA 1ZNBA 3W77A 1RCFA 4TZFA 1KBQA 2Q0JA 2R97A 4DY4A 5AXOA 2DKFA 4H6PA 2HNBA 5EW0A 3OX2A 2M6SA 5F12A 2BC2A 4PU0A 1ZKPA 4YSBA 4FGJA 2R2DA 4XWTA 3G5MA 3ADRA 4TYFA 4C1GA 1H66A 4BMOB 2DOOA 5EHTA 4ZVNA 2HB9A 3B6IA 4BZ3A 5FQCA 3SRXA 2BG6A 2FX2A 3PY6A 5A0TA 1QBGA 2QX9A 3G1PA 4NLLA 3JSXA 2YNWA 2QINA 3JXPA 2MOKA 1QH3A 4U7HA
chains in the Genus database with same CATH superfamily
3KKEA 1B15A 3JARB 4Y7CA 2YFKA 2C54A 3DBHB 4RTMA 1FDSA 3V8PA 4UBIA 3RVSA 3TTYA 1KBZA 3L0DA 3IT1A 4JFRA 2JBAB 1GFZA 2XWBF 4JLDA 2K2QB 5EL0A 1WMBA 4WN9B 1VPEA 2FNAA 1H4SA 2H08A 1UPBA 2JLQA 1PJRA 4Z4CA 4XEHA 4D3ZA 2XUFA 3IXQA 5FAXA 3UC9A 2X9NA 4FNOA 3L0SA 3MUEA 4BQNA 1ZOOA 5F3RA 1IOZA 4M4SA 2QA5A 1FQWA 3U5ZB 3L02A 2V7QD 3OC0A 3PA8A 5KDLA 4K0KB 1CU1A 2FSPA 4GX2A 2XVMA 2K6GA 2AA3A 3TLXA 2P1EA 2YS6A 1Z29A 2XECA 3L4SO 5LYYA 3V4OA 2V6GA 4D8YA 3IUNA 5BY2A 1RLTA 1TD9A 5TDHA 5K0ZA 1EHYA 1X7WA 2IHNA 4GPD1 4CYMA 1H2RS 2CMDA 4HMQA 4QNRA 3VHXB 3HUFA 3JQDA 4LJLA 3DBOB 3ENWA 4MS1B 4NICA 4H4CA 4RPIA 3HCWA 4EA9A 3M89A 1T5HX 3TMYA 3JPYA 4PAWA 3O5AA 4HGOA 3W5JA 2G4LA 5TX7A 4CN9A 4EKIA 5B4TA 1G17A 4NYIR 1VSVA 1L6IA 1UBGA 4OYRA 2FTKE 4WNAB 2C7PA 1KI2A 2Y05A 1EDBA 4AS2A 5DM4A 1JR2A 2KJQA 4KJXA 5FEMA 1L5NA 4C22A 3DOOA 4HL1A 2EFJA 3INYA 3EEQA 2FPUA 4P83A 2WJPA 2ZE5A 3IEUA 1NVMB 2O1EA 1VB3A 2C9DA 3FYSA 1PFVA 3H3FA 3K5PA 3NTUA 5CT5A 4YIKA 4EG6A 2A0XA 2CL0X 4WCFB 5FBZA 2JLVA 2ZREA 3O8DA 1KDRA 1PS9A 2BF4A 3NWJA 3C24A 5TV2A 5JYDA 3R5FA 4FFMA 4RKRA 2AR9A 4J0HA 5BWLA 1C1XB 3MXOA 3TIXB 2QVXX 2F7SA 3I9NA 4YAJA 5IZCC 3THSA 1OBFO 2FPOA 3PC2A 3CHYA 3QKIA 5FBHA 3HV0A 5BV8A 1L4EA 3LPAA 4G8CA 5T6BA 1XKQA 2PXHA 3QV2A 2XQKA 1KZYC 2WFMA 3HL0A 2CZQA 2EDAA 2YXLA 3F5DA 3ZE6A 5DX0A 3I13A 2EKPA 5EV8A 4RA6B 1G3IA 1WB6A 3VISA 2GPTA 1KZ1A 1OX5A 2Q1WA 3G1UA 5AM2A 3TH5A 4JI1B 3PC3A 1MW8X 1QC5A 3CIFA 4EHIA 3RM3A 5ALMA 1JHRA 1F0NA 1K6EA 3REQA 3WLTA 3HKDA 3VKHA 4MUFA 3JW8A 1KDYA 3ZWDA 2QDSA 3GCDA 3ZWWA 3Q3EA 1RZRD 4CLDA 2NSYA 3ADKA 4GSYA 1ZY2A 4MKGA 3R7WB 3X1YA 2D59A 1BXRB 2M6RA 3LUGA 3HVHA 1DC3A 1ESDA 5JCXA 5JMTA 3QF4B 1JLLA 1TQDA 4NU0A 5FJJA 4BWFB 3DEIA 2XQIA 2WPDA 2G1PA 3P4YA 4DBZA 2IS1A 3TX6A 4AG5A 3GCZA 4XPZA 2X0EA 4HVCA 3ZWMA 1DEHA 1AUXA 1FPQA 4NFYA 4PV7A 4K6KA 3SMQA 4J6EA 1PHPA 3VZSA 3WDKA 5FXMA 1U3DA 2OORA 1MH1A 1I7LA 1TEXA 4KFSA 5EHZA 4UREA 1CR4A 3KSDO 5BQFA 4J4HA 3FKJA 2B82A 3N2KA 1M0WA 2W2VA 3H7IA 3CPEA 3PWSA 1LB1B 4Q01A 2G6TA 1E58A 1CSEE 1DWQA 2GD2A 2XLCA 1YBHA 1EFRD 3PTLA 4MUBA 3E27A 4EPTA 8OHMA 1RAFA 3U1BA 2O0JA 5H8WA 4E5VA 4PIPA 4YT4A 4C4SA 5JLAA 1Y3HA 2N75A 4NR0A 2IDZA 4AZTA 1EUCB 3OJLA 5A5FA 5LMUB 3FOCA 2YHEA 3PEYA 1P7CA 1Z38A 1GZ4A 2DY0A 1S9HA 4Q4HA 1KNXA 4UU1A 4AYTA 4B8WA 4ZYXA 3GLFE 3O92A 3MK31 1WZEA 2JHCA 5I8ZA 1UBUS 5C1PA 1O5IA 3EGCA 1OQAA 2JVJA 4X9XA 2GAFA 1ST3A 1RI2A 1UXIA 3W79A 1ONNA 3T4UA 3FW1A 3FUTA 4F91B 4C4AA 5EKSA 4BLSA 5DSXA 2ZO4A 1L5GB 4R9SA 2ISCA 5LZ4A 3EVBA 5REQA 3BTVA 2BTOA 4H3SA 3IQEA 1ZJZA 3H9EO 3ZK7A 1E79A 1U7XA 3EZLA 3LUFA 4YV1A 1NW5A 4BV2A 1E2UA 3OEHA 1IHYA 3Q3VA 5AVJA 1UPFA 3EXHB 1NAIA 3RTCA 4BFLA 3D0QA 4P53A 2C82A 2OKGA 3WGUA 1BRTA 3DF9A 1JLRA 1AF4A 3GP8A 4I4LA 1WJGA 3ETHA 4J7XA 2J32A 3BD8A 4EO7A 1KJZA 4UTRA 1N7HA 3N2NA 4IJKA 3KSRA 4WHMA 1E3WB 5SICE 5BMVB 3JS5A 1M6WA 1ORVA 4FFSA 1ZVMA 4J3JA 4LTMA 1XN1A 4Q16A 1MV5A 4LJKA 2ZSUA 3RVPA 2VDUE 4AJNA 3GA0A 4QBTA 5T4EA 3VDRA 4C7JA 3ADCA 2PR2A 4XWKA 3TRJA 4PF1A 4AW9A 2PEYA 4QUAA 3H8VA 3HMQA 4UXHA 4UUAA 4GX1A 1VTKA 4YT5A 5EWLB 2Z3VA 4JKOA 1WMDA 4XVUA 1U5BB 1WO8A 4L28A 1BU5A 1E8DA 1KHTA 4FDUA 2I33A 4UPVA 5KNBD 5EQFA 2OAGA 1KIMA 1Q1EA 2FEPA 3L06A 4HYYA 4PPNA 2PZAA 4KWEA 4OQFA 5SZHB 4ENSA 2WB2A 2PGLA 4OXQA 4TV8B 1OBOA 2ORYA 4ZCRA 3JALB 1CDDA 2AG1A 2XOKA 3G8CA 3UMJA 5HFNA 4P6VF 4D80A 2YYSA 3DEAA 4OMFG 4V03A 4JLMA 5K0FA 1FTYA 1YKGA 3RYTC 4TV9B 4EA8A 3SC2B 1UDRA 1R9GA 1C8VB 4P36A 1QV6A 2H18A 4PICA 2IGBA 1AUOA 3GLKA 4IH4A 1XRLA 2YNMD 2ON6A 4FCVA 1U2SA 2RGDA 1SMKA 3R8FA 1QHFA 3R9IA 1U0FA 2JI8A 2BSXA 1P0QA 1GCIA 1P2UA 1QHEA 2NTNA 2RG1A 3K8ZA 4Z0TA 3NZEA 1S3GA 3FBTA 5EXEA 1KO2A 4G0OA 2DB3A 3K70D 5GGXA 4DR6B 5AJXA 4LDQA 4KOEC 3DFUA 1DQZA 4U5XA 1PZHA 3S8MA 3GXOA 1GKKA 4IEIA 4I1IA 3PVSA 4GC5A 3N05A 1XWWA 3ITKA 4PRLA 5MN6A 1M8JA 4R68A 1RMQA 2IYFA 3PNKA 2R11A 1GA6A 3IE2A 4KNWA 2WABA 4RLSA 5KPDA 3WL7A 1DBWA 5KBYA 4AMUA 3A4YA 1NPTO 4CIVA 4EPRA 2HN9A 4Y1FA 1LPMA 1NUPA 5JDCA 2GM4A 4RSHA 4LJYA 5EIWA 2C5SA 2PSEA 2QJFA 2NU9A 1TB4A 3P9IA 3R6TA 4MH0R 3VHRA 5HW0A 4TVOA 3WOHA 3UK6A 3OF2A 1X42A 2BFAA 4RORA 2DQZA 4RV5A 4BQIA 1OHHA 3CR3C 4IDQA 4HYTA 4TT3A 4WKCA 3PI7A 2FPIA 1ILWA 1EZ4A 3B8HA 4EW3A 3MHPA 3NVAA 2XE8A 4X6XA 2OBLA 2IUYA 1MB2A 1JQEA 4DY6A 1U7HA 3A28A 2X2FA 3ZDCA 1QX3A 1XO1A 4G86A 2PGDA 3NEYA 1ADGA 3TE6A 2ZT8A 3AR6A 4EGJA 1E2NA 1CUJA 5K8TA 1FIUA 1MW9X 1VG0B 4B3MB 4BYGA 3GY0A 1I0ZA 1O87A 2QSYA 2Z2KA 3FRHA 1UJCA 4HVTA 4LDAA 2PGOA 4QYIA 4W63A 1RVDA 3CPSA 3T4PA 3IODA 1A9RA 1R6XA 3DBLA 4PTZA 2HU8A 3EH2A 3UHAA 5CDYA 2VP6A 4X3PA 1Z5VA 2X4IA 1Q3HA 2YVUA 5KJ6A 3DMYA 1KHHA 1NLYA 3ABZA 1ZD9A 3DMTC 1BX1A 2H2WA 1JIVA 2IZZA 3TTUA 1C0IA 4PVDA 1II0A 1RYYA 3QY0A 3WB9A 1FZTA 1JX6A 4I66A 4FFLA 5BXYA 4B17A 4P54A 3BG5A 1KRWA 1I4TD 1JPUA 4RD2A 1YDMA 3E7FA 4QOHA 1LQUA 1WKCA 2PQMA 3GZ4A 1J7JA 4GI5A 1X7HA 4YMGA 2BV3A 2I99A 1HL3A 3WP1B 3B60A 2JHAA 4BNDA 4WFKA 5UKDA 1BN7A 1NQXA 4BLQA 3VA7A 4XPIA 4TZ0A 1VRCA 4K6MA 2H65A 4GQBA 4RSMA 5DTJA 4CKEB 4GOKA 2HQ1A 3NH6A 3PI6A 1W36C 3DKVA 3F49S 5U4XA 3OCVA 1G41A 2ZROA 5JV5A 4Z9YA 3CYFA 5EZQA 2YY5A 3U0BA 2C07A 1CDOA 3O95A 2NTVA 1O95D 1DWUA 3EHDA 5G0UA 2BG8A 1LRLA 2IP2A 5EOVA 3EMDA 4ZOLB 4RVNA 2V9CA 2Y0CA 3GEBA 3MT0A 1ISGA 4J2OA 2AEEA 2BHLA 3ZGZA 4N41A 2X42A 2C8KA 1CWUA 4UDXX 5DE3A 3OZIA 4PPQA 1GAWA 2O6HA 4QAQA 2R96A 3ROEA 5KYNA 1WAMA 3NFRA 2FDXA 3RJ5A 4Q03A 4RD3A 4MA5A 3V1LA 1ODIA 4M8NE 3GJ0A 1T9DA 4UNQA 5KKNB 5JFGA 4WASA 4FOLA 1U2TA 5KPJA 2A4KA 4KGDA 3WGKA 5KX5A 3HJNA 1YS1X 4B2LA 4G1VA 1S2LA 5K0BA 2YHSA 3NLLA 4O25A 4QPZA 1SQ6A 4M22A 4B6JA 2JCYA 4B45A 4PSDA 1SC6A 1F38A 1N6NA 3RTGA 2BIBA 4AMGA 3C41J 3FCOA 621PA 4HMOA 4HT3B 2LWIA 3T94A 4M89A 5TIIA 2H2IA 3I92A 1MKYA 3EIUA 5C3UA 3DF7A 3NKVA 5LOVA 2ZZMA 2JLZA 2RCNA 2GN4A 4ALNA 4EW1A 1W4AA 2FU6A 4W99A 4BFYA 1M2HA 2J67A 1HUQA 2NTJA 2C96A 2WC1A 2GZHA 2YY7A 3DE2X 2GPBA 1SCIA 2XNDD 1JHVA 2AYYA 1LDEA 2DP4E 1V2GA 4HDMA 2WAMA 1PBTA 3FPFA 3OIDA 1KI1A 2Y68A 3OIWA 1UZMA 4GPTA 5AXRA 2I29A 3D8UA 5I48A 3AH8A 2O20A 5CNIA 4Z6KA 5A7GA 2POQX 1RM4A 3UNXA 2QAGB 1CUBA 3G6WA 3PUZA 3QX8A 4URFA 4I08A 3OQ6A 2LDXA 1KS2A 2YINC 3HJAA 4EHKA 4MW1A 5KTTA 4LVUA 3C15C 4PCUA 3TKYA 4XIJA 3CLKA 1KK0A 3OVMA 6PFKA 4OK3A 3GWGA 3V97A 3ICWA 1SKYB 1ZXLA 1S3SA 1Z7GA 3CTMA 4BGUA 1XEAA 3HCOA 3GPDG 2DWUA 3IMEA 4LNAA 2CHFA 5JAIA 3WDMA 2Z5LA 3LCMA 2I3BA 5REQB 5FJIA 3L79A 1KVRA 1YR2A 2J1LA 4EGAA 6CHYA 4BX2A 3RBXA 3SE0A 3UXEA 1UJMA 4OJNA 2XCUA 1VP3A 1BEUB 2AOVA 3KZVA 4L9AA 5J5CA 1SUFA 2CXNA 2C59A 5DSTA 1LH0A 1Q20A 4MROA 4B87A 4BZQA 5HIMA 1DX4A 1NVKA 3I5MA 3M81A 3BQ9A 3RSGA 4UZFA 2JCSA 1I2AA 3CRMA 2V8BA 3EZFA 4QO8A 1ENOA 1ISSA 3PHLA 2Q3DA 2QTLA 4K6GA 4OHFA 1H6AA 1VBFA 1W76A 4BZXA 4Z9FA 2H8KA 1DCTA 2X86A 1PYGA 4P93A 1OBCA 4MP3A 1D6JA 4P8RA 1XI2A 3RH0A 5ACXA 5K0WA 2DECA 2PKYX 4QIHA 5EZYA 1RKUA 1KJQA 1O1YA 3IH5A 4FDTA 3FMGA 1C50A 3NDRA 4HBGA 5LE1A 2P5SA 1CUYA 2UYOA 3NHRA 1QQAA 4U7WA 5HIOA 1FF9A 4P34A 5DX8A 4ID3A 3HEBA 3PFWO 3TD2A 4BKUA 4H6WA 5LQJA 1TF7A 4C9BA 2EFDB 1I3OA 1M72A 4NEHB 1P0FA 3EGOA 3HBJA 4GXQA 5KCMA 3TFWA 3V7YA 5LQDA 3ITDA 4AKSA 4UVIA 4IZIA 1Y98A 2VQ3A 2MJLA 5CYGA 1ISFA 1T8PA 3GT4A 3SE7A 3RS2A 1JT9A 5EMLA 5JVDA 2B1JA 3OJCA 2ZQZA 5HS4A 3I2JA 1X7ZB 4DCCA 1CJCA 4N49A 1KJWA 3PVZA 4ALJA 2QRGA 1ISJA 3IDOA 3L93A 5A9RA 3DMRA 4L5BA 4LXIA 3Q7EA 3JRXA 3V4FA 2FZWA 3CBGA 4LZJA 2WAYA 3LGSA 3FDZA 1HZZA 3A4TA 3CPHA 4GE3A 1H8HD 5DYYA 5T3UA 3X2EA 5BMVF 4YSBA 4GSLA 1Y3FE 1R8XA 5DMHA 1TPZA 2CFSA 1YIAA 1KAOA 5E38A 1TCAA 1FSGA 1KERA 2X9QA 4EUEA 1YO6A 2V97A 3OH8A 4H9GA 4IDFA 3LT1A 4FMCB 5CX4A 2RI6A 4Q4AA 4C05A 2GDJA 3KZNA 3R20A 5HJ2A 4BMNA 4BZ3A 2JIQA 2JC3A 4NS1A 2BC9A 1RXCA 2QP9X 1QWOA 2R4QA 1ZHHA 3FDXA 1V0JA 2H4HA 1WE2A 2O1XA 2FCAA 5YASA 4ENWA 4RCYA 4YMVA 3FI0A 1VYTA 4JAVC 3FPGA 3PIDA 5FL7A 4E6EA 4S05A 3W3ZB 1T2VA 5DGCA 2Y99A 5EFOA 2NU6A 3IKVA 2XAAA 3WL8A 5AW2A 5K51A 5BOSA 4JYZA 3HNPA 1E5QA 5FI0B 3WQQA 1XQWA 3PYLA 2PU5A 1R0KA 1TD1A 3E61A 5DYWA 2NQ8A 1TUBB 3EGVA 4B5KA 2AS0A 1KY5A 2ZUUA 2DWQA 3CSUA 4X7MA 4YP9A 4P0PB 1J20A 2FEOA 4K26A 3TRIA 3SK0A 4R1LA 2C97A 2XB9A 1Z0JA 5AJUA 4UEWA 4MO9A 4P38A 2BJVA 4QG7A 4MKXA 3VPEA 3PWZA 4AY3A 4MVJD 3V00A 4F2GA 1W5EA 3ABSB 1W85A 3GPBA 3DXZA 3ZEIA 3KZXA 4FBMA 1VGRA 2I62A 1WRAA 4IRXA 4MKIA 1SC9A 2YL2A 5LXTA 1A5BB 1WUKS 2OOSA 4L95C 1A27A 2BBWA 3QJGA 3EOAI 4JR2A 4MS1A 4RH0A 1TJNA 3RQSA 4DMLA 2WTMA 1XPUA 3P0EA 2O7RA 1J0XO 1WPGA 3R9XA 4AJJA 5AFSA 2X13A 1WD7A 1C8KA 3CB4A 1U4SA 1U8CB 1XGKA 3ZOZA 3HYSA 3H99A 1VI5A 3GLGA 1U2PA 3GC6A 1YHNA 5COQA 3ZHYA 2O23A 3DD5A 1BD4A 1YZ3A 4BBPA 2M6LA 3P27A 2PT6A 2PNFA 2XYQA 2PV0A 4EZIA 1N5JA 1SM4A 3W78A 2PMCA 2QAGC 3JASB 5ACQA 1SU4A 4ZQBA 4BFUA 2WFZA 1MC4A 1A04A 1ML3A 1UZAA 1CJKC 1Y63A 2L42A 1GQFA 2P1DA 2RBEA 2UYGA 3PGA1 4II2A 1LPBB 4LQDA 4QAJA 2OAEA 5D6OA 3EUFA 1VYUA 4Y6SA 1ZKDA 1JEJA 3VR4H 4ZI7A 1A3CA 2P9BA 3SLKA 1Y7HA 1MXFA 4ZT2A 3ZS9A 1VE6A 1OWMA 2E1RA 3Q8LA 4YJHB 2CG2A 1U1DA 4QUIA 5MFPA 4R5HA 1SGWA 4CKBA 1KI9A 3A1UA 4I9HA 4KVAA 1CZLA 2AE2A 4XWOA 2QN3A 3MWDB 5JC8A 4EHFA 1K7FB 3RBVA 3T5AA 2D0DA 3R7FA 2ZPTX 2A1IA 5CH5A 3LPMA 3E6AA 4MV6A 4OREX 3Q3HA 1E1DA 3RVNA 5KNBH 3D0KA 4IBOA 3W6PA 2E21A 3ELBA 3HBFA 2WAAA 3KJIA 3QEJA 5SY6A 3KX2A 5TLSA 3UA3A 4NCXA 4OHZA 1EUYA 2HYIC 3WGYA 4E5SA 4Y1EA 2G5TA 5HKAA 1BC2A 4LPSA 4AZWA 3U7HB 3L5KA 1JJFA 1ZSVA 4KACA 2R1UA 2BCGY 1G98A 1XF1A 3CINA 5BV2P 2GF0A 4WW0A 1I5RA 1K75A 1NVWQ 1A5SB 2H3EA 4KLCA 2QIPA 5I9TA 1B8NA 2JFGA 1H05A 3MS2A 4JZYA 4K9OA 4H16A 1T8RA 4MLZA 3V3TA 4ISBA 1N2SA 4YBZA 1VL5A 4PM4A 4K3VA 4NMWA 3RFTA 2ZWRA 5ICCA 2VTBA 4FGLA 2X22A 1F9AA 2ZI6A 1U0NA 1ORRA 4JC5A 4M1EA 2QG9A 1G8YA 2WJHA 2A2ZA 4B6PA 1SCKA 2CJXA 3O74A 3TEJA 1XMVA 3EEIA 3IPXA 5K2MA 4C7VA 4E22A 1BHQ1 1E0DA 2QDXA 4QREA 2R86A 3BXOA 2DUWA 4RACA 5C53B 1RJGA 2ZJ0A 3MJVA 4DSUA 3X1JA 5AVVA 1VQ1A 5FYDA 4CT4B 5KVSA 3LW7A 3D02A 3ZX4A 1XTPA 1D4AA 1W29A 2VYND 3H16A 3OBIA 3VAZA 1NTRA 3ZUPA 1HLDA 3OE7D 1DB3A 3OUZA 4ETNA 5KYTA 3RTEA 1NP6A 2FUEA 3FUWA 1E2BA 4HK4A 1MPXA 1Z6YA 1RBQA 4TLDA 3F74A 3UW3A 4AG3A 3WA7A 2AXPA 1EHIA 2XY4A 4C0SA 2HJHA 1GZUA 1BGVA 1TA9A 2E49A 3FM9A 3WL6A 1BCSB 5DPMA 5AM4A 3UG6A 3PUYA 4BLVA 1TYDE 4KXXA 1Y42X 4BCDA 4AAYA 4RXTA 1RWMA 2DYKA 3KNSA 1Z35A 3VR5H 2AN4A 1OXXK 4FB5A 4CKCB 3ZCSA 2YZKA 5LYJB 4ZT6A 4BWYA 5KX5B 2AHRA 3HXQA 1G59A 1Z88A 1QFJA 3NIFB 4H4DA 4NYIQ 1WXHA 1VL0A 3QP9A 5EIHA 4L57A 4EUFA 2PUBA 3AL3A 1S8NA 1UJ4A 4JSTA 4XUEA 4C1FA 4N39A 1RC8A 1UXGA 3QX7A 3EWAA 3WR5A 3GVCA 4K6FA 2CB9A 2VZLA 2COEA 1ENPA 5DRYA 4M9RA 1V2HE 3MLBA 2VDVE 2WYVA 3IIKA 1GQYA 1L2TA 3NC0C 3KQHA 5EI5A 2WG2A 2G28A 3EXFA 5K05A 4Z4QA 2W58A 3HU1A 5NLLA 3UF0A 5HKKA 4L3WA 3LNTA 3ETCA 4PPFA 4XR9A 5BWOA 1QRUA 1OX6A 4POAA 2WWHA 4WK4B 4XR4A 4TRMA 5JS7A 1TMGE 5JZSA 1DC7A 3USES 1K68A 3BYZA 1IBRA 2Y8AA 1BWPA 3O3CA 5D6NA 2XUQA 1LC3A 3H5AA 2HMAA 5JTTA 2XUOA 2YQZA 3OWHA 5AVKA 2O2DA 3DFMA 2WJ3A 4QE3A 2DOKA 5BSMA 3QXCA 1H5NA 2VDPB 2GXQA 4J16C 3UZUA 3WXBA 4QXMA 1SR8A 3H3XA 1GJRA 5K0TA 4BB5A 2FW9A 4A0HA 5IC6A 3WK9A 2DKNA 2VO1A 2JJ2D 4MEJA 1J1IA 2PZ8A 3CN7A 1MRZA 4KVGA 4QTYA 5C1DA 2OECA 5F73A 5CR9A 1M8PA 1Q19A 2QVGA 1WTCA 2AN5A 1UK7A 1JR3D 1X1EA 2FPWA 2IEIA 4K2HA 2C9BA 1SZDA 2QNIA 2WAOA 5FUWA 4C09A 2H51A 2KM1A 2P27A 1SBIA 5AIAA 3K7EA 5LQCA 3IB6A 3Q10A 3CLUD 3DDCA 5BN5A 2GS9A 3E7DA 3IAS6 9ATCA 4NBLA 2RGRA 1AJEA 5BVGB 1HNZB 1MN6A 3MWGA 3NHYA 2OXEA 4R1QA 3BFXA 3DTYA 4BFVA 4LE2A 3NDJA 2YWXA 4OK6A 5IT4A 4JC8A 1P9WA 4BEJA 2WUFA 3F67A 5GJVC 3KQLA 4JBLA 5BQOA 1V95A 4RENA 3ZGXA 3L4BA 4L5IA 1G16A 4C14A 3K0AA 2E87A 4O6VA 2ZYUX 1DHRA 3QQ5A 5FA6A 3AVXA 3LA6A 3KBBA 4JC4A 3VHLB 3VKUA 1DPFA 5ICGA 4N0PA 4HSEA 2ZB8A 4BO4A 3BMNB 3EVCA 2BMJA 4BMPB 5K3EA 4FZRA 4RNCA 4E4RA 3JQEA 4FYKA 3AEZA 2JFBA 2Y6UA 2H0AA 2MYNA 1GN9A 1VLJA 3LX8A 3VH1A 2J6IA 4PG8A 1M9NA 4GVXA 3RAJA 2XNJA 1TA0A 3TOCA 4I1YA 1QX4A 1K5PA 4ZAWA 2C7OA 3HY4A 1P7YA 1YAHA 2AJTA 4EJFA 1B41A 4Y2PA 3UXMA 2X41A 3T5DA 4RTNA 3GP5A 1MP0A 2YR0A 4GOLD 5FTJA 5J9FA 2ACKA 3B8EA 4ETMA 5JNVA 5JSHA 3AEUA 4ABYA 1EG7A 2WA2A 4OI0A 4YVFA 2H06A 2CBXA 2YJ5A 1HDOA 3QVGA 4RHFA 5HOEA 4HWKA 3PLAE 3QI2A 2I4MA 3ESXA 3PJDA 4KV9A 4S1VA 3TUJC 3ZLTA 5TEVA 2UZIR 1ONBA 5JBQA 3N0WA 1XP5A 3WIDA 2GCGA 3MTDA 3U6BA 2EKZA 4GOOD 1H69A 2Q5OA 1XCMA 3AEXA 3CF4A 2DX7A 3M6VA 1VLMA 5GONF 1TUEA 2ZJ1A 5LOVB 2ID9A 3RADC 1LBHA 4E2YA 4O4HB 5JDCC 2P9ZA 4DCTA 3FTFA 3M6XA 1HE5A 1I1HA 4P84A 1VMEA 3U61B 1IXYA 4UXJA 2CXOA 5B2EA 1NZJA 2W2NA 3FTEA 3TNFA 2XGOA 1WZ2A 1RWQA 2JIPA 1ZCFA 1KYZA 4WZZA 2JPDA 3H11B 3HB7A 4MQUA 1TJPB 2QM8A 2A0KA 4UOEA 3TZKA 1O0CA 2V6MA 1QZZA 5EIFA 4UCQA 4UEJA 3ZVLA 3ZXIA 3C8UA 4YQFA 1RLUA 3TLGB 4DXHA 2FSIA 1MEOA 1R9MA 2XUDA 4JLWA 3U17A 3L0ZA 4BNNA 4UHJA 4KQJA 3PC4A 1Y3AA 1QFXA 1M1YB 3QKSA 1UAAA 4Y6GB 1HKUA 5E7JA 3RC1A 4WJLA 2XF4A 2D7CA 3B1WA 2JAHA 1NBWB 3O8QB 3N5CA 2VSFA 2VP5A 3KKMA 4E5PA 2WR8A 3G7SA 5EIOA 5BMVA 1H3EA 1Z63A 4MINA 5IKMA 4E6PA 5CM2Z 4DDUA 4M88A 5DHTA 1YZLA 1R7RA 3ESCA 5T5QA 3TZ6A 4XB2A 4C7OB 3DOFA 4IIVA 4ZDJA 3DHCA 1OX4A 2HCJB 3C39A 2EKBA 4FFDA 4H18A 2IYYA 3KXDA 1M1XB 4FNMA 4M8KA 3SHWA 3KIPA 2AMJA 3K2QA 2CMHA 4YC7A 2QE7D 2J5QA 2ZITA 1OXKB 3ZZ1A 2FYTA 3MD9A 2VPZA 3FFXA 2P2DA 1WB4A 3SU8A 1KR5A 1Q44A 3L7BA 1O7JA 2X4GA 2X8AA 3V6LA 4CL2A 3IP9A 3FCCA 4EJMA 1KJNA 3RRXA 5FQAA 5FNVA 5CEFA 3PFBA 4KFTA 4C3OB 2IYAA 2G72A 3TRDA 3D4OA 4Q02A 4WSOA 5I8WA 1RYZA 2BFCA 5IARA 1XZQA 3G9UA 2I3AA 3SXUA 5TJ9A 1UZLA 1U3GA 5B5SA 2FK7A 2SCUA 1GNQA 5ELMA 4US0R 4ZO2A 1T2CA 4NARA 5EG5A 2PKRA 4LMRA 2VHJA 3QMVA 4ZVTA 2H54A 1I4EB 4JOSA 1EWVA 4DS3A 1J6UA 3AHJA 4V3BA 2CJPA 3NIWA 3NTLA 4Z4FA 1YZKA 2H7VA 3DBLB 4PYNA 3RGWS 3W2TA 4M98A 3C4JA 4BNTA 4F4FA 1K5DA 1EUCA 3TQFA 2QMYA 3BICA 3ZXUB 3FWHA 4I6JA 4EGSA 1Y48E 5A4MS 4R1UA 3RSLA 3MIIA 1OPRA 4PLVA 2GBPA 1TLLA 1G9SA 1U1IA 3K09A 1CRLA 5ANRB 1JWAB 1J1ZA 5CB4F 2PIDA 3LX5A 3KXIA 3ORHA 4DV4B 2QXYA 4PHCA 5FNVF 4QFCA 4KR2A 1SURA 3OA0A 4QU9A 3HMKA 1QP0A 2VEOA 5G41A 4WBNB 1VIVA 1X8KA 4IEEA 1E1YA 3VPSA 1T9BA 2W6IA 3G23A 3DHBA 1XZGA 3LZDA 3HKEA 3O26A 3OKCA 2A7QA 4AP9A 3RUFA 3UMRA 2WP0A 4IQGA 3BWEA 4PAMA 3U7IA 4GZ3A 1SBNE 5IMBA 5JW6A 1Q0UA 2BD0A 2I2BA 4B3FX 4CKEA 4HL2A 3ZBPA 3QYPA 3IP5A 3R7WA 3QIVA 1L1QA 3C3MA 1G42A 1L3BA 3CNQS 1ZK0A 3COZA 4AJKA 1GPH1 3RRZA 1OI2A 4BEVA 3A26A 3AG5A 1ZIXA 3IAUA 3QRWA 5FX2A 2I7DA 3REQB 2H1OA 3DEYX 3ABRB 4B6OA 2XXAA 4B3HA 5KILA 3BKWA 5KHAA 4BB6A 2HKIA 4PNZA 4BVGA 3F97A 3SQWA 1ODSA 5JY1A 3ZWXA 4MI1A 4QUEA 5BN3B 3VO2A 3IJPA 4PZ9A 2YJGA 3DOUA 4KHPB 1OAAA 2Z4RA 4NESA 4XQGA 4W6ZA 1R64A 4TTVA 2F2TA 2WILA 1FTQA 1MLDA 1P74A 4ZV9A 1X80A 2IZOA 4X94A 3SN6A 3KOWA 4JDPA 3UO8B 3FOZA 3AERB 1DCMA 5C5CA 5E8RA 3SJAA 1T3GA 5EC8A 2FWPA 2Q0JA 3LZ6A 1PTJC 3THYA 4L5YA 3RRMA 4JYCA 3WDLA 1OB2A 2POCA 1N6RA 1XKLA 2WHYA 4TMZA 5EJ6A 3C4VA 5ULLA 3E1GA 3ZEAA 5C18A 5L4NA 2O2SA 1MC5A 2I76A 2PN1A 1TM4E 4KN8A 2YZGA 1COZA 5CDGA 1ZW6A 2UDPA 4K0RA 1SBCA 3K05A 2MSNA 2EFYA 3FF4A 3JR7A 4A2PA 2B6HA 3FDJA 1NXTA 2G4CA 2NSDA 2P3LA 2XT0A 3HM2A 1JDSA 4X1IA 3VI3B 3VVCA 3WJ2A 1Z3CA 4JBIA 5AJWA 3SCZA 2OPHA 5EPEA 2DJ5A 2GWRA 1B4DA 2FRDC 2FUCA 3EFOB 4XM2A 1CF4A 3F96A 1YQUA 2NOAA 2ZBFA 1NFQA 2IXFA 2P2GA 2PYZA 2PSSA 2GF2A 3R2UA 1T5LA 1N2BA 1E3WA 2YX1A 4DOMA 2VNIA 4EO9A 3UB4A 4EUNA 1P2VA 5D84A 3HCDA 2KSQA 3H42B 1R0BA 2RH4A 3JQ8A 1W9MA 1FP6A 4IO1A 1TQ2A 1UT6A 1IHPA 1OLXA 2R97A 2AMFA 2DKFA 2FF7A 2NUBA 3NYWA 3VKGA 2X8BA 3FVTA 4RNDB 2WG1A 2HX1A 4OXYA 4FOTA 2EFHB 1XR3A 4J43A 4EUKA 2Y1FA 2F3PA 2JFOA 1DEXA 4M7WA 3AHHA 3S28A 1JG1A 1T1GA 2J07A 1PT8A 1XAIA 4J4BA 1QQ5A 5J4KA 3GUHA 2HT1A 4JA0A 2PLRA 1E1NA 2JGEA 3FCSB 3PB3A 4C6TA 3Q0EA 1Z4JA 2CNNA 1Q2UA 4WN9A 5IC5A 2OP0A 4NXMB 2OPBA 4P86A 2RK6A 1GTMA 3G1PA 5ACVA 3ENKA 4LMAA 4ZYZA 1JT2A 2WWTA 2I3GA 4N18A 3BJZA 3LBAA 5BN4B 5LQMA 4JT9A 1P2TA 2YMPA 4GQIA 4PHGA 4GRDA 4MAMA 5JISA 1S7CA 1TZJA 1ZN9A 3IBFA 1VL2A 4DG5A 1PDWA 3OPYB 3UV3A 4OGKA 5CJPA 1NFFA 1G7SA 3PRHA 3WSVA 4M1KA 1AKUA 2GK4A 2OVBA 2GEDA 4B3DA 4D9BA 4E4TA 4WJKB 3CZAA 4AJ4A 1YL5A 3AF2A 3CLHA 3ZCVA 4RD6A 3AILA 1SWVA 3DZFA 3V3KA 1ZHFA 2NYAA 4CR7A 1V1RB 4J3FA 3L84A 2WIBA 1Y82A 4P3OA 2HLPA 3CSSA 1YL6A 1QZUA 1ZI8A 2J30A 3I37X 3KUXA 1Z7EA 2I1LA 3FZYA 1ECFA 4RMNA 1FUEA 5BYAA 1AHIA 4C2AA 2G09A 2VHXA 1EJ6A 3GROA 4Q12A 3ZJUA 3AHFA 3BGVA 3MRVA 2PTHA 3PDWA 4BWVA 4YV2A 1HFKA 1CV2A 1IIBA 2C1EA 3T9DA 4NULA 2JGMA 2NZYA 2W4MA 3DULA 4ZQFA 3TTXA 3H4VA 3JYQA 3LY7A 1AG9A 1NI5A 1XRRA 1ZAKA 1G8KA 2EBUA 3BCUA 3BJIC 2G5PA 3E9NA 2P77A 4Q1DA 4U6NA 4MJLA 4Q18A 1M0TA 3SBXA 1GTJ1 4BXOB 1FOEB 2QQEA 2ZQYA 1ZJWA 2ONCA 3UGJA 1NATA 1G5RA 2O3QA 1GAJA 1Q1NA 3ABOB 4OO3A 1OH7A 4ESVA 4JNCA 1RXVA 1Q0HA 2NYPA 1OH8A 3AW9A 4RTKA 3WIEA 5KTMA 2P6PA 5LUAA 2EG5A 5GM2A 2Z5FA 5ALNA 1J2UA 2RE8A 3PSAA 4ERXA 3K0AB 2PKXA 4LRSB 1XCBA 5JD3A 3LIPA 5H81A 3WGQA 2FPGA 2OK7A 1M2JA 1XPJA 4JJFA 4KGVA 2PANA 3UWDA 4D9NA 3CKMA 1XCPA 4Y9TA 4Z99A 4MVJP 3K8OE 2KE5A 1YKSA 1NYRA 5A1JA 5FBKA 3A9UA 1K7SN 3BMXA 4KE8A 4KE9A 4B75A 3A6LA 4K2AA 4H1VA 1KQ3A 2ZDQA 1XV5A 3DB2A 2R60A 4RKEA 3I52A 5D1HA 3RBAA 3AUFA 5AW1A 2G9NA 1Y6QA 4FX2A 5FHRA 4YRPA 3RHZA 4HX9A 1IZ8A 2VXBA 2NACA 3PNOA 4RSRA 2B99A 4BV9A 4BYMA 3BHJA 5JO9A 5DTQA 1WW1A 2WYMC 1TLFA 1M0SA 3OIYA 2GFKA 2PBRA 1KDTA 2JH3A 4E5KA 1B0PA 1SB9A 1VRWA 2PQ2A 4LW8A 5M7EA 1Z73A 2AGVA 1J5XA 2XSZA 3H7AA 2BCEA 3SY8A 4H35A 2C31A 3ZK8A 4EBFA 3F5MA 1MB9A 3SYMA 2Z8YM 1XA4A 1HMPA 3GARA 3ILYA 4N5IX 4DMMA 1QH8B 3K5WA 2VLIA 4DT1B 1GPBA 1OVGA 1CULC 2F48A 3K94A 3T1HB 5BWMA 4I4CA 4F4DA 5JRDS 4XJVA 2PKEA 5TF0A 1T36A 1X7WB 1C0PA 5AW6A 1KO8A 2WD8A 1ZGBA 2ACWA 4YGYA 5CCXA 3DCNA 2VRBA 3ISTA 4CF5A 1FX0A 2EL9A 4UAGA 4KXMA 1IM5A 2EJVA 3NHMA 4R8LA 3CG4A 4AB1A 4UEOA 4N0EA 4CDNA 4OHUA 4BUJA 3SYRA 2IKQA 1VJRA 2PRYA 1PZXA 3R5KA 4FYXA 3TEFA 3W7AA 1T9GS 3WBBA 1V35A 4MX8A 2D1SA 3WXCA 2QD1A 4F12A 1I2ZA 2Q0SA 2VJNA 3DMTA 3FZEA 3GF4A 4J0CA 1Z22A 2ALJA 2H63A 2O57A 2WJWA 4N3AA 4ZK2A 1E4EB 4MCJA 4WJZA 1NURA 4KQKA 2JLRA 1V7PC 3F6YA 4RJJA 5D86A 5LYJA 5FPTA 4C0AC 4D0RA 1QP7A 4HEQA 1RQPA 2BLLA 4FMCF 4QDJA 5TGDA 1PW5A 3VOBA 1G4AE 1Q1GA 2DM6A 3C85A 2HAEA 2GDZA 3CCCA 5THXA 4ZCIA 1CHDA 1W6UA 1XMSA 3K72B 4O8CA 3GLFA 3GFQA 4YCMA 2PZEA 5E3HA 3V4VB 5B3JC 4EB6A 4DRXA 2ZGVA 2X8WA 5AKIA 4CM4B 4V3CA 3JYLA 3QLUA 2J4FA 3IPCA 4P4GA 3GLIB 3N8KA 1JQKA 5DTEA 1F0KA 3IE0A 3ZDRA 3A6PC 1KAGA 1UZNA 2FE1A 2C1ZA 3GK3A 2ZYDA 3NT5A 4UDNA 5A05A 4EVIA 3H5OA 1D1QA 3E1SA 1LPNA 1UMCA 1X39A 3HADA 3O3OB 3QIAA 1I0IA 1EK5A 2I6GA 2ZDGA 3K2BA 4G5SA 5K3SA 1M0EA 4DWVA 1SIOA 2VPPA 3QWHA 3L4KA 3D3QA 1FL9A 4IDPA 4MIKA 4GMHA 1YBMA 4O1HA 4DQKA 3P52A 4EVQA 3QY9A 2Q5QA 5K0GA 1VKJA 3KQQA 4P3KA 3A2MA 1RP1A 1RBMA 3SX0A 1PE0A 4O2BB 3U3JA 2JFNA 1W2WB 4ATNA 1UC4B 2GVDC 2ECOA 2H9YA 5DCYA 4TSRA 2WVJA 1TJ5A 2J0UB 3N74A 1WY7A 2YJZA 4I4TA 3IILA 2Q4EA 3TQHA 3BWBA 1TECE 4H1TA 3H13A 3JQFC 4EY5A 4IIDA 3NCHA 3P2EA 4KAXA 2BFDA 3F6SA 3A6HA 5IBRA 4CMEA 2BI4A 5I3CA 5K4MA 1YR6A 2JFYA 3RD5A 3TIGA 2WWFA 3A6FA 3EFHA 2C92A 3QLTA 2GBFA 3TTVA 1VLVA 3LHDA 4AVYA 2YXDA 2BCJQ 3JD0A 4BVFA 2D54A 4C08A 2YOFA 2F1OA 3RTBA 4O1MA 3LC7O 3QGMA 3BL6A 3KYBA 1ZNZA 1BMQA 3C8ZA 3ZUGA 5JI2E 4YA6A 1SBTA 4C7MA 2D6FA 1F2UA 2J3LA 4E0BA 1NUAA 5LWQA 3SXPA 2QSUA 3FVRA 1E4YA 4LNHA 3AB3A 5E7IA 5IAGA 1ID8A 1QNLA 1V7ZA 1XK7A 1GGVA 3GCXA 1XEFA 3PQ2A 4EPXA 2PGJA 5KDOA 2C78A 2VAWA 1UWVA 1Z5OA 3DZCA 4MW2A 1CB7A 3BWXA 5DNAA 3QU7A 3V1YA 3DTVA 2XR1A 1T6YA 1E7MA 3MRXA 4C2TA 4K03A 3R7NA 2HD4A 4WAUA 1AOXA 1FU4A 1NQOA 1VB5A 4MVJF 1GQOA 2AEJA 4JQSA 5A04A 1C4KA 3F9IA 4RTSA 5U9CA 4MR8A 3EWSA 3JVDA 5EQDA 2BMDA 4M8LA 4LSGA 4PS0A 5EUBA 3OZDA 4RAOA 2JFXA 4IPTA 1A71A 2OG1A 2H85A 3AESA 2YJ6A 3DUWA 1FQKA 2HJRA 3DB1A 5E6UA 1S01A 2GTHA 2J0VA 5GY7A 3OU7A 4EEXA 5EUMA 1M5UA 2QLNA 4E46A 5FWYA 4DLLA 5CFNA 5U1PA 4J1TA 4ZDIA 1AUVA 1TAQA 3SHTA 2ERXA 1KDVA 3U3MA 3NALA 3DE7X 1I32A 3VR3D 4AKHA 2OAQ1 2ZJ2A 1Z5ZA 3RWMB 1K88A 5GQSA 3H1AA 4EYFA 4HTAA 2X8JA 4AWBA 4FR2A 3JD1A 3SGLA 5DXJA 1ZVVA 3RDPA 4ACAA 1UBMS 1P91A 3GB9A 1I0LA 1TIPA 5EWMB 5A4FS 2R6GA 4WESA 1M2FA 2GM5A 2O1WA 2ZYHA 3JQ6A 3OKPA 4BGEA 5AW4A 1ZGGA 1FXWA 2WTUA 4LI0A 3TF5A 4JQOA 3FPBA 1K89A 2CL7X 3W4IA 3VV2A 2XZPA 2P68A 1HYQA 5IJ9A 1G5FA 4MAFA 4R01A 1FP4A 1GPNA 2B37A 4ASUD 2VBIA 4ZEJA 1C7QA 2OD9A 4L0DA 2NZEA 4P58A 3SVLA 1T4CA 5TQVA 5KTPA 2FMTA 3ANMA 1PYDA 4W5JA 4XSVA 1X8HA 3JD4A 5CB8A 2V4MA 4OG2A 3V48A 2AX4A 3WLRA 4N47A 3ZX5A 4M0DA 4X7RA 1DNPA 4NK5A 2JZCA 1RAEA 1SOVA 1NLUA 1TJ4A 3CRW1 3FGOA 1IY2A 3EASA 1RPZA 3GRZA 3A1CA 3ZXSA 4KQGA 2DTEA 3E5HA 4DCGA 4FB4A 3C6MA 4LISA 1TUGA 2H52A 1AY0A 3IIEA 1LBSA 3CIOA 2YHUA 1Z2DA 4C7KA 4C1BA 3TB4A 1IY0A 3WWDA 2UUBB 4P92A 1K8QA 3WV5A 4OB8A 3GXBA 3IOCA 2JLCA 4IWXA 3QFHA 4HC4A 3WFIA 2HRBA 5EJMA 3SS8A 1OZ0A 4B6SA 2R6AA 3SF8B 2GMWA 4YCBA 1BH2A 1KFJB 2CFIA 4OBXA 5DHPA 4X65B 1YF3A 1MAHA 1HT3A 2ESRA 4MWOA 2AR7A 2H07A 2O2JA 1P5RA 1K4YA 5CH8A 2WU1A 4CEIA 4Z8YA 1N5MA 4C89A 1LY1A 5K99A 4UBOA 3SDBA 1RJ9A 1U8EA 3T9EA 2XVXA 4DIOA 2ORVA 5IDWA 2D1YA 2CJFA 1JU3A 1S0UA 1TQ8A 1X7XA 3LUPA 4HEHA 1M2WA 1NJ2A 1T4BA 1D2CA 1E59A 4PO1A 3IPRA 3L6BA 2VW8A 4Y9RA 4CM6A 3ACBA 3MIZA 4EGCB 1XDWA 2EJBA 3ZWFA 1ZC4A 3WYNA 3JWPA 1H6DA 1NWCA 2PY6A 5E2IA 4PWYA 1L5YA 1YHYA 1SU8A 3DKPA 3PQ5A 4II3A 2QNBA 1V9LA 2CMKA 4FYHA 1RJEA 2FB9A 1N6HA 1RRKA 1HDRA 1YJ5A 2IZ6A 1U7WA 3MF4A 4RXUA 3TMAA 4MUYA 2OESA 3I09A 5IZCA 1WMAA 3QXJA 3ZQ6A 4OV6B 3CISA 2BGTA 2ZUFA 1KU6A 5TMEA 2P2LA 4OJYA 4KRFA 1K5GA 1YQEA 2BFDB 1XXHB 3L04A 4KVZA 1GGKA 3O91A 4FZ5A 4O4IF 2ZVDA 3AJDA 4RPKA 3MUOA 1RWPA 1MQAA 1S5PA 2EGUA 2NUAB 2VWGA 4G67A 4YRJA 3TWOA 3PR3A 1LJ8A 4QFDA 2GZ1A 1AMUA 2YJNA 4B80A 4HPWA 2ZRBA 1PS8A 3LSTA 4MMZB 5HXAA 2GZAA 1CIJA 1JGTA 1YQGA 2B7LA 2NX2A 3KT3A 3I2YX 1XEXB 3TR5A 1S1MA 2DR2A 4O2BA 3ZDEA 1OXSC 3AP3A 1GPDG 4Q7EA 2HI0A 4YPFA 4B2IA 1N1EA 3PE3A 5TMBA 4MJXA 1JH8A 1W7AA 2WHEA 3AQIA 1FRVA 3EDRA 2E9SA 1PWEA 3NNDA 2YIJA 2QAGA 3MPOA 1AQUA 4UJ3A 4A8JC 1HR0B 4D9JA 2GEKA 4W8HA 3GELA 3HJBA 4LI3X 4RVUA 3VSCA 5DBIA 1S8OA 4ZAZA 1YB5A 2WF9A 5HEKA 2UZ4A 1GUAA 2OOKA 3TNYA 1ZGZA 1SIWA 2QRMA 1XRPA 2AOTB 3JQFA 3R6WA 5AI0A 2IUUA 3RASA 4ENTA 3HDHA 1X70A 4N5NA 2WFLB 1H1DA 3F2IA 4EF6A 5DYIA 3LAWA 2ZCVA 2W2LA 3QU5A 1P2SA 4RZXA 1PVOA 2IW1A 3RIMA 3L9WA 3OQIB 5A23A 4DLVA 2BI8A 2YZ2A 4NBUA 1P1JA 3M5WA 1CTQA 3DBVO 2XV1A 4IUCS 5LCFA 5HF8A 3QKRA 4G9GA 3RVMA 4BPRA 3PGMA 5F33A 1K98A 4WY2A 1UADA 2GNOA 3EQ2A 5HUQA 2IEZA 2C7QA 3MYRA 2ZUWA 3BERA 3DAPA 3JVUA 4QJ5A 3W04A 1XP8A 2CNWA 1NM5C 2FZ4A 1I9GA 3I04M 4KTTE 4NX2A 1GZSA 1DJQA 3I0VA 2G9VA 3ZNNA 3VGPA 5B36A 2A6PA 4HH1A 5JEEA 3BGDA 2O5VA 1ULSA 3UOAB 2QNRA 2ASEA 4CF4A 1P0PA 5IVHA 3PHCA 3W8NA 4K9KA 2OILA 4UWSB 3PC8C 1CYEA 3O3NB 3GH3A 2AB0A 2I0FA 3MILA 1R5NA 4NZMA 1FSSA 1H8HA 5CK5A 1RXUA 3EE6A 3G5LA 3T7KA 1M2VA 1V11A 2FGKA 1I24A 3SDSA 5CNKA 3MBIA 5HUJA 4V0RA 1R66A 4ZOLA 3LTNC 5A03A 4JLOA 3ZWOA 3AIMA 3C2QA 4HNAA 3ZE9A 3ABQB 1V1MA 2VDMB 3KEGA 3R7SA 4WXMA 2KW5A 4HDRA 4ZYTA 1L8OA 2HLHA 1VIMA 3EXIB 4HATA 4LXGA 5B37A 3VYRB 4BLRA 1MQ9A 1SHUX 3LK7A 4R8VA 2W2KB 1T5TA 2WJVA 3CF0A 1HTTA 2ADOA 3WB0A 3GLIE 3V2UA 1BU8A 2ZYTX 3ER9A 1YDHA 4DY4A 1Z62A 2IHKA 3ACDA 4H6PA 4IS2A 1RADA 2D1TA 4CM9D 2HSDA 3N0RA 3Q9NA 3NGMA 4L3OA 3NWPA 3IL2A 4NBSA 1QYCA 2Q5HA 5BSRA 1FUIA 2JI4A 2RGAA 4NU6A 2VJKA 4Q39A 2LKDA 1LNQA 4FFVA 3SS9X 2PMFA 3MT8A 3PGJA 2O1SA 1QG4A 2A9QA 3UA4A 4Q47A 4G1CA 2F4NA 4XB1A 3UJDA 2B5VA 1DBVO 5F21A 1DBPA 4K3UA 3KG2A 4A03A 5CX1B 2H57A 1Z8DA 4CF7A 5ESRA 3AHCA 1E3TA 1QAOA 1JXAA 4CG2A 1WCIB 1WUYA 1BXGB 2CNKA 1P7VA 1P4SA 1Y3DE 3MGKA 2MSLA 2YHIA 4NLLA 4DC9A 4Q1FA 1DG3A 2YNWA 1Z7YA 2MOKA 1F2TA 2XE6A 1VMAA 1A4RA 1SXHA 1JHZA 1NJGA 3EPPA 3ZVRA 4BZZA 2R0QC 4FFBA 1AV6A 5ENVA 1QG6A 3N2GA 2HLDD 3PITA 4EVSA 2AXNA 4A10A 3AHIA 5EHNA 3ZQKA 1VPLA 1KQFA 1OFUA 3AR2A 3E8SA 4TTRA 5M3BA 3KRTA 4TRNA 1CUVA 2VBFA 2IYWA 3TVTA 4E2FA 2OGWA 1ECBA 4HRVA 1RXIA 3USZA 1ABFA 3V80A 4CV3A 4ZGWA 4B9AA 2X15A 3I28A 4KPGA 3HM9A 2Z6AA 5FKJA 5IAEA 3U3KA 5IS2A 3EDQA 1FP7A 4WL0A 1EAMA 4H08A 4IZHA 2AJBA 3CX4A 4B84A 4F5YA 1U31A 4PFKA 4KIFA 2QRJA 4FYIA 4NOMA 4PYOA 5AW5A 4KQHA 4QGGA 3DAHA 3PUHA 1NLFA 5KJFA 3K70B 4TZKA 2FVXA 3IC5A 5ALTA 5LMZA 3FSGA 1WETA 4OOFA 5HCIA 2O7VA 4Q9HA 5A06A 3RIYA 3QVXA 2WTEA 3AI3A 4URZR 2Y87A 3E8MA 1P9OA 2HB6A 3L7DA 4CTMA 1HTWA 4RETA 2FU5C 3AOGA 4GF5A 4RJ2A 4XVHA 3L8MA 4AK9A 2QDTA 3DUFB 2WW8A 4O0MA 4OQXA 3MAAC 2HMYB 4QULA 4XH9B 2WUDA 1FSPA 4O8ZA 3W2EA 4CEIB 1MABB 3EXHC 2V7WA 1NASA 1UKCA 3PEWA 1MAWA 1N2CA 3M2PA 4X24A 3ZVNA 3AF3A 1Z0FA 4C4RA 3VTFA 3WRWA 4EELA 2EZUA 1U0HC 1GIAA 2E4XA 2QXUA 4A2CA 4IDAA 1U5AA 4R1SA 3HABA 4WOCA 2QJSA 1G7RA 3AR5A 2BZ0A 3C6KA 1MT0A 4F3TA 4TMVA 2CF5A 1HKHA 2FMIA 1OV6A 1VI6A 2QRUA 2WU8A 1HYEA 3EXG1 3QVJA 4B73A 5KZMB 1JI0A 2I6UA 1XG5A 3KHKA 1F06A 3C70A 3D7NA 3PR2B 1Q0LA 3N07A 5BN4A 4U7FA 2SCUB 4WERA 2QUHA 3LYHA 1QV7A 4XIGS 1XOIA 3BCRA 1Q57A 3AP1A 1C4OA 1GGNA 5ADHA 3EMBA 4PLGA 3H5NA 3TR0A 4XAQA 2YNMA 5A2GA 1B23P 1RPNA 1R16A 3KEFA 2CV2A 3UC5A 4JJ6A 1FP2A 1GG8A 1PFKA 3K9LA 3BS4A 4TTAA 5CVDA 2VNKA 1JHMA 1A4UA 1EP3B 4QATA 1T2AA 1V9SA 2IYUA 4NOLA 1I80A 1G8SA 4G0ZA 3OMXA 5FLXA 1AXGA 2EYQA 3PFGA 3GGJA 4NJEA 5FPHA 5SY9A 3T7RA 4DF3A 5DNUA 5BSEA 3AUAA 4NOJA 4BO6A 1EVLA 2X0DA 1OLXB 2PQ0A 1AZWA 1DP4A 4AMYA 3GLQA 1TFRA 4Q5IA 1QK3A 5EJIA 3DOIA 4G65A 2BN4A 5E4TA 3QX3A 4J1SA 4MR7B 1XJCA 3N3BC 1Q5PA 1DG9A 3BK1A 1BNCA 1CQJB 1PUXA 1E1RA 2BLNA 1F8UA 5TT1A 2Z0MA 2O8FB 1WEHA 2RI0A 3AWDA 4R6WA 2D8AA 5EJFA 2JD0A 2JAUA 4X97A 4C0BA 3QUCA 3ZBQA 3R41A 3I04A 3HWWA 1K7YA 1GEGA 3KWJA 4HNTA 2PCJA 4Y9DA 5M2QA 4GVPA 4OAOA 1N1DA 3Q41A 1XK6A 1DT3A 1TE2A 2D1RA 2PKWA 5JQGA 1MQOA 5FPSA 2J3DA 1BVTA 2IY9A 3LXXA 4FR0A 4Y67A 4WXPA 5T4HA 2OXIA 2VDJA 2XUGA 4BZWA 3ZDZB 1R0RE 2EJCA 5C7YA 4NG4A 1LI7A 4FZVA 3GVHA 3DGEC 2XCSB 3I6IA 3EEOA 1J1UA 3WL5A 4F9GA 1V8DA 2FEMA 4KEAA 3GIDA 1BOOA 1T3LA 4R2HA 1FX1A 1PZMA 1H2HA 1Z2OX 4B3IA 1SBYA 4N6GA 4WZBE 4DIUA 5BSWA 2MSDB 2QX6A 3NYQA 1YK0A 2FFRA 4AMBA 1VIYA 3PUWA 3UBMA 2UU9B 5ACWA 4B8ZA 4JELA 1Y7TA 4D3YA 2O14A 3FR7A 4WKPA 4KDEA 1HRKA 3Q8WA 4WCFC 4F86A 5IASA 3TXYA 2C5FA 3L7IA 1GXSA 2AC7A 2VP0A 2QTRA 3M5PA 5CX1A 4E1VA 1O0BA 2QL6A 4BUCA 4OKNA 3QVGB 2EARA 1E2HA 1NBME 2ST1A 3E9DA 2EZTA 1V7CA 3OKAA 4Q1EA 3AEUB 1WOYA 3ROGA 421PA 1MJFA 1XCOA 5ED0A 2BEUB 1Q84A 1WMFA 3QELB 2JEYA 2QRKA 3R44A 4IHQA 1MZVA 2WIJA 1LLFA 3E4DA 5H3LA 4E14A 4DJTA 4LYFA 5AUNB 1THTA 4V0QA 4B6RA 3NORA 3TIIA 3U4QA 4GC9A 1X1BA 2AXQA 1EFRA 3QFRA 2F3TA 1F4PA 2OYSA 2XDWA 4KITB 3OHPA 5EIBD 3MNFA 4H1WA 1KSGA 5LP6F 2J3IA 4C87A 4LJ9A 4UBQA 4XFDA 3KVRA 3NNSA 4M1WA 1JIJA 3LF1A 4Z54A 3MGCA 4B81A 2C9MA 4M6WA 3L0OA 4MCHA 3I6MA 4M8IA 4K9QA 3AY3A 2ZUCA 3GMTA 5G4KA 5HM6A 3U3XA 4V1CB 4WOBA 1ABEA 1JBEA 3OAAD 4AQ7A 1GLGA 4DN6A 4MUEA 2ZRFA 2I2AA 1F9EA 1XZHA 1H2YA 2FFHA 1R8SA 3F6BX 3LRXA 4E94A 3X2FA 1U8TA 3KYCA 4NH4A 4BVLA 1YUMA 4PGAA 5IM4F 3KTFA 3QNUA 2OO5A 4NYJQ 4EFZA 2XI4A 3AXSA 1Z5UA 5FR1A 2YMMA 3II6X 4B2PA 5L3VA 4ABTA 1R4MB 4G1MB 4E7PA 4LX8A 3SEQA 1ZSYA 4EB0A 4MQFA 2GKLA 2REOA 1LF0A 3FIUA 1T8TA 4ZA2A 1SFRA 3NEJA 1H2XA 3SM9A 3NT4A 3ZHBA 3MJSA 1KJJA 4J3NA 3VMMA 1IONA 1S3IA 3OZFA 1ACMA 4J07A 3Q3IA 4I36A 5B3AA 4ZCMA 4ZJUA 3RHFA 2XMGA 2UXBB 3LO5A 1ZA1A 3BPSA 2HY7A 1A7JA 3EUEA 3W4JA 4B46A 4IJWA 1E2FA 4R16A 4YV7A 4A8HA 8ADHA 4J6FA 1G2PA 2PG3A 1T1SA 3JCZA 2UYQA 3AUTA 4N5LA 4FFPA 5AM0A 1E7YA 3AI2A 2R6CA 2XTMA 3BQNB 1XRNA 1T0IA 4K9RA 4JLPA 2G07A 2IYZA 4NMMA 1K3UB 3MA0A 3QI7A 2Q6OA 4PY2A 3WHIA 3N75A 3HP4A 4KPEC 4F06A 5TPWA 2EFCB 5FWXA 2VHQA 2ZR8A 4C6HA 4O63O 1F14A 3B89A 2PUCA 1UPXA 3VSBA 2Q45A 4EB3A 5DTIA 5JJCA 3UPUA 5IVKA 1XLUA 3LOQA 4G09A 4ZAYA 3SLGA 5AUPB 1M10A 3B1KA 3QPVA 4KRGA 3CPJB 1N0HA 2QVLA 4PBTA 3AF5A 3ENZA 5CK4A 5F77A 1ZX1A 1C1HA 5AVRA 4NJMA 4KBFA 5IULC 5EE5B 5WRFA 2O54A 3AHEA 4X61A 2D1QA 5AK5A 3LQQA 3P9XA 4HUJA 4EXYA 4PG7A 1Q0TA 4NBVA 4EAQA 3CA8A 1XCJA 4HFNA 1HLFA 2SKDA 2OGSA 1W1UA 3AV0B 1YQQA 3WLIA 4H7JA 4ARAA 1EB9A 2HU2A 2PZMA 4I4NA 4P35A 2IX3A 1WDKA 3I1FA 4RTPA 3AM5A 4ZMSA 3U4AA 5TC4A 4I1SA 2Q4RA 2FOXA 3COPA 1NAHA 3NP9A 4QVIA 1QOQB 3G7UA 1U1CA 1M8FA 1WVGA 2RARA 1L4NA 1L0BA 1D2HA 1ADYA 3KUUA 4I0WB 4A8TA 3V5NA 2V96A 4C88A 2QX8A 4NYJR 2IUSA 4W9NA 2V55B 3WK7A 4CL3A 4RE5A 1UOEA 4KXVA 5EMMA 3CH5A 3DHVA 3M3DA 1XRMA 7MDHA 3IHKA 1X7GA 1L9XA 2PT5A 2ZYRA 3GJRA 5KVVA 3SJUA 1IN7A 1KFEB 1N6LA 2O2YA 2QTBA 3H2BA 4C4YA 4YUWA 1RAAA 2OLEA 5KWSA 2CVPA 1FW6A 4RBSA 2OMEA 1EJBA 5K0JA 3AETB 1G5QA 5L4LA 4QU5A 2C98A 3LL7A 3IDZA 4KL8S 3P4XA 2W6QA 5KTRA 2E6UX 1DKMA 2QRZA 2CUNA 4YAEA 5BPFA 5FA5A 2BMWA 2WSLA 1UFVA 3NX4A 4RMJA 5B1HA 4R51A 3UAGA 1X2EA 7GPBA 4D3FA 1ZU4A 4EFNA 1IC6A 1L7QA 1SUPA 1E2GA 2OB2A 3E70C 1AURA 3BN3A 4LUCA 5IABA 5F2NA 3X1DA 1YIDA 2YNVB 1FYVA 1W581 4QVGA 1RFLA 3TLBA 3GLGE 4EYLA 2B69A 1JH9A 2FEXA 4DB2A 1D1SA 1NF3A 1ZMTA 3KS9A 2QENA 2R1VB 5P8WA 3IQIX 4BN5A 5ESDA 1L7OA 3UKDA 1YWGO 3I01M 4Z2YA 2O7QA 1OLSA 3K4PA 4C1DA 5FR2A 1M1NA 3CZ9A 3CUUA 4FVTA 3QTBA 5IMSA 1OVMA 4RFVA 4GL4A 2JFFA 5G0TA 4LSMA 4JBGA 1ZITA 1X9IA 5T4BA 2XTJA 2G67A 5TVKA 3T3EA 3ZN2A 4P32A 1XLTC 2G40A 4BVAA 4ALLA 3VOTA 4RD4A 5LQRA 1FA9A 4EB8A 5DULA 1CS0A 1KXZA 1MOZA 1XHLA 4U6QA 5GADl 1NBEA 2XYGA 3HCNA 3M7IA 1CQIB 4X66B 1QNFA 3Q85A 2BKEA 2CD7A 2A9OA 2JZNA 1MGOA 2PIAA 4P3XA 5EWJA 3ZY5A 5BNFA 4EIWA 3S5JA 1YA6A 4K9SA 3LHIA 3AINA 3V9PA 3WLAA 2WSMA 3Q3GE 5C3MA 4OJMX 2XRFA 4BQPA 1U63A 5A3JA 4AY6A 4JWTA 1NP3A 2GKGA 2JLXA 1AZTA 3IEPA 3E0QA 3U7GA 3SHQA 4LDZA 3BMOB 4DCPA 4R8SA 5HJ5A 4DV0B 5DXAA 4LQLA 5TMDA 3Q72A 4BO7A 4IV5A 4ARZA 3IXLA 3CLRD 2PD3A 2O8CA 3C1OA 2CXXA 4O4JA 3KM0A 4IIGA 2QE7A 3VC7A 4BMZA 3CX6A 4L85A 4LWPA 1Q7TA 5L7YA 5CEJA 4G5FA 1A9PA 2AKEA 3O4JA 5D5HA 3UMBA 2AJCA 5KYKA 5JZOA 1XTQA 5HFAA 1EX7A 4PFSA 5JS2A 1OOEA 2PMBA 4EF5A 4IKPA 4PAOA 2C00A 4MQ5A 4PANA 3B70A 4YJ2F 1WSBA 4I9UA 5IAJA 1E6UA 2WT9A 2RJ3A 3COWA 4P81A 3ROPA 1WNFA 3TSWA 4Z4GA 3U2QA 2QLLA 4NZYA 3SQMA 5C7IO 3WGGA 4CMIB 2P1ZA 3WVNA 2HRQA 1LDBA 5DCLA 3UCXA 1ZCJA 1CEXA 1WXQA 1C8LA 2V4ZA 2DSNA 4PN3A 2J31A 5LZ8A 3BAFA 5AHKA 2AZTA 4RY0A 1QQBA 1G63A 2WF8A 5DIZA 3NCTA 3Q5EA 4QL3A 1EJ2A 1UWCA 1CE8A 2AOUB 3K6SB 5KVQA 4OLAA 3NUQA 4AX0B 2IYRA 3S8EA 1T8UA 1Z4IA 2AUMA 1T26A 2Z5GA 1OZAA 5AKEA 4D1TA 4ZFNA 4LE1A 1JI3A 1IQUA 1PJSA 2O3TA 3TM4A 5AM1A 1N1MA 2QYSA 4RM3A 3BWMA 1XVIA 4I5EA 4J0KA 5FUYA 3FMFA 4Q82A 2QM7A 1KEVA 2GFIA 5HUHA 3BQMB 2AN1A 4R3WA 3OEYA 4NAHA 5KI6A 4AYWA 1CJMA 2FR8C 1JAIA 1ADFA 2Q6IA 5KTYA 2XXJA 3GU3A 1MR3F 2V7UA 1GQRA 4JYMA 3H2SA 3WS7A 5B3LA 1GNVA 2VC2B 4B47A 3CVXA 4RMIA 4WX2B 4K81B 1CJUC 1F0YA 1Q50A 3QPUA 4AKTA 3KYCB 3M4XA 3TRHA 3OLWA 2YNMC 4IXDA 5EZ6B 2F8TA 1NXOA 1NV8A 3RSOA 5ACPA 5B57C 4TTJA 5DMXA 2V0CA 3HVIA 1K92A 2AYZA 2DR3A 3NFYA 2ODTX 1KBQA 2Q99A 2EP5A 2AFRA 4FSHA 4MO2A 5HBGA 1XHEA 3ONDA 4J1TC 5F4ZA 1H0KA 4OH7A 3M34A 2H5EA 1YB7A 2B4YA 2Q5FA 2QE6A 2YIMA 5DHRA 5F12A 3VPHA 3WLMA 4ANFA 5KQMA 3D2LA 1Z08A 1NSFA 1FJHA 3DS8A 4PAQA 5KNDD 2R8YA 2ECKA 1N2IA 1WBDA 4C1GA 1QPBA 3AUXA 4J75A 5B1DA 1ZRMA 3HVJA 2PR7A 2R751 3WNVA 4A8PA 4J76A 3EGDB 4I8XA 4ZVNA 3AUYA 1QHXA 1X7YB 4PBSA 3PRKE 1T3TA 4NCIA 5J2UF 1PQUA 3UJCA 3AEQB 3REOA 1QRSA 3ZWKA 1OLUA 5ALWA 2Z4SA 4MDFA 3FFTA 3W9SA 1GTZA 1THZA 5F1PA 4KREA 1XJQA 2A0UA 1KZ6A 4WFJA 3UTDA 3VH3A 3VTAA 1KAEA 2PXCA 4C21A 4ZEMA 1A9QA 2VAXA 4X41A 2C4MA 2KLHA 1QIDA 1MJGA 1QVZA 3L7CA 4N65A 4TYYA 3HA5A 4HPJB 2FPRA 3AVVA 1DELA 1P7ZA 1LW6E 1PL7A 4YJDA 4HDSB 1KRXA 3LVZA 2AWNA 3QVKA 2WM9B 1MU0A 3O4FA 2YYYA 3WMWA 2F9MA 1GPYA 2X5XA 3Q12A 1JAXA 4Z4IA 4DEYA 3AOEC 4K9NA 2ZXEA 4RESA 3I05A 1IULA 4XE5A 2P6NA 1FFBA 2X2EA 3RYIB 3G7NA 3GVPA 3HA3A 4BQSA 4HI0E 3WK6A 1RYNA 1YS2X 2MIIA 3G6KA 1LC0A 3DONA 3UK0A 3FB4A 3J7AC 1M2XA 2PUFA 2BYTA 1GKUB 3T3HA 4DW8A 3K6JA 2E5LB 2VK2A 2H4ZA 3R3VA 1I1QB 3P71T 4OFXA 1TYEB 2JGDB 2W2PA 4W8OA 4ERNA 5J47A 1Y6RA 1H9CA 4PLFA 4UTPA 1J39A 3KQNA 2EC5A 5A6SA 3FSJX 3HEMA 5I3ZA 2ZLBA 1DQNA 2BH2A 1ZHOA 3AEYA 1AN9A 1KKUA 1WVMA 1F6WA 16PKA 2FQWA 2X5JO 1IMJA 1OXUA 3H5WA 2OBXA 3LW8A 3NEAA 3P9NA 3TCXB 2PWYA 4IQ0A 1SKYE 1CT9A 2NXCA 4HZUA 1UQRA 4KYUA 4MP6A 4TYMA 5AWFC 4PYRA 1PZFA 2YBEA 1W34A 3CKKA 2HM7A 3UAXA 3O1IC 3WDSA 2OCIA 1DEKA 1IQPA 2OK8A 2X9GA 4KQFA 5BW5A 3BDIA 1N77A 2NQTA 1EGMB 4FXPA 2XITA 3WXMA 2NP6A 2LD4A 4ER5A 3G59A 1L4FA 1DT5A 1QDLB 2FV8A 2P9GA 3D7SA 3CKYA 3ZR9A 1OA0A 3P0FA 4BUZA 3LDAA 5BSHA 4X5OA 1A7TA 1A5TA 1F8FA 1SVLA 3I15A 3GFFA 1JR3A 2I66A 1QB8A 2HPAA 3E5NA 4O02B 3UCEA 3ZWVA 2HA6A 1Z4OA 3A1DA 1O58A 4YP1A 4DNFA 3FJ1A 3GVXA 3RKRA 3H2YA 2B98A 4S2UA 1TW3A 4IWNA 3RT1A 5KIAA 2D7DA 3Q15C 4L8WB 1Z28A 4REOA 4Y2SA 4JL8A 3ZZNA 1MA0A 1N2GA 5JAMA 2BP7A 3X2XA 2XMQA 2J9YB 1PFUA 2H2GA 4S1PA 1DLJA 5AI4A 1PVDA 3J80A 2QUJA 4KWCA 5CM9C 2QRQA 3T35A 1UDXA 1O0SA 3MGAA 1UK8A 4FEAA 3V42A 4NPAA 2NAFA 4D4LA 3SG0A 2A0FA 1WPRA 3PT5A 2JEZA 3ZHXA 4M0UA 3RC7A 5CURA 5KX5F 2DU8A 4G89A 2AFHB 1W5BA 3A11A 1MDFA 1NW8A 1HQKA 1CK4A 1ZIDA 3QTLA 5CUQA 3STWA 4BKQA 3BRWA 1Y1QA 2VHUA 3PNPA 4AMVA 3KEQA 2X1VA 4GBMA 3SLRA 4YAOA 4S04A 4WD6A 1M34B 1XWIA 1JDPA 2C7GA 3DVLA 3NM5A 4JB8A 3SBOA 3DXYA 4YRGA 6ABPA 3IUYA 3FUCA 2A4MA 1E7QA 4XPIB 5HOQA 2F62A 1OD6A 4RKFA 1SEVA 2V4UA 3DD1A 3G02A 5KEIA 1FXSA 2V5AA 4POOA 3KD3A 3WL4A 4YXWD 1AKMA 2Q3BA 2WM3A 3BGWA 1KZ7B 3VNAA 3T9AA 4X6LA 5EJ9A 3HUDA 3IESA 1E6MA 1RQNA 1T2EA 2ZS9A 2CG3A 3V8MA 3H1EA 3B12A 4JVNA 2R85A 3RRYA 3Q2IA 3TXXA 2C4VA 3ADDA 4C1CA 2XWQA 2XBMA 3T52A 3WADA 1MVOA 3GMDA 1FC0A 3EF0A 3CRQA 3DM9B 1V1RA 2I4NA 2UZ1A 4F3KA 3W05A 3IBYA 4TT8A 3NHWA 3NHKA 4TLEA 4CF6A 1XZIA 2B20A 2GEJA 2I7CA 3O4VA 1SOUA 3GDWA 2B94A 2HO4A 1M1YE 4DA0A 1XALA 2XGSA 2OCPA 5LFAA 3F9OA 1JEQA 2Z1DA 4NZNA 4OXRA 3B5JA 1AUPA 4J03A 2GB4A 5IX8A 4I55A 4OI2A 3VH2A 3WGJA 3OUUA 2FR8A 2AFIB 5KVAA 2WTXA 2FZEA 2PSFA 4HEA1 4WZ6A 4KO1S 8LDHA 1PJTA 2FFBA 1YI1A 5CXXA 3RFXA 1M75A 2KB0A 4BP9A 1N78A 3REFA 1QS0A 1PUIA 3U40A 1Z8NA 4NCBA 4MI9A 2VFAA 1U8UA 2A9VA 4Z9AA 2W6PA 3CWZA 3QE2A 1TGVA 4C7BA 2ZTSA 4MKHA 5JQGB 1Z6XA 4NBTA 2XB8A 5DBOA 1Q2XA 2ICAA 2H9IA 1EJ0A 1Q77A 2HRZA 2XT6A 3MRSA 4DWWA 2FWAA 1FYFA 1C3VA 1IZ0A 3WYCA 3DHNA 1GUYA 2BP7B 3THXB 2B83A 4D4HA 1N2ZA 3RGGA 1PWHA 2IOFA 5EE0A 5KYUA 4L22A 5FEUA 5ALXA 4PHHA 4EUHA 4ZK6A 1VJNA 1SCQA 2R4UA 3CVUA 3CCFA 4AJOA 4GYWA 2IPOA 1U2DC 2WV7A 2BE9A 3T95A 3WGHA 4RIIA 2IDKA 2X8JB 5ALLA 4FHGA 1A5ZA 1EXWA 4KUGA 1QO0D 3UY4A 1K4KA 4IO0A 2VQFB 2FJ0A 3SHFA 1RI1A 4AIRA 3RPEA 4DYHA 5K6TA 3QMPA 1ZIOA 2ZJ6A 5HNKA 1FBNA 1L5WA 2CXRA 3JATA 4CMAA 3FAKA 5A4KA 3OX3A 4GAEA 3IVRA 1TF5A 4IHAA 3IUSA 3O38A 1H9AA 3PT9A 1YQ9A 4NDNE 4AYXA 3EB9A 2QY6A 3TN7A 1H0RA 2IIPA 3CNNA 3I3SR 4L4RA 5H4HA 2K7ZA 3DR5A 4LAFA 4TTSA 2CDCA 5F2EA 4KPFC 4XWWA 2DUUA 3TOSA 5F2OA 4FSBA 1SOWA 4JSYA 1YZNA 4UTXA 1R6VA 5IM5A 1K8RA 4A0RA 2GPSA 1ZICA 2H0RA 2NNLD 2ZBGA 3TMKA 2P0YA 2NM0A 4D0NA 2H2AA 2WKQA 3R24A 2QWXA 5TB5A 2H0QA 5ALQA 2P4UA 4CEJA 1VL8A 1KH2A 1NDUA 1C7IA 2VYVD 3HY6A 2XIQA 1NPDA 5B12A 3IMGA 4BNFA 5IJZA 4QOJA 3JZDA 1Z5WA 4LWZA 2XZLA 5BQ3A 4FT2A 4IW3B 2JLWA 1H2WA 2RHTA 5EN4A 4MUMA 1W0JD 1Y37A 3P5BA 2WBLC 4Y2VA 1E9SA 2MYPA 3EEBA 4BP3A 3SKVA 3U80A 5DLQC 4CUKA 1SJ9A 2OM6A 1Q16A 3FTNA 1I5EA 1ZBDA 1Z37A 3CEMA 1A8UA 4UM5A 4C30A 4IGEA 4B7XA 2OO5C 3PWTA 3R9KA 1RPTA 3EMKA 4BFZA 3FPCA 4M0LA 4EL0A 1EK2A 2H1SA 3FYUB 3L7LA 5JH7A 2FK6A 3C98A 1DEOA 1J0AA 1WEKA 4W1SA 4LXQA 4ZYLA 1S89A 2JJ2A 5FLKA 2O8EB 2CVQA 2X77A 4LMPA 4U7PB 4XXHA 3TINA 5B7PA 5BT8A 1IVSA 4YJ2A 3DQPA 1D03A 1KYTA 1ESCA 3PGXA 2HK8A 3KDSE 4ZEWA 3JQPA 1CERA 1UPUA 3KJQA 1ABBA 3NRJA 1IY9A 1CZNA 5FTMA 3CO5A 1DS6A 2IQ5A 3L6NA 1YE8A 3O8CA 2X0JA 3O03A 1TF2A 4DAEA 4F6CA 3HKEB 1UPAA 2ZB7A 1K1EA 1XB2A 2IHBA 3AESB 5DM70 2ATVA 5MFZA 1IPEA 2HZ7A 3SQNA 5LQSA 1J42A 1U1FA 2VP9A 2O7NA 3C5WP 3JTEA 4E30A 1JLMA 3OA2A 4KYTA 5KTKA 1CY2A 2HZBA 2LV8A 3U39A 2R8PA 1ISRA 3KYDA 3OOHA 4FHCA 4O4LF 4DIKA 2O8DA 1E62A 4D6YA 1N8SA 1FLVA 2ZRPA 4TTIA 5B58C 4NJOA 4OQQA 2BZGA 3VOAA 4AXXA 4QUDA 3OPNA 4G5QA 5IYZA 4RHEA 4FFBB 4FMBB 2GPYA 5JNTA 3MPUA 3UG7A 4CV2A 1FUYB 4G97A 4HLCA 1A9XA 3ELWA 1KOLA 3VM6A 1O95C 3L8ZA 5KQLA 1NNUA 2GO7A 3R3XA 1FDVA 2AFIE 1U7DA 2YHIB 1A96A 3KR2A 2OBMA 1V5FA 4A0FA 5CJ2A 1D7AA 4ZP1A 1T9ZA 1E9RA 2Q21A 5IT9A 3I9OA 3LJKA 3FY4A 1XM8A 4DSNA 2ZULA 4PHFA 3WLSA 1SRRA 2CD9A 1BFUA 2XXAB 4AQDA 4ES6A 1G4UR 1CR1A 4GUDA 2AJLI 3AVTA 3MWEA 3GGPA 5LA6A 2C2GA 1SOMA 3M4YA 1LSUA 4EENA 1T8YA 2JGNA 2PUVA 4I1PA 4UFNA 2P97A 1FFEA 3U44A 2ZUSA 2CF6A 2VCYA 2VRCD 2WTNA 3FPKA 5EZ5A 3TD9A