2Q9UA

Crystal structure of the flavodiiron protein from giardia intestinalis
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
409
structure length
409
Chain Sequence
b'KPKYVQDQEMIPGVYWVGIVDWMVRIFHGYHTDEGSSYNSYFIDDECPTVIDSVKYPFAEEWLSRIAACCPLDKIKYVVMNHAEGDHASSLKDHYHKFTNATFVCTKKCQEHLKILYGMEKATWLIVDDKYTLKIGKRTLKFIPVPLLHWPDSTFTYCPEDKILFSNDGFGQHYATSRRWADECDVSHVMHLFKEYTANILGLFSAQMRKALEVASTVEIKYILSAHGVSWRGDAMGLAIAEYDRWSKGQHCQKKVTVVLDSMYGTTHRMALALLDGARSTGCETVLLEMTSSDITKVALHTYDSGAVAFASPTLNNTMMPSVAAALNYVRGLTLIKGKPAFAFGAFGWSNRAVPDIVAELRDGCKADVYDEKGITFKFNYTEELLEQAYNAGVDLGKRAIAYCEKNAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords A-type flavoprotein
publication title The O2-scavenging flavodiiron protein in the human parasite Giardia intestinalis
pubmed doi rcsb
source organism Giardia intestinalis
molecule tags Oxidoreductase
total genus 157
structure length 409
sequence length 409
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2q9uA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2q9uA01
1B1CA 3IE0A 1XI2A 4LTMA 1SQSA 3DHBA 1VGNA 5HIQA 4HS4A 3NHWA 1CZHA 5LBTA 3B6IA 3S2YA 1SMLA 2AMJA 5AYAA 3D7NA 1FVXA 4N82A 3GFRA 1DDKA 2A7MA 2QEDA 4C1EA 4Y9UA 2BG8A 2RG1A 1ZWLA 1J9EA 1WUOA 2E7YA 5EVBA 3SBLA 1KR3A 2FZVA 1SG0A 4GR9A 4AX0B 1FTGA 2XR1A 4D1WA 1XM8A 2Z9CA 5AHRA 1AKUA 4C1GA 2WC1A 3ZNBA 1ZKPA 2WYLA 5B1UA 3DH8A 1FLVA 4CHLA 3NHKA 5HH5A 1NNI1 5B3RA 1VMEA 2H6AA 3QE2A 5AXOA 4EFZA 1RLJA 3SRXA 3ADRA 3O2NA 1YKGA 6NULA 3NFRA 1AKQA 4DILA 5KILA 4EYBA 2Q62A 2P1EA 4CF6A 3X2XA 4HEQA 1YCHA 3R6WA 3L9XA 4H2DA 4RL0A 3IELA 3JXPA 1XYVA 1AZLA 3N3AC 2CBNA 3IDZA 5EV6A 2P97A 1JA0A 4YALA 3SD9A 1KO3A 2WRSA 2OHHA 1CZOA 5EWAA 1TIKA 1QR2A 2BPOA 5EA2A 1WSBA 4DIKA 1K07A 5FA6A 3FNIA 5F51A 3QFRA 4YQEA 4GI5A 3QH8A 1QH3A 1FLNA 1FLDA 5K4MA 1ZTCA 2YCBA 5KIKA 4F8YA 2N1MA 3BV6A 5A0VA 1WUPA 5K4NA 5LM6A 4J8PA 4D1UA 1JT1A 3FW1A 4Z6XA 2I7TA 1X8HA 4YAWA 2FK6A 1I1OA 2MWMA 3LCMA 4ICIA 2Y8AA 5ACUA 4HL1A 4Z67A 4DY4A 3B6KA 4B87A 2QMZA 4NQ6A 4AX1B 4BZ3A 3P0RA 2FHXB 2Q0IA 5DPXA 4OXXA 3ZWFA 5EVKA 4H6PA 3F9OA 3F90A 3G1PA 4UWOB 4UWPB 2OHIA 5ACXA 2VW8A 5LBUA 4FGKA 4C0XA 4GYQA 3TEMA 5ACRA 2FX2A 4C0WA 2V9CA 1HLKA 3R2UA 1AMOA 4J5FA 5F12A 4C09A 1E5DA 2F1OA 1RTTA 2Z9BA 3NHSA 3NHPA 2BG8B 1XYYA 1WW1A 3QFCA 1A7TA 4ZO3A 1V4BA 1FUEA 1KBQA 1DD6A 4U7HA 3I0VA 2ZZIA 5A0TA 3BC2A 3TZBA 4CETA 4QOHA 1QHEA 5FX2A 4ZVKA 4PU0A 3SPUA 3W79A 3ES9A 3AF5A 3X2ZA 3P2UA 3UXHA 2DKFA 2BMIA 5K4KA 5A5ZA 3WXCA 5ACSA 3ESYA 3BK1A 3HLYA 2FU8A 2YZ3A 2GMNA 2HNBA 5LJIA 3K20A 1X8IA 4ZO2A 3IOFA 2QDSA 3NHUA 2FVXA 4LA4A 4EYLA 5LE1A 5LS3A 5ACQA 1YDGA 4LE6A 4UA4A 4UAMA 2BMVA 3GAMA 1DXKA 3SW3A 4QOIA 3OVMA 1J8QA 2OHJA 1DX9A 3T3NA 2FAXA 5HIPA 3ZR9A 3ESZA 4PVTA 4ZVNA 1BVTA 1JJEA 1JA1A 2FCRA 2BZSA 3K1YA 1WRAA 1AKRA 2YNUA 1YOBA 1TLLA 1X77A 3U7IA 4Z5ZA 5TGZA 2YNVA 4QOFA 2BGAA 4N65A 2R2DA 3PG4A 3A4YA 1GG5A 3X30A 3ESHA 3I13A 4Z7RA 4C1CA 1XTOA 4AWZA 4UWRB 2XOEA 2XODA 1JJTA 1OBOA 3T9MA 1T0IA 5EH9A 4N9QA 4BMOB 2MT9A 3MD7A 4PTZA 4TZ9A 2MOKA 1ZNBA 2FU7A 4FGJA 5LMCA 1CZLA 3DHAA 3JSXA 2ARKA 1AKTA 4YAOA 1X8GA 3FAIA 3OJWA 2GCUA 4YAFA 5IQKA 2GSWA 3L9WA 3IE1A 1YCFA 1WSWA 4BMPB 3KLBA 1M2XA 3LVZA 2BG6A 2NYPA 2Q0JA 4EYFA 4QOGA 1ZWKA 4C1DA 1YCGA 5NLLA 2QX4A 4O98A 2I7VA 3LT5A 2ZO4A 5FUQA 5LVAA 2NXAA 2FOXA 3FCZA 4H0DA 1CZRA 4M0CA 5LCFA 3OWXA 2BG2A 3W77A 3ESXA 4GYUA 2BF4A 4GCWA 2XF4A 3IEKA 5K0WA 1AKWA 2Z98A 5A87A 2UYXA 4TYFA 3NHYA 4YSLA 3PY5A 3RKKA 5AXRA 3ZHOA 4LTDA 4QODA 5AEBA 4AD9A 2Q42A 1AHNA 4RAMA 4YSKA 3KAQA 4C14A 1D4AA 4NLLA 3RPEA 1P9EA 2ZWRA 3F2VA 3TE7A 3GFSA 3IOGA 4D1VA 2M6RA 4YAUA 4U4LA 3RPCA 3KL7A 2I7XA 3F6RA 4XDHA 2BFZA 3GFQA 5FQBA 4EXYA 2FDXA 2QINA 2GFKA 4GQIA 2QX8A 3IEMA 3OX2A 3F6SA 2GKLA 5NULA 3NLLA 1KBOA 4C1FA 2HB9A 3VPEA 3NHFA 5LCHA 2BTNA 1J9ZA 2FLVA 2WYMC 5ACPA 3RKJA 3FVWA 1A8TA 3KNRA 4HL2A 3O73A 3OX1A 2W5UA 4R81A 4XDGA 3EYWA 3N3BC 5ACVA 4LTNA 1H69A 2YNVB 2Z9DA 3KEGA 4BP0A 2QX9A 5LCAA 5AHOA 1BC2A 5HIOA 4ZEJA 3KAPA 5F4BA 1F4PA 5EAIA 2R97A 4NQ5A 1D04A 2BC2A 2FU6A 2X2PA 2QX6A 3FJOA 4TZBA 3HR4A 4ZNBA 2ZNBA 4U7FA 2KLBA 3ZQ4A 4TYTA 4RAWA 3EDOA 2BN4A 3I14A 2WHGA 4EXSA 4ZVMA 3BK2A 5B15A 1CZKA 2YNWA 1BVYF 4FX2A 3OX3A 3X2YA 4Y9RA 2FM6A 3NHLA 4Z60A 2P18A 4Y7CA 5FQAA 2YNTA 5EMNA 4FEKA 4PTYA 4PVOA 5JROA 2QMYA 3AJ3A 3W78A 4P62A 4YSBA 5B3KA 3Q6VA 4XWTA 2BR6A 2V5VA 2FZ5A 3NHJA 4ESEA 4NQ4A 5LSCA 2X2OA 1XT6A 4C1HA 2V5UA 1AKVA 3KNSA 4V0HA 3U7RA 2Y8BA 4FSBA 3I15A 1VJNA 3I11A 5EW0A 4D1TA 1D03A 5EHTA 1CZUA 2AZ4A 4RL2A 3VQZA 3TP9A 3DHCA 4UBQA 2BFKA 2Y87A 4FGLA 4U7GA 3OWHA 1DXQA 2HNAA 3OJXA 1RLIA 4XWWA 3HA2A 3H3EA 1RCFA 1CZNA 2M6SA 4RBSA 5HH4A 3PY6A 2QR2A 1AG9A 2KQUA 2BIBA 2BFZB 4Z5YA 2QWXA 3IE2A 3B6JA 5BUCA 1T5BA 1QRDA 5LLDA 3AF6A 2AIOA 5FQCA 1BU5A 5LJLA 5EV8A 2ZKIA 3B6MA 4XUKA 4QOEA 5B3LA 3T3OA 1FX1A 2FU9A 3W7AA 1ZX1A 4KEPA 2HPVA 4AWYB 4QOJA 2A5LA 1FLAA 1H66A 1QBGA 4FR7A 2DOOA 4J5HA 1C7EA 2Q9UA 3SFPA 4D02A 2BFLA 1L9YA 5A4KA 4JO0A 4LAFA 4KEQA 4ZVLA 3S0ZA 4TZEA 2M5DA 5ACTA 5HH6A 4C76A 1C7FA 3UXEA 2QJSA 5ACWA 2OYSA 2D5IA 3N39C 2MTBA 2R96A 1YRHA 4RM5A 1OFVA 4TZFA 2NZEA 4UWSB 4HKYA 1Y44A 2WYMA 4EY2A 5HISA 4F6HA 4S24A 3G5MA 1QH5A 1J9GA 2M5CA 2YNTB 5ULLA 4NQ2A 1OBVA 2BG7A 2NZFA 2P4ZA 3L6NA 4F6ZA 2B3DA 2GFJA 3NHRA 1MQOA 2FHXA 1BMCA 4WD6A 4NULA 1DXOA 1KO2A 2QDTA 3FX2A 5EVDA 3SVLA
chains in the Genus database with same CATH superfamily
3CNHA 3IE0A 3NH6A 4KXLA 2WWVD 3T9DA 5DM70 4WPGA 1ZD1A 1N33B 1LI7A 1AGYA 1NMSA 3CUSA 2CVQA 3C6BA 1N0WA 3FYUB 4CKCA 3DPSA 1IK4A 1V95A 1QH8A 5CLJA 3ZKWB 1D0IA 1UBOS 1N6NA 3EEBA 2WWTA 3QGMA 1UM9B 1O8BA 3A3NA 3DULA 3EC2A 2WSBA 1S2IA 3QLUC 4NAUA 5BR4A 3SBXA 4WH0A 5A9RA 3ELUA 2XJ4A 4RYLA 3G13A 2H8GA 4L4UA 1H5QA 4RPHA 2BWJA 4RLFA 4WDQA 4OTZA 4N0QA 5BRNA 4Z1OA 3RTDA 4L15A 4HZIA 5H59A 1YJBA 3TZHA 1TJPB 1N77A 2Q1TA 1UMBB 1GTRA 4RA6A 1SG0A 1Y8RA 2WJIA 4GR9A 3E4DA 2ACWA 4JU8A 4LJ5A 4PAMA 1FRNA 5AI0A 5BMVB 2CXRA 2XHZA 5IFLA 1EFAA 3QKIA 2O2GA 4M0MA 3VU8A 4C6SA 1PFQA 5IK2D 2ZT8A 3R3HA 5B6IA 2GA9A 5T67A 2VKTA 4R2HA 4MRMB 3QKRB 3HLKA 2D6FA 2DQKA 3NHKA 5JD3A 5DWVA 4E11A 4B8ZA 3G5UA 1S8FA 4AS3A 4FYPA 3JR3A 1GZDA 4HUTA 3ADBA 1ZXXA 1KH3A 3ADRA 1QRRA 4INZA 4ZOBA 5DIFA 1UP7A 1VHDA 2GSDA 2JGIA 4ZN6A 2GYVA 4EYBA 1VL1A 4FLFA 3C7DB 1I4LD 1I51A 1RCUA 2RHJA 1YCHA 3HL0A 4RY9A 4LGMA 1S5PA 5KDLA 5JH7B 2O2EA 5CX4A 2C9DA 1VYUA 3E27A 4U2DA 1YXMA 2D3WA 1FQJA 3IDZA 2QN3A 3N3AC 4RSMA 4RJKA 3NGMA 4YALA 1CQWA 3W5UA 5KYKA 4DLUA 1MP0A 3BL6A 3PNLA 2Z3WA 2IZZA 3VTFA 1YL6A 4W8HA 2UVDA 1Z4QA 3A1DA 2X23A 2TRSB 2GJAA 4KX3A 3Q0TA 5JT1A 1DJPA 5BSMA 1FLDA 5CK4A 3IHWA 4HAXA 3GJ5A 3UJ3X 4F1WA 2DU8A 3MMXA 1VHQA 1RFLA 1H4SA 3GUUA 5KKNB 2ZRGA 5FEUA 2WE8A 4MH0R 1TKCA 1HDRA 4KFTA 4L5YA 3WK7A 1B3BA 1S4QA 4PRKA 1DUVG 3OZVA 1QRUA 5DM1A 2E0IA 3A10A 5EVCA 4IQFA 1E0DA 3HDJA 3K2EA 3EQ6A 5E4YA 1V37A 3MELA 4IFTA 3TX6A 2O3SA 2RGXA 3KXDA 2VF7A 1UC9A 5K8UA 5FNVA 2VDOB 3T7EA 5K6AC 1WZCA 4OBEA 3A26A 1XZ8A 3Q85A 1JA9A 1FDTA 4ZI5A 1C2TA 2X6TA 3C6ZA 1YDMA 3P0RA 3A58B 3AY3A 2GAAA 3LP6A 2RK4A 2X1VA 3UMCA 1K9VF 1M1NB 4IQ4A 4KWTA 3I64A 3PKIA 3BWVA 4N5HX 4EKNB 5ICGA 4FYYA 1XXHB 2ODEA 2QRVA 1GGHA 3EVAA 4I5EA 4P4NA 4GUDA 1FRFS 4RPLA 1UEXC 2LV8A 3I52A 4F1JA 2YZGA 2R8EA 3SSNA 3EVEA 3BQ9A 3T7AA 1EKXA 4RK0A 2EG5A 3CLKA 4QUKA 2OHIA 1F38A 3K0AA 5C7IO 1W19A 1MX9A 1W8IA 1BMQA 2FZKA 1XKLA 2H6EA 1WUYA 2V7WA 3IKVA 3OQPA 4FTWA 4FXPA 1GD1O 1YUNA 4LJKA 4MA5A 3RF6A 3RSSA 4EEZA 4EKGA 5C4IA 2O3JA 4JKYA 1ISFA 3AF3A 4JB0A 4RORA 5DKFA 3W9YA 4C09A 3ZE8A 1BROA 1T9GS 1DBWA 4ZTZB 1CY2A 3C4QA 2R6AA 2Z9BA 2Z1NA 4Q3NA 5AJVB 1ZNZA 3WAJA 5KTOA 1ODLA 4P82A 4MS3A 2VUSA 1W34A 2Z8YM 4HATA 5LQRA 4DA4A 3AR9A 1OFHA 3PGMA 4W4TA 4XAQA 1DJQA 3ONFA 1VIVA 4RXTA 1ISMA 4ZQHA 4S0ZA 4HLCA 3RB8A 2MR5A 1IU9A 3QUSA 4MUBA 3RK0A 5K3OA 4D0LB 2O57A 3P27A 1HE2A 4JYBA 4M0KA 2W2OA 3KEMA 5EXTA 5G0UA 3ID6C 4JBIA 1RJWA 1E2QA 3PLAE 3L8CA 3G2MA 1T1IA 4U6NA 3SDZA 2H59A 4A0GA 1NRJB 1CY4A 1G1AA 4FD3A 4AUEA 2F3PA 1H2EA 3M6LA 3HLYA 4TXNA 5JYCA 1N2XA 3ECCA 3PDUA 1LU9A 4TMYA 2AZTA 2HNBA 4IUBS 4FFOA 2IYLD 2SKEA 3EPHA 1JJFA 1E20A 1SFRA 3BE6A 3URMA 4ZO2A 2CJFA 1TW2A 3DE1X 4NEGA 1OHHA 4HB3A 4PCVA 3SLRA 3C15C 1J1UA 2O5CA 3FUCA 2AFHB 1JDVA 3GDWA 2AJ8A 4Q93A 5BW6B 4E32A 3NPAA 1SO8A 5DTMA 2X0IA 3A04A 1WZIA 3DL4A 4MULA 4OAOA 3GDOA 6ABPA 3L0OA 1HNXB 3NP7A 4BNFA 4RZQA 2B8NA 2JRCA 3EZFA 5DYTA 4JNKA 1DCFA 3MJ4A 1EAMA 2W48A 4BNZA 3FNQA 1JA1A 1XO1A 3L8DA 3BFXA 4IVQA 5EHQA 1M2GA 2YHIA 2NXEA 3PICA 4E3WA 5ITSA 1W29A 4IZHA 1TLLA 3G85A 3JQAD 4TN1A 3JVUA 5EE5B 3U7IA 5BR8B 1IXZA 2INGX 1LCIA 5TNXA 5JCJD 2GNOA 1RIFA 5DE3A 1XVAA 2K2QB 1W94A 1OGIA 2XOEA 2ZUDA 4IY1A 4GX1A 3TQIA 3HYTA 3WIOA 1M1YE 2ZBDA 1E1KA 1Z37A 2I65A 1MAVA 4JMPA 4XGNA 3NYRA 5A5DA 1R27A 3M4JA 4JMLA 3MJRA 3IV9A 5JZSA 2YS7A 1LZLA 3GCZA 3ZOKA 1TD9A 4J91A 2FGJA 5H5JA 3TB6A 1UK6A 3NNSA 3DTTA 4H7EA 1GNTA 5JI3E 3OJ0A 2AG6A 3OFND 3R3JA 4N5LA 2Z2YA 1B15A 1OCEA 2Q50A 3GJTA 3JWEA 4KO8A 3SJCA 5FFMA 2LP4Y 3DAPA 3CNEA 1XQYA 5KTMA 1U3DA 2PL5A 4RQTA 4OA5A 3PF9A 3G7UA 1T8PA 3EOAI 4NDAA 1MO5A 1PS0A 4RS4A 2EXXA 4ZAYA 3EIUA 2LD4A 1DPFA 3EFOB 2ADOA 4CT0A 4JJ8A 4LDPA 3TFQA 4NYIQ 1RSZA 1HSOA 1YRWA 5T7BA 4NCXA 1K6JA 4ZO7A 3WIEA 4DEXA 5IC4A 1OROA 3KOOA 2I6UA 3AWIA 1YZFA 4MWDA 2A14A 2GZHA 4EJMA 1IN7A 3LBAA 4UNIA 4HH4A 1T4CB 4C3UA 2IZ6A 3IULA 2VDWA 3DVQX 1UKZA 2HWWA 2A35A 3UK7A 3D02A 4DHEA 1JFSA 1VE3A 2VRWA 1CZRA 3T94A 3BDAA 3K32A 3DLIA 4UVGA 2O2JA 2NZXA 1JILA 2HCJB 3W2IA 2NP7A 3DZGA 4NQ6A 1P2SA 1DRWA 3HJCA 1NE7A 3RIYA 4HWSA 4QDUA 5EKTA 1BGWA 1VL5A 2BHRA 4G1EB 1NN1A 1K98A 2XF4A 2O20A 4DTCA 5T8KA 1Y4UA 2PSDA 1YH3A 2Z98A 4ZCTA 2XNDA 1H8ED 3L7JA 3ZCQA 4OMDA 3AKCA 4DGSA 2G77B 3BFVA 4DADA 1UMDA 1X9IA 1AMNA 4D4IA 3OETA 4AX4A 1E7MA 1XTJA 1G21A 1LDNA 3WRYC 1IULA 3F2VA 3QYFA 3N7AA 4P7BA 4I1OA 4Y2TA 5KJEA 2MCFA 1I3OA 1K3FA 2VNAA 3OCWA 4DQLA 4YA6A 1LBIA 4EP1A 1VZ2A 4LG1A 4MDHA 2A4KA 4TTRA 1GZ3A 1PQUA 3UCEA 3E9ZA 2GHQA 2YINC 3K8ZA 3SP1A 4QQFA 3K09A 5E6UA 4YXWA 3T4PA 3WJ2A 5KINB 4E1AA 3F6SA 5LZ4A 1J49A 3RF7A 1CR0A 4W6ZA 3ZCUA 4ENRA 3MGCA 4ALMA 5BUZA 2BW0A 2VQ6A 4QBFA 1JEAA 1SU8A 2IX9A 4M54A 1V8DA 4CG0A 3HVJA 2ZQYA 4OQPA 1MJNA 5CVEA 1X94A 4A6XA 2GRJA 3L7IA 1C1HA 1NBMA 1YBHA 2VH5R 4Q7JB 4TZKA 5EEGA 5LA6B 4BO2A 1IB6A 1NW7A 1P1IA 2HPZA 3AESA 4BKUA 1GYRA 2PL9A 2F3TA 1GNVA 3O8QB 3PPYA 4PHFA 4CKEB 4OP3A 4J3NA 1H69A 4WBSA 3DZIA 5F78A 2HIAA 1VMIA 3TQRA 1DWUA 4DG8A 5BOSB 5JSQA 2XKKA 4IIXA 4DS3A 2ZIEA 1HA3A 1U11A 1XZMA 3PC4A 3Q7RA 1Z5PA 1U1DA 4OBBA 5SYMA 1T9ZA 5HIOA 1RD4A 4RJ2A 2CZCA 4PF1A 2V9ZA 2ECFA 3UM9A 2BC2A 3UYKA 1T3LA 2UYQA 2PNFA 4QJ5A 4C7MA 2WHXA 1SPXA 1YR6A 3L8MA 2QP3A 4V3CA 3FJOA 3PTZA 3RSHA 4PIVA 3BICA 3HA3A 3TYXA 3QOXA 1RI2A 4PLTA 3RO7A 2FP3A 3AUTA 1R6TA 2H4JA 1ZH6A 3PJFA 1AVTA 1DCTA 3WKDA 3PX7A 1RWXA 1LBTA 1AZSC 4IIHA 1NXOA 5TQ2B 3DKRA 5A1JA 2BH2A 4WCFA 1NV8A 2MSWA 2PGLA 4L5AA 1J7KA 3NDJA 1QNFA 4BGEA 3LU1A 4G9EA 2VAPA 3U13A 4OQMA 3OIWA 1AIPA 5JJBA 1JLKA 2C83A 2WV7A 1JAXA 1CFZA 1Z7GA 2VJPA 4I9HA 2IV2X 3WZMA 2W6QA 1EVIA 1EYZA 1X42A 4XWTA 1A95A 3JQ7B 4H4CA 3G23A 2JAWA 4ZYVA 2Q9BA 1WXXA 3KZXA 3I2JA 1YB1A 4B47A 3U3XA 1B8OA 1A3CA 1J07A 1YR7A 5FLXA 1BD3A 2YN2A 3B7PA 4YDRA 1WMFA 3RJ5A 3ZTYA 3JASB 2BGJA 3HHEA 1NKSA 5FWNA 2IW1A 2X13A 8MHTA 1BEEA 3I6YA 2PG3A 3MCWA 3CYFA 1VYVA 2I62A 1DUIA 1USKA 3HB4X 1R8XA 4WCDA 3STTA 3VDQA 3RADC 1C9KA 3QVGB 2JBAA 1FDOA 2YMLA 2HF7A 4M87A 3TD6A 1UEIA 2LDBA 1L7AA 1A9TA 2VP4A 2Z83A 3ANLA 3L8EA 3W05A 4AYWA 3ZGXA 4WK4B 4H59A 5A4FS 5ARBA 2CG2A 2O1WA 1FFEA 3WX0A 3UKDA 4EATA 2BKUA 1TZCA 1SBYA 4UNSA 3WJ7A 5JJIA 3FMOB 2DWQA 1T1SA 3WQQA 3LT4A 1DNPA 2RSLA 3H75A 1M54A 2ACKA 3NEAA 2X6RA 3NIBA 2X3FA 3KUDA 5AK0A 1I2DA 3UGKA 1C4OA 2QR2A 1F8XA 2OQ2A 4KB5A 2O7VA 3DE7X 3NQ41 1TZMA 5IMBA 2PKWA 1W4ZA 4UBLA 4YECA 2PPLA 3OT1A 3IE2A 1X8LA 3O2QB 1DG9A 1YK1A 4B44A 2Z2IA 3VRHA 3A6JA 4IMPA 4BQPA 1FZQA 3EZYA 4HI0E 1QKIA 2ZWPA 3AF6A 1KK1A 3W5AA 5LJLA 4MRSA 4GPD1 2OMEA 1Y5NA 4YJHA 1KI3A 1MT3A 1AQJA 3LG2A 1FQKA 1VB5A 2YL2A 3KEFA 1M2WA 4AG3A 5I4KA 4Y0NA 1R5JA 1CJSA 1UXGA 4UE2A 1U8FO 1FRZA 3VZPA 5A3RA 3WWYA 3ADOA 3UF0A 1WCV1 5A4MS 4DA0A 1TI7A 2WJ6A 4NONA 3HN2A 3CFYA 4PLVA 1C7EA 2FN4A 3L7DA 3QXHA 4M7WA 3U3RA 1ZD3A 1RYBA 1KMQA 1SUEA 2QMOA 4LDZA 5BNZA 1EA7A 1U0NA 1AM4D 2RHCA 2D2VA 3KFLA 2C7QA 4Q21A 4D8VA 1HEUA 2HJWA 3VNAA 5IW8A 3PA6A 2GB4A 3NBMA 2YWBA 1JI3A 1KQ3A 4G5YA 2ZJ8A 2M5DA 4FOSA 4TZTA 4Z0HO 1FFAA 5ACTA 1QYRA 3PZBA 4GOOD 2CNWA 5KJ1A 3GLIA 1J1IA 1XELA 1AQ6A 5DVZA 1JXOA 3L8GA 5IXSA 3V9PA 4IM7A 2AKYA 4TS3A 4EMTA 1DC4A 4L78A 9ABPA 2NZEA 2IXAA 1W9MA 3EDCA 1CE8B 1DKOA 2J5KA 3EDQA 4BNTA 3Q0EA 1R9JA 1RYZA 3SLGA 3VISA 3V2HA 1C8LA 4OO3A 4Q3OA 2IIPA 1L7XA 3FPEA 3HVIA 3NRBA 5AOAA 2P2LA 4FPXA 2UYCA 3HJFA 5B55A 2QN8A 3LT1A 4CL0A 3EIFA 1CIJA 1KPGA 1C9YA 4R1OA 4HDSA 1ONOA 1RBMA 1B0UA 2PJRA 2ZVPX 3ENWA 1LJLA 5G3YA 4NBLA 3QPUA 2UVQA 4XW2A 4Z7NB 2JL1A 3AGQA 3S8EA 1IY2A 2IYVA 3EVNA 3OUZA 4QJIA 2GCEA 3R9IA 1G2OA 4MK4A 1OFUX 3NWOA 5BSKA 4P9NA 3ZD6A 2X0JA 4RETA 1VGNA 1TM1E 1WWKA 2P8JA 3DBLB 3H3FA 4NNOA 5TX7A 3VPDA 1RRMA 3QPVA 1GQ2A 2X41A 3PNSA 4CEHA 1EGVB 5BORA 4FHCA 3OIDA 4BBJA 2LCQA 1M5TA 2DT5A 5FPPA 4HVLA 3UEOA 3QTTA 2H1FA 3GK3A 3I04A 4JYPA 4AMUA 4DFDA 2OLEA 5ITWA 1C14A 3FUTA 3MEQA 4YO8A 2QIOA 1OJ7A 1X1AA 2GEDA 2X9VA 2H4YA 1KWGA 2H54A 3RUIA 4PAWA 2QMEA 2GPWA 4F6RB 1P2VA 3QSGA 4XQCA 2R8PA 4INOA 4OHRA 4X60A 4M53A 2XR1A 4OM8A 2PUGA 2W6MA 1MXHA 3ZZTA 4BQEA 3DHWC 3OZEA 4RPKA 1VMKA 3I2GA 2E37A 4XJXA 2PWYA 4RKYA 2ZSKA 2R00A 3CT6A 4ZT3A 2WYLA 3WS7A 3ZNBA 3GG2A 1VSBA 1ENYA 1V43A 1QC5B 3SIXA 5AKIA 4M60A 1S2LA 1Y9JA 2P4SA 2REQB 2WP8J 1NNI1 4MINA 3IKTA 1GXSA 3BMCA 1EVKA 3OTIA 2PZFA 1XTRA 3C3DA 5U4QA 5CDFA 1SD2A 5K5EA 1QBKC 4ACAA 5T3UA 1DCMA 1HLFA 4K0RA 1F5SA 5IP5A 1HDIA 3SQWA 4AJEA 5AKJA 1IMOA 3QEKA 4WVFA 4YRBA 4TYNA 3A9SA 2TYSB 1QNLA 4H2DA 3NAZA 2QE6A 1J25A 1TU3A 3D5QA 4Q7LA 2X6QA 4G63A 1XYVA 1N36B 1ZRNA 3L7BA 4OK5A 1Q1ZA 2QTZA 3PFBA 2V4UA 1TK9A 2ZFUA 4MQ6A 5E95A 1HMYA 3S68A 4EUHA 1G6Q1 2B0CA 4MKHA 4MHTA 1GPYA 4OK6A 1FNDA 2Q3JA 1QHYA 1UKEA 4PM4A 1VI5A 1Y89A 3MPOA 2HA2A 4NE9A 5CYOA 4B6QA 3VGJA 3TZCA 1VRCA 1CQJB 1YB2A 1UWKA 2DBZA 3B1XA 4XM1A 1VYTA 2W22A 4QPJC 4C08A 5FDFA 3YASA 2ZB2A 3RTBA 4TOIA 3RVRA 2K5UA 5KCZA 3U3OA 2IP1A 5D7BA 1WUPA 4WK2B 4UASA 5LM6A 3C4VA 3HA5A 1KP3A 4J8PA 4UUQA 1XCJA 1ZVJA 5DTEA 3KQWA 3UUGA 1CS0A 4G1CA 4BLTA 4R01A 1TCAA 2OZPA 3MQ4A 1N5JA 2HJSA 1WXIA 3JQ9C 4FBLA 4JASB 4OH7A 1JMKC 4X5OA 1V8BA 5TS2A 5K0GA 1P7VA 4OQZA 4R31A 1F20A 1U2TA 3OT5A 2QSJA 2V3VA 4X1IA 1MGOA 1RI3A 3IO3A 4MVJD 5DI3A 3UZUA 2E7ZA 5C7OO 5LU9A 1NVXQ 3ZE7A 4R84A 4RTJA 1UL1X 1IC6A 1W0JD 2GEFA 1D2MA 1XVVA 1VFNA 2VATA 3QYAA 3V7WA 4CLRB 4YRNA 4L02A 2XA9A 5JNVA 2XHEA 3SMVA 3USCS 2GKGA 4X95A 3GAZA 2GF0A 3L07A 4A23A 3NWBA 5KQMA 1OAOA 4E4TA 1NXWA 4E88A 2JA2A 1H42A 4DMRA 3L6UA 2Z30A 2OO5C 2AQHA 2YMQA 3E2IA 4EB0A 4JVSB 3EGDA 1JFTA 3E3OA 1NIPA 3GLSA 5A5FA 2WE7A 5DNWA 4CKCB 5JYBA 3HY4A 3OMLA 1QH8B 3GNTA 2BVNA 3ZKAA 4JUCA 3DVAA 3QF7A 1BXKA 1L6IA 1A2OA 2C20A 3F7TA 3L3BA 5DGHA 4M6WA 1UAYA 3RV4A 5AIBA 3H16A 2QD4A 4ALNA 1F9AA 2ZETA 4EPWA 1T6NA 2XD9A 2AZXA 3FWPA 4D9NA 4TKUA 5EJAA 2AMYA 2F1OA 3E3MA 3NXSA 2BEJA 3T5MA 2XTAA 1WDWB 2BM8A 3GT3A 3PC7A 4ODIA 5GP1A 3WP0A 1O0CA 1YL7A 2XE4A 1ZHHA 3K9FC 2PZ8A 3IURA 4ZCLA 5J5VA 1A7TA 3BB3A 4R6XA 2W2KA 2PRYA 4CF7A 5IHPA 3S5JA 3FRIA 5DXFA 2YWCA 5F7OA 4U7HA 2ZZIA 2SKDA 1O9HA 4RA6B 1Y8RB 1RKBA 5FI3A 3BC2A 4CETA 1V3VA 4YCDA 4B2LA 4ZC1A 4MMYB 2OBBA 3T8YA 1TTHA 5CGZA 1GNLA 4IS2A 3OLVA 4R7TA 5HTKA 4O3MA 1U1GA 3SQXA 2NVOA 2G83A 3ZZ1A 3AJ3A 3RUHA 3SPUA 1FUUA 1A4XA 3GGGA 1FU7A 2FG6C 3RT7A 2Q99A 4NNPA 4JVMA 3ZLJA 5A5ZA 3ZWYA 3KOMA 4FEYA 4JJ4A 2HK8A 4DSAA 3FB1A 5EESA 3WQRA 3VR2D 4YJKA 2XMZA 1AQNA 2ZM6B 2HA5A 4L74A 2QD1A 5K0FA 1U2GA 3C70A 3DFUA 3Q3EA 4FW9A 3VZRA 4EPRA 5C5IA 1NJ2A 1V8PA 3KKKA 3OSUA 2AMLA 3NHUA 2CYAA 1K7SN 3A6EA 1XDSA 4MUIA 1PZGA 3CWZA 4CFZA 5LE1A 3KKPA 3IQFA 1RLTA 1YDGA 4CJXA 2P62A 1MENA 2V5AA 3WO1A 1ZVVA 3JD0A 4DMGA 1V6SA 3GAMA 1KYVA 4Q4LA 2O2ZA 5KO2A 1ZC3A 1UBEA 2ZRBA 1NP7A 2FSGA 1TMKA 1E7SA 4A16A 2Z4TA 3P7MA 1PK9A 4LYAA 2X40A 3QQPA 4Y6QA 5HZGA 2H07A 5KTKA 1JG7A 2H48A 2QXTA 4ZVNA 2QVCA 1PJTA 1IL0A 4LWOA 3SYMA 3DE5X 4A26A 5K2OA 1TTPB 2WU0A 2EQBA 1LRJA 3LLUA 4QYIA 3TPFA 4YROA 1X77A 1A5SB 2XYHA 3E1GA 3P0FA 5TGZA 4ZJZA 2PNJA 5CLQA 2YNVA 4PZAA 3UPTA 1GCGA 3AINA 3M3PA 5H4HA 3RAFC 1E4YA 2RDMA 4M37A 1FNSA 2JHAA 4MSUA 3R5XA 4W8GA 3W1EA 3FF4A 1E94E 4RTPA 2O2HA 1NLYA 3Q8XB 3EGWA 3GCGA 3GNQA 4M1KA 4F93B 5LL6P 2WINI 3THYB 1SGWA 2O0LA 4XB2A 3WIUA 4PR3A 2GVZC 3TH5A 5FNVB 1MJFA 5JWOA 4YLEA 4P4SA 4G41A 3BTOA 2LKDA 1K6XA 1DB3A 4TV9F 4DCMA 2WVJA 4N5MA 1M2OA 1ZDMA 3ZHRA 1P7ZA 1UC5B 3C8MA 5DSXA 1CZLA 4KQEA 2JBHA 2IHJA 3MBKA 4ZC8A 1UODA 1VI6A 1JSZA 3WLMA 1X19A 2R8RA 3KWJA 2Q07A 3LHSA 2GCUA 1Z29A 5GZ1A 1A96A 1ZUWA 4ZOEA 3LC0A 3MTEA 2QRVB 3PHCA 4OB8A 4EY6A 5CT9A 4W6QA 3PEFA 2C2HA 2VF4X 2VHJA 5LQDA 3GH3A 5JADA 1I4EB 3UTCA 4EYFA 3K0AB 4N48A 1CS4C 3VX4A 1UFVA 2E4ZA 3O38A 3U9TA 3KWLA 1TCUA 2YWFA 4AC9A 4BLRA 3B78A 2JFNA 2XTNA 3IKLA 2YBDA 4YRCA 1LPBB 3UJPA 1BD4A 2UUCB 3P5BA 4B7UA 4L5CA 4REMA 1N5KA 3WADA 3R9XA 3DQPA 5BN4A 3T9FA 4DCTA 2BZ1A 1C7IA 1LV8A 3GQBB 2HGZA 3BORA 3M4NA 4F5ZA 4MS3B 2P4HX 3RWOA 2QY9A 4R5HA 3S1SA 3Q1KA 1HL7A 4HN2A 3TQQA 5TPWA 3WFZA 2BHSA 3OMWA 3VU3A 2JAXA 2C99A 1B26A 2R5NA 3C7KA 3IEKA 3TZ6A 9LDBA 1AH2A 5K0WA 4B9AA 2HHHB 1IOZA 3IAFA 4ARSA 4IDHA 3PSHA 5AXCA 3EFBA 3PFCA 4GH5A 4MIKA 3U4DA 4C7OA 1T9GR 3JD1A 3NTOA 1CUBA 3BERA 4BGDA 4MUHA 4ZGGA 1ONSA 3ITKA 1VI2A 4LY3A 4MGYR 5T64A 4BEJA 4C14A 4G67A 1OLXA 1KVRA 3ROGA 1BDHA 2Y8EA 1Q0RA 3P2EA 4B6GA 5L53A 5MFPA 5KJFA 2BP7A 4JSRA 5JECA 4YAUA 2LNDA 1XTKA 2R1VA 4MPJA 5LBIA 3UCFA 5LZ5A 4CUZA 5IF3A 4EHLA 1TZKA 3H97A 3PNMA 3AL0C 3DD1A 1LDMA 2C84A 4WHMA 3M83A 4OH1A 1CEQA 2ZIWB 4BNGA 2R6GA 2QLTA 1T4MA 3NLLA 4M1MA 3C8HA 1HWYA 3PI6A 4QXMA 3SCZA 3VC2A 3HMQA 4C1FA 4CNBA 2VSQA 3BH6A 2QPTA 1NMXA 3IP7A 3QMVA 2W4QA 2GM5A 4LWQA 5I8PA 1QYCA 4KFCA 4H1VA 3KE8A 4V03A 3GLRA 5B37A 3MJCA 1CETA 2O8EA 1AHIA 1Z6ZA 4GGOA 4NG4A 5FYQA 4ZOLF 1GQFA 2A33A 3OX1A 2NPFA 3B5JA 2V7GA 2W5UA 3NTLA 1E3EA 3N3BC 2YHIB 3OKCA 2R7KA 5FL7D 2P3LA 3IVRA 3ZI7A 1U3UA 1OSNA 3L84A 2Z3ZA 4FMDF 2A7QA 3N2KA 2HO5A 2R7LA 1OKKA 4QSHA 4HYYA 1V1MA 4BP0A 2IS1A 2EBFX 3SSMA 1VDMA 1P18A 4HRXA 3A11A 1Q1AA 3AVQA 1F4PA 4NCIA 5EAIA 3L8YA 5SYNA 2Z3VA 3FJ1A 4R9NA 5E0KB 2ZIUB 4OUDA 3R3UA 1P5JA 4PINA 1ZL0A 2A67A 3PU6A 4FT2A 3WNBA 2DR2A 1L1QA 2V4ZA 4UXIA 3SZRA 1M6NA 4H6XA 2GZ1A 3TLBA 1B4DA 1GL9B 4AS1A 1QZTA 4GOXA 3A06A 2OO7A 5HCUA 1VJCA 1B76A 4ZI3A 3EZNA 1V7QA 5K8TA 1HLGA 1N2IA 1MB0A 5CT6A 3L6RA 5T41A 1E1YA 1PT5A 3EASA 3KR2A 2OYRA 4CVNA 4D45A 2XB2A 1PVVA 2R60A 2H31A 3K9HA 5LP6C 1TQ2A 2HX1A 2JD2A 3NHLA 4YNBA 4F2HA 3RABA 1KTVA 1PWEA 4MKGA 1QDUA 3PQ2A 4B6PA 1P5RA 5H3LA 4Y2YA 4Z2AA 4N0DA 1I36A 1SHKA 4TWJA 1LF0A 3RWMB 2HHJA 3W78A 4DDTA 1POXA 2H1OA 3KQTA 4B6EA 2FQWA 3B8HA 3H6KA 3USZA 3EUEA 2O8FA 1Z8NA 1XT6A 3IUPA 4Q3LA 4Y67A 5M5BA 2B1RA 2R6R1 2VDWB 3ISVA 4GPEA 3OFKA 4J0FA 1PT7A 3ENZA 4I7EA 1AKVA 1D09A 4HUQA 4WZ6A 3JAMA 2HLHA 4NQZA 4YVFA 1JU9A 1T0BA 3U7RA 4EUEA 2WJVA 2EQ5A 2DFPA 3N7TA 3QE4A 5EZ5A 4YP7A 2EATA 3EYAA 1BHO1 4PC7A 3WLFA 3ICQB 5I01A 1ZH4A 4WKGA 5LZ9A 4EX7A 2AZ4A 1QH1A 4RL2A 1C7QA 1SOMA 3R5TA 1BWSA 4ND2A 2JIZD 4KG7A 1SG6A 1UBFA 1NW3A 2CN1A 3DMGA 1B3RA 1DXQA 2WZQA 3O83A 4RX1A 4U7GA 4F45A 1VL0A 1P6UA 1KDOA 4W5OA 1UMDB 2J0EA 1HETA 3BIWA 3CRNA 4LYEA 4J0KA 2VJCA 4U0JA 3N5KA 4Z1MA 3T52A 2IS6A 3MMPA 1G21B 2EP5A 4PC2A 4MVYA 1Y3CE 2A94A 4WK0B 4PO8A 3SX0A 3L8FA 2ODNA 5ED0A 1EUDA 3UENA 2Y4NA 4KE6A 4V0ME 4XYBA 1MVNA 2NQTA 4BKQA 3RV3A 2QROA 3ABZA 1GVHA 1VG1A 2Y9MB 3UW1A 4QUIA 4RHEA 5E6UB 5BWOA 1H65A 4U8GA 1PNRA 1NMQA 3GLQA 4CMEC 4J4HA 1JTFA 1EGQA 2I6QA 2VN8A 4HV4A 3OTOB 5L95A 4CEIA 1KQPA 1UKVY 2FZGA 2HBZA 3CH4B 4G0NA 4IHAA 1U7PA 4G0MA 1WP9A 3N6VA 5IYZF 1XL0A 2Q5QA 1DBIA 5J9FA 3B1JA 3AESB 3TKYA 4E08A 3O8LA 4JP8A 3GRYA 2ZSBA 5TT1A 3BD6A 2J08A 1V71A 3L7CA 2YJNA 1IHXA 4S2EA 1NF9A 1S4MA 4D2IA 3NVDA 4FHDA 5EIHA 1W76A 1GPKA 1ZISA 3U6KA 1ISHA 1JEYB 2AF4C 1U2ZA 1ZSNA 2B1IA 1MA0A 2IEIA 4MI1A 4EY3A 1MG0A 3CLRC 2WAAA 5A4KA 3AVWA 3H2KA 2HTEA 1DDOA 1K63A 1Z5ZA 2Z8XA 2NG1A 4D9FA 4ITVA 2AS0A 5CDSA 1IBSA 2CLFB 2FGKA 2JI9A 3JTEA 1K08A 2C4HA 4BN0A 2HC9A 1G5HA 1XZHA 1NUUA 3F6BX 3BGVA 2FZLA 3JY6A 3WTBA 1SKQA 2YFQA 1JH9A 1MX1A 3PGKA 1MAWA 4ZXPA 4CMAA 2WYMA 4A2PA 4A6EA 1KOGA 5HE9A 4J29A 4AKGA 2B6NA 1HQKA 1MJGA 3VDNB 3FZYA 2ZVQX 4WCFB 5B1SA 1WX1A 4K1LA 4GBED 1UT6A 2VJDA 2H65A 4D9CA 4EJSB 2VYQA 3SICE 4RKFA 3TIFA 3CCCA 4TWZA 2B3DA 4PGAA 3IJ5A 4W5WA 1UAGA 3EMDA 1R0WA 3O4GA 2E9SA 1BYUA 1UBMS 5TB5A 1A69A 2QM8A 2RGYA 5MN4A 2RI6A 4ZHQA 3UOWA 1G4UR 4XARA 2ECKA 2VHZA 4LPSA 3RS7A 3ESQA 1UP6A 2WU4A 4ZWNA 5TPZA 3WDKA 2AJLI 1QOZA 1N75A 4KFSA 3O1HB 4RJJA 4V0KA 4ID9A 3BWDD 3BCSA 3RH0A 1EWYA 1IPEA 3WZ2A 5AWFC 2OENG 1DV1A 2EZ8A 3C3KA 3GEHA 4MW5A 4X6YA 3PWSA 2C5SA 2M1ZA 5T5QA 3ZV7A 1UC8A 1BYIA 4Y6LA 3VNVA 4AJ1A 2WFMA 4WASA 2JBAB 4RDCA 4BFCA 3UWKA 4Q18A 2R1TA 2OYCA 4C1EA 1O0BA 3WL7A 4JJAA 2I9KA 2CC2A 1L4LA 3IB3A 4FOLA 1NLMA 4TT3A 1KAEA 1UR5A 2IOYA 4GC5A 3FDXA 4HZGA 3OJOA 2EW2A 5ERXA 3UJCA 4E94A 4H1WA 3N2YA 5F76A 3DEZA 1XUOA 4FWBA 1HYGA 4KI0A 5JFOA 1VJ1A 3DT9A 3QBJA 4IVPA 2AG0A 2FPLA 1L3IA 2UDPA 2VEDA 5CEFA 4Z4GA 2E87A 1XU4A 2WC1A 4M0EA 5HIQA 4YCSA 4OYLA 2FA9A 1JHVA 3NBZC 1VGVA 3OT1B 2UU9B 1P4AA 1RXEA 4NS1A 1PVOA 3GB9A 5HS6A 3BZWA 4BVGA 3SFTA 4YMTA 3BX1A 1OXTA 2PBLA 3LBHA 2OK7A 1NVDA 1J0BA 1DFIA 1Q7TA 5CJ2A 3H5WA 3ORRA 4X8OA 4YRZA 1N6LA 5EIWA 1AKQA 4YJHB 4MYCA 2PXXA 3IPYA 4RQBA 4BMVA 1N34B 3LBYA 4Q3DA 1C9NA 3OE7D 1USWA 2Q4EA 4LHEA 4QXRA 1GQRA 2QVZX 3ZTTA 3JXPA 4PX5A 3ZVKA 4JH0A 2CZQA 5AVTA 4WADA 5LM3A 2PV0A 2CLCX 2ZYIA 3DE2X 2OHHA 5BXYA 1PZFA 4BLWA 3KLMX 3RVBA 3FNIA 1THZA 2BT4A 4ROSA 4YXWD 4RTSA 1GFWA 2JI7A 2BGUA 1QB8A 3GEMA 4LMBA 4BV3A 5A3VA 2XWSA 2ZS7A 1FLNA 2WWGA 3MIIA 1IUKA 4LDAA 5BY2A 3FLEA 2LIVA 1R6AA 3PR1A 4FZ3A 3TO5A 5A62A 1XG5A 5LQCA 3LI2A 3KQQA 4FYXA 2ID7A 1MW9X 3E9CA 1U0FA 4WLVA 4C3ZA 4CL2A 3GLIB 2YJZA 4YJ2A 3I32A 3PEWA 4Z8YA 4KQIA 3KQUA 4IP0A 2Q5CA 2Q8PA 4LV5B 1K4YA 5LC1A 5BMVF 1ZU5A 4MHSA 1G3IA 2JCVA 3NG1A 2WM2A 3CPHA 3NYWA 1UANA 3A3OA 5CM9C 1UIRA 1HNNA 1Y1RA 1Z4MA 4EY4A 2FK6A 1NU6A 4YJDA 1Z5OA 3TPZA 3PNVA 4C03A 5BNFA 1YVRA 5HGXA 2Y8AA 4ARAA 1F2VA 1BRMA 1EE2A 1EFUA 5L9AA 1ISPA 5LMUB 2IHVA 4ZCMA 2QR5A 4JELA 4QPPA 4RC9A 3N5CA 4US0R 4DQDA 5KOJA 2CL7X 3IC5A 3WWEA 2NU9A 2JG3A 4JC8A 2OKGA 2PZBA 1UDAA 4HDSB 4L9SA 4AL4A 2IPOA 4DVGA 5B36A 5A2QA 3KJHA 5JH7F 2XTJA 1IEQA 1ML3A 1XJWA 2C2GA 2HYDA 5C81A 3KB6A 4JU9A 4HL6A 2Q0SA 3H13A 3NJ8A 3CHYA 3KYIB 3LT2A 4IDCA 4DM3A 5H7XA 1GA4A 3DONA 2B7BA 2Q7DA 4XOUA 1DOZA 1W4BA 3LL4A 4BNXA 4TS9A 4CEHB 4JYAB 2QRHA 4G0ZA 4C4SA 2PL3A 5IARA 5KMGA 2O0HA 2NZUG 4WZAE 5TARA 3LUHA 2FHPA 2B30A 1L5WA 4U4AA 5A9TA 4IWYA 1DARA 4WLUA 2B78A 1HUQA 5D1HA 1JB9A 1O94D 3RKUA 5KU1A 5C7LO 3DMTC 4JODA 1P17A 2C82A 2Y99A 1KC3A 2V97A 2ZI6A 3OOHA 1J21A 3UHFA 4LECA 1XVIA 2RBGA 4Z5XA 4CLXA 4QJ4A 4TVKA 4UUNA 4J2OA 2VHUA 4HOYA 4LY0A 1N2ZA 1NAIA 4FHZA 1SKMA 3MTAA 3SYRA 3NTUA 3V6LA 4QBKA 1XJ5A 3TZEA 2GCNA 3WDMA 1F8GA 3U16A 1R4NA 4DHWA 2H1SA 5IG2A 1CUZA 3F9RA 3BSYA 3CJRA 2O06A 2JB9A 5EMJA 1D6MA 2C5LA 3BGSA 1XROA 2XMRA 3GO4A 5EE1A 4HNVA 1UBTS 5DRTA 4L75A 3BMXA 1PK8A 4G4IA 1GAWA 1BE0A 1I7LA 1Y81A 2VJQA 5DCUA 3GN2A 2BSAA 3O93A 1RLUA 2NUBA 1ACJA 1GXSB 3BMCB 3TLAA 1JAZA 5ACSA 3CV3A 4QAJA 3FPCA 1L5QA 2P9JA 3RYIA 2ET6A 1U4OA 3PDIA 1RPAA 1I3NA 1BX1A 5KVAA 2NM0A 4KVAA 2WSMA 1ZD9A 1ZSVA 1ICEA 3D0RA 1O95A 2H29A 3VKFA 1FFCA 1JR3E 3PUXA 3DO8A 4IV5A 1QFYA 4GBJA 2YV3A 1H3FA 3OP4A 5FBVB 3SX2A 4K6HA 1IDOA 1VC2A 4AN4A 3P2UA 1XZQA 3SW3A 5BSFA 4G5GA 1QQTA 2WTUA 1J8QA 2VNJA 2FAXA 2J4DA 1GGEA 2QHXA 3T95A 1BVTA 3KDAA 5HK8A 3M81A 3PBKA 1MBZA 4MPDA 3IUEA 3SZ3A 4I50A 4GLJA 1RHQA 1UC4B 3K5IA 3MYRA 4ZO6A 2GARA 1PDWA 2FV8A 3ICPA 4Z7RA 3VR6H 4K9DA 2QUBA 2J3KA 3GLTA 3RVLA 1U02A 5C34B 4KAXA 1CS0B 4FUQA 4AWBA 4UQPA 1XF9A 3UUFA 3C1TA 4NICA 4LF6B 4J7CA 2P0YA 2QY6A 3KJXA 1F9EA 1ILEA 2NXNA 4NCBA 2OGWA 4J9VA 1ES9A 2PGDA 1EI9A 1EJ6A 2MT9A 3H1AA 3QNUA 4U7DA 1T6ZA 1MXFA 1T26A 4X1IB 1EWVA 3AI1A 5DI3B 1BAPA 1EEHA 5BPHA 1K27A 3KJQA 4M21A 2W6JA 4KLRA 3EGIA 1C81A 1GNQA 3PVCA 1AOXA 4UZEA 4QTUB 3W9BA 3QUCA 2FX5A 2WAXA 6AT1A 1VBNA 1YMQA 2I3DA 1EZZA 1VL8A 2OCBA 3GVCA 3L7LA 3RSZA 3JQEA 2A92A 2FVYA 3C85A 1DKMA 3ZQ6A 4K8RB 3W2EA 4EA8A 2PKQP 3BD8A 2AOVA 3IE1A 1GZHB 3KYDA 2Y0EA 3EGDB 5ES3A 1IUPA 3WHIA 1IUNA 3W90A 4K1XA 4AROA 5FTLA 1SVWA 1Z22A 2FQXA 3D4LA 3SU8A 1CP2A 3PC2A 1GTL1 3DVAB 2LZ0A 2HHAA 2XRMA 4DIDA 1BC5A 4GOND 1Z06A 5NLLA 3T1YB 4M6WB 4ZYYA 1XZEA 1EHIA 2EYQA 3KCNA 1PWHA 1OW3B 4C0JA 4CR7A 3E8XA 3KJFA 6PFKA 1LQ2A 1U8XX 2FOXA 2XBUA 4TKUB 4D43A 3F3YA 1RYEA 4B3DA 3W4IA 3KUKA 2RAPA 1ANKA 3I8SA 2DB3A 4IJQA 1VA5A 4G26A 1SXJC 2HFKA 2W2KB 3LX6A 3ABQB 4ZOAA 2YOGA 3IDQA 1CCWA 2FPOA 4EB8A 2IWHA 1E0JA 2JRLA 2IYWA 4UPVA 2X1LA 5A87A 2BELA 4IJ5A 3ETGA 4YRTA 4LBYA 2ZPAA 4QODA 2AC7A 2WKSA 2CG3A 3BCRA 3UOGA 3BQNB 2GS9A 4PC3A 1ZCZA 2QLMA 3MJTA 5IAGA 2BISA 2ZROA 4LC0A 4EK9A 4RELA 1YQTA 5I4CA 4XIFA 4O2RA 1KYTA 2Q1WA 3FFXA 2WLTA 3HCRA 2GO7A 3GCWA 3P71T 4ND1A 1SBCA 4GPAA 4H7KA 3WLRA 2Q4BA 5AOVA 2G5CA 2WYUA 2BFFA 3TTXA 4TS1A 2H57A 3L4BA 1A9SA 5DISB 2PMDA 1FOEB 2A9OA 1I2AA 2IXTA 2OFOA 3PQFA 5TT0A 5B3AA 1GU1A 2H1IA 2WB2A 3FPBA 3CUEF 4PWZA 2BC9A 2XXJA 2C5EA 3RVQA 1P2BA 2XRFA 2VHYA 3MERA 4EIWA 8ATCA 1O2DA 2NO9A 2XCRB 4M9RA 3HPQA 1YOVA 2QVLA 4YT8A 1J9ZA 5J4VA 3GDFA 3LGAA 1YWGO 3S40A 2HQBA 1CERA 2V8BA 4MXDA 3HXQA 1JYSA 5EG5A 1Z5GA 4QBHA 1GKUB 4R81A 3C87A 5H02A 1RC8A 1G63A 2X9LA 5AK6A 4QYIB 3WGQA 4AKIA 3RROA 1DFGA 4MYHA 2YNVB 4BJ3A 2G9UA 3HM9A 3PQ6A 2X5JO 5THQA 3WB2A 5AIAA 5D7NA 4WTOA 2C2ZA 2Y4OA 3UC5A 2IY7A 3NT4A 2WAOA 1CT9A 4CW7A 2Q28A 3DYIA 2XDQA 1FDWA 5B3JA 4FR2A 4EHAA 3F6EX 2FU6A 1IE3A 1R5OA 3KHTA 1HE1C 4BWGA 3ZV4A 1QMPA 1C9EA 3HV0A 2AN1A 4X9XA 3R2JA 4QLAA 4A5OA 1RKUA 1CDEA 1P3JA 3JSAA 3ME5A 1NW8A 4JJEA 2J4CA 3SJUA 2FPPA 4P4SB 2WICA 2PSSA 1W7AA 1BQ3A 1CUEA 1XA3A 1JDBC 2CFOA 4BVEA 1T9HA 3BL5A 5A3JA 2M9MA 4CM3A 5BW4A 1M2OB 1SAYA 3R9KA 2P1DA 2HLPA 5KNBD 2DLNA 3TWOA 2VSYA 4ES6A 2A0XA 2AJTA 1SVSA 1OB5A 5L3RA 3CKYA 1J24A 1EDDA 3T35A 4BN4A 4C1NA 1XZDA 2XA2A 1C30A 3QWIA 1YJ5A 2XWJI 4MW0A 4L16A 2G1AA 1IJKA 4X71A 4JEHA 1BGVA 3VH3A 3SK0A 4BPBA 4FEKA 4U7JA 4KNYA 1TNDA 3K5WA 4CR6A 2QMYA 3TOVA 3CRW1 2R751 1Z6AA 2ZDGA 5LYJA 4HAWA 5ALRA 4Y3UA 1UKAA 4EFMA 3BA1A 1PLKA 3MSCA 3CM0A 4G5QA 1SVOA 1WPGA 2FPUA 1E9RA 4TM7A 2IEBA 3HY6A 4Q9DA 3R9XB 4TQUS 1JR3A 3A31A 5BN4B 1L5OA 4MP3A 2VWHA 5A7GA 2DEUA 4GXNA 1E6MA 4P7FA 4NMLA 2O8NA 4TS4A 1BMTA 1OMOA 3F8WA 3TOZA 3WLJA 2ON6A 5A23A 5TPWB 1GKIA 1HE8B 1VKHA 2A1IA 2O7NA 2VNHA 2W83A 4PGFA 2QEQA 1MPXA 5FQOA 1X6VA 5KIAA 3T7RA 1W36B 4RE5A 1CUUA 4UHKA 1RWQA 1KDRA 1XF1A 2PQ6A 4W1RA 1YDFA 2R6HA 3RUAA 2M6LA 1Z26A 3OJXA 1KR2A 4E6EA 4C7OB 3OX4A 1WDTA 4LRTB 4KXVA 4CF4A 1DRKA 1SB8A 3A3PA 1QLWA 4BKMA 2I91A 4S05A 1G5FA 1A4RA 2M6SA 3G2NA 3TQCA 4R4JA 1JEYA 5J2TA 4RU1A 1OLXB 4CM8A 2NXCA 1D2NA 1W35A 5BV7A 2C96A 1S8NA 3NC0C 1EGHA 4I4CA 1GP2A 2BP7B 2FNAA 1D8TA 2QQ0A 4IIJA 2R1VB 4EYEA 9ATCA 3RCBA 2QG4A 4LNUA 4QUJA 3VTKA 1CUHA 3PUZA 4OP1A 4DAOA 1KIMA 1PQPA 4M0DA 4P6VF 1U2DC 3ADPA 1ZJ6A 1WVGA 1SHUX 4JLWA 2FFRA 4TXLA 2GNAA 2ZKIA 3ENNA 1WR8A 4IJWA 5ILOA 1K06A 1K75A 4RLHA 2FU9A 4OD0A 1Q3KA 3AM1A 1OX6A 2BDUA 3DW1X 1U0GA 3F9CA 3GEDA 3PGLA 1CDOA 4KO2S 1J8VA 1KY4A 2KLHA 4QWMA 2YWGA 4C78A 2O8EB 1H8HD 1NNSA 1Z75A 3AC0A 1ID8A 3P2YA 3PXGA 2JK1A 2H2WA 2PSHA 1EFCA 4UULA 1DTWA 1K97A 2LBPA 2QW1A 3JALA 4QXQA 3N2KB 3SFPA 2WYVA 4I3HA 5B6JA 1V1MB 1IVSA 1JHQA 2QTTA 4KO3S 1VZ3A 2AEEA 3K4PA 3LQQA 5F7ZA 4JO0A 1YAHA 2PRZA 3PQDA 1JDNA 3SYTA 3JRNA 3UAWA 1GR1A 4NBNA 5CM8B 4YRMA 3KR9A 4FZ5A 5KEIA 4OUDB 1VRVA 4AW9A 4BVHA 4KR7A 1QAQA 4ZO8A 3HXTA 2VT6A 2CSXA 1TECE 3A27A 2OBXA 2A84A 2B0JA 4KLZA 5TQ0A 3AJDA 3PWKA 4K9OA 4BNJA 4DR6B 4JCOA 1CSEE 2MTBA 3ISJA 3ONNA 3BFPA 1AQLA 1RCTE 1SD5A 1W88A 5ENDA 1UH5A 4FKBA 4BQIA 4QIHA 3BAZA 1I1QB 1E1LA 4IH9A 3MIZA 2NAFA 4S24A 5BW5A 3BJIC 3DDWA 1B7GO 4UD6A 3ZLUA 4H1UA 5SY4A 3LQ2A 1O58A 1P39A 1Z5UA 2I2XB 3SE0A 3PYXA 1KFKB 3I76A 2EHJA 2JK0A 3G9TA 1Z33A 4M1QA 5K1ZA 5ULLA 4RM2A 4JLUA 4W5TA 2DPGA 2QPLA 2XF8A 1INLA 2YNUA 5GONF 1ZK0A 1ZM9A 5I47A 3G17A 1ESZA 4K6GA 4FOTA 4WD6A 4EB3A 2ZXEA 5TS3A 3WYDA 1GR0A 2O8FB 3BCUA 3CLUC 2GJKA 3GD5A 2ZR9A 3JV7A 2JATA 2XDYA 3PDJA 2BFCA 3PHBE 4HLDA 4JBHA 3RHTA 5DNYB 1F14A 5KTRA 2JFPA 2PRKA 4DQXA 1NOKA 2W11A 4TUYA 4HG2A 4OLJA 1Y7IA 2CHFA 4HUQB 5DHRA 1WW3A 4PANA 4AXHA 2ZYDA 3NIGB 1KGDA 2CFRA 4O59O 4OGFA 5DGXA 1E5XA 4BO8A 4MDEA 3BWYA 1ADBA 3QRWA 3I23A 1KVQA 4ZRNA 3LYLA 3TIXB 4CCYA 4UDYX 4MVJF 1BQ4A 2ZUSA 1G5RA 3OA2A 4I1SA 4EDFA 4DW8A 2FMUA 4EW6A 4PN7A 5EJEA 1QH1B 1XTIA 2GHRA 3WMWA 1RC0A 2PUJA 4F72A 4ZDJA 2V98A 1RM5A 3P9CA 1TA9A 4U2CA 1X7ZA 4C0AC 5A4AA 3PT9A 2C7VA 5CLIA 4DC9A 3M5CA 5KNLA 1Q7GA 3FSGD 1QH0A 1NP3A 2BUCA 1I2ZA 3PXAA 4BX0A 4MRRA 5SZHB 3GLHA 5CPBA 1THTA 3OT4A 1EUDB 1Z5VA 2AW3A 3H2HA 4JC0A 2D1YA 4L27A 1FFHA 3S2ZA 1R0ZA 3NH9A 3NJ4A 4MB6A 4MKRA 3DXXA 1NFFA 4WCFC 3D4NA 1NJSA 1QTRA 1VG8A 2VOEA 1FVHA 2Y92A 1FF9A 3FNHA 5SYAA 2XNJA 1MD9A 1TLTA 3KALA 1R9MA 3KXIA 4R8VA 1MEEA 1SC6A 1N7HA 4K87A 1A2BA 4LHXA 5AM4A 4Z9FA 5JJCA 1R2QA 3HMKA 2WWIA 3MGGA 4KQCA 4KLNA 3I58A 1RRVA 2P9CA 3L6OO 1QRTA 2Q45A 4JJIA 3W5SA 4CEIB 4AJHA 4IV8A 1AUXA 2P1EA 2IYFA 4UPDA 4HEQA 2XKBA 3QMMA 2QLBA 1K6EA 2Z43A 1NYRA 3WY9A 4OG2A 4RL0A 3HWX1 3U9LA 1G5QA 2Q6LA 1Z0JA 3K94A 3QQ5A 1U4NA 1BXRA 1RJGA 4V39A 1Y7HA 3CT4A 4CT5A 4NOJA 4BLPA 4XOIA 2Q3DA 3CG0A 1TIKA 3F5MA 1X1DA 4GOLD 3FMPB 2CBXA 4E7OA 1LLFA 1PIWA 1ZGGA 2GD2A 2PUWA 3S7TA 1ADYA 2CE2X 2X77A 2J4FA 4CI0B 1QG0A 2APJA 3LWNA 4RHTA 4LMRA 1IXKA 1SIOA 2J87A 3MRXA 3VSCA 4B83A 5COAA 3IUMA 2XZDA 5CA0A 3R3ZA 1Q7EA 5G1NA 1YB7A 3AQIA 2QS9A 4IF4A 4NBSA 3T4XA 4B3MB 1GITA 3N74A 2CUKA 2A9RA 2FRXA 1OFIA 4FDUA 3G2JA 4M22A 3WQSB 2R4TA 1Z15A 2ZRJA 3QVVA 5C53B 5DLEA 3RS2A 5EOVA 4FFRA 4CMCA 1OKKD 1ZY2A 1VP9A 3NBQA 4F4IA 4OHXA 5D5QA 4MOWA 1MQ8B 4U0KA 5E8JA 1M1ZA 1X3LA 1GCUA 3R7AA 3ZDQA 1IWOA 4CG2A 4GEGA 4MUGA 3EQ8A 1Q19A 3B6KA 4B4DA 5IMSA 1TM3E 3DE0X 2R4QA 1GEEA 2D62A 3BYZA 3OKFA 3EBLA 4X0EA 5IU6A 1WB5A 2AN9A 1BO6A 3KPYA 3WLNA 4DZTA 3A0UA 1M2NA 3O2SB 2OOSA 3PXCX 1OREA 1BMDA 3LLCA 4JUDX 1Y98A 1G19A 2QRZA 4U9IS 2VBGA 4ZHQB 3JVEA 3VR3D 1N5MA 1U6IA 2ZZNA 5GGYA 3RFVA 1JF8A 3NVAA 4DYVA 1I4WA 1D1TA 1ZHOA 2FMKA 3GPIA 4ZXFA 2B4KA 4BMNA 4R5MA 4LJLA 3R7LA 3AU9A 3N1UA 1J8MF 1EDBA 4PPNA 4AJOA 1YQ9A 2GCGA 1AMOA 1DTSA 3SIRA 1EXNA 1OA0A 2AFVA 2PZLA 1MOSA 6LDHA 3DHYA 3DMPA 1RI1A 3CVWA 2R1TB 2R65A 3B9RA 1GVNB 1SWWA 3LLSA 3TQFA 3D2BA 4KPYA 5HRUA 2J3JA 1PX2A 3EVCA 3PQ5A 3QFCA 1U7ZA 3G8DA 1QO9A 3L02A 2Y1DA 4D8TA 3CLTD 1ZGCA 3DOCA 2O0KA 3FRJA 1PYOA 4AY5A 1G8JA 2EYUA 1XP8A 4QJ3A 4IVNA 5FX2A 3ADDA 4PYRA 2ZT7A 5D3MA 1XZCA 4F46A 4ZK2A 3N8DA 5BSUA 2VDUE 3ES9A 4E3ZA 3QPWA 4UM9B 1ICIA 3A4IA 4G1BA 2IFTA 2V7BA 2O1XA 2C9ZA 3KXKA 2GN9A 2G5TA 1XQXA 4KIFA 4RVGA 4TL7A 3TLXA 4D97A 1DV2A 3JZMA 4P31A 4W9NA 2R7NA 2V7QD 2GK7A 2C29D 4PEVA 1JLMA 3DXZA 3IS3A 4P32A 4B40A 5LJIA 3QUAA 4YRIA 1ST2A 2BOVA 3RFCA 3I0MA 3U48A 1PKXA 2WV9A 3NDRA 2XUGA 4G37A 3OQBA 4F71A 3PD7A 4ZAZA 3REGA 2A9JA 2YWRA 3PUIA 3WL8A 5GJBA 1D4OA 3C1AA 3BMOA 4RIHA 1W1WA 1NHGA 5AKEA 1KP9A 1PYGA 4P7JA 2CXXA 3ZC3A 1A4IA 1H94A 4HTFA 2QM7A 3TMKA 4E2ZA 1UQRA 1SUSA 2AEJA 4G8JA 5L7WA 3T3NA 1IK6A 3BWEA 4OQDA 3LVRE 5FOXA 1L4KA 4DJAA 1FCJA 1T24A 1IZ7A 2R6JA 3CE9A 4MB0A 3ZBPA 2GH1A 2BGAA 2AZDA 3GFVA 4DLZA 1DADA 4YJ2B 3A4YA 3FWKA 4ZT4A 1G55A 4KRFA 5DEOA 3L7YA 1P0PA 2CHVA 4UFOA 4TMFA 1GTMA 4XCXA 1KXZA 4PIMA 3KTDA 1V16A 4A3SA 4ZMSA 1F0KA 3FKSA 2J6IA 4R8MA 5ESRA 2EFJA 1J2YA 1ECPA 1JV2B 2O2SA 2GVDC 1L7DA 4FFDA 4NU8X 1TQDA 1EPUA 4KUHA 1QPZA 2RB4A 2HDNB 2NADA 3PRYA 3GJ4A 3MCZA 2IV7A 4EHKA 4EGCB 4P58A 5EH9A 3L6DA 5M3BA 2XT9A 1V7PC 1PG0A 2GAJA 2VXCA 2PA0A 4CMHA 4Z51A 2E4AA 3AV0B 2MOKA 5KNDD 5KOJB 1HT2E 3MTIA 1FVFA 2NU9B 1E4EA 1P75A 2C7BA 3KJNA 3AUXA 4PS0A 2PT7A 1O54A 2BCJQ 5GM1A 2X76A 3H1BA 4C2UA 3VNUA 1ONNA 4KV7A 4JOCA 4C88A 2P79A 5FJJA 3V7YA 2RGAA 5IQKA 2YC4C 3MTDA 4J03A 4A0HA 4JP5A 4Y0VA 3L7NA 3W34A 2E4XA 4PGMA 1YR1A 3OLZA 4HNAA 1HZJA 2ZBEA 3G8BA 3GOQA 1DO8A 3BAFA 1Y7PA 4CIWA 2V03A 4JBXA 2HSJA 5KMGB 3V4RA 1WUKS 1VDZA 4J0IA 3HB1A 1CF4A 2QX4A 2I2BA 1STOA 4O98A 1D5WA 1RFGE 3FYDA 3LT5A 4HO1X 2JLRA 4IDEA 4OMCA 3GGOA 2J3QA 2ZWMA 1YZKA 2C77A 4QTYA 1E63A 1SURA 2QN2A 1XA4A 2RGUA 5FL3A 3PP8A 5HIJA 4E07A 3CO0S 3LO8A 3HKDA 4HQNA 4EY5A 2E82A 5DYNA 5IFKA 2YDYA 3JXEA 1Y4SA 2UYGA 4P34A 2WUEA 1G3UA 1P7YA 4I2VA 2NLOA 3F7NA 4ZAFA 4LGYA 4DPMA 1R4NB 2EJWA 3MHTA 3G3EA 2PS9A 1KVUA 2RGEA 4UDNA 3SR4A 5IAOA 3OHPA 4YRFA 3AVXA 1K7CA 4EHHA 5FNVF 2CXHA 4MA4A 2W6ZA 1FE8A 3PGA1 4DNXA 1C5KA 2XXAA 3WWDA 4B3HA 4IDAA 3NVMB 4QQNA 2YZMA 5FT9A 2ZWRA 4D1VA 1E9BA 3CF4A 3VYVA 4OQNA 1NVEA 4DA9A 3RYIB 1B6TA 1V5WA 1YMUA 3ND8A 3PDIB 3R4VA 4TT3D 1JKIA 2JIPA 5CT5A 4AZSA 4WOBA 4CV0A 2WQ7A 3C8DA 5BQXA 2C7PA 3IIIA 4GQIA 4MRNA 4M46A 2I2WA 3B3AA 4BO3A 1VLJA 2J7PA 3D59A 1VL2A 4RZ3A 5AOBA 5EE0A 4BZQA 2Y67A 1Q20A 2RH8A 4G09A 1CU1A 4S0XA 2HB9A 3AOEA 5BV2P 1KI9A 2A2ZA 2D0OB 3KSDO 4LXIA 3FNGA 5E3JA 1I7DA 2FLVA 5A6SA 4DM4A 1OAAA 4KIUA 2WZBA 2FE1A 2NIPA 1Y34E 4R2LA 5E6RA 2LE0A 2IU4A 4EENA 2R85A 2FUG6 4I8XA 1QRAA 1VA4A 4G07A 5I3ZA 3KSBC 3CUTA 1NQWA 4O08A 3A32A 3RS5A 4CEJA 2DFNA 1THMA 4LTNA 3T7TA 2DXIA 1TYCA 4I50B 2FDRA 4P92A 1UDRA 1HBJA 1L7MA 2HA4A 3K15A 1DZ3A 2Q2WA 4Q37A 4UHFA 3O7MA 4KE9A 1GUZA 1BOFA 5IPFA 3IHKA 3QVJA 3GJRA 3K0HA 4PN3A 2J5BA 2EDAA 5K0SA 4KOAA 1Z82A 3I2KA 4F4DA 2VYFA 1G3QA 2G08A 4EJSC 4N12A 5KSZA 1U3GA 1YMVA 1RP1A 1SUIA 2H7CA 2GN1A 2IZ5A 1RQ7A 2B5WA 4FN4A 4P7KA 4RHFA 4R68A 4AJ2A 1QP4A 2KLBA 3G8AA 1RRPA 3LM8A 2IOHA 4ZK6A 1SWVA 2VCYA 1DI0A 2B25A 1DEHA 5LDGA 3THXA 3KDPA 3ZHZA 1ZR2A 5B15A 1IY8A 1Y4DE 1Y6ZA 3KYBA 5KJCA 2BI4A 3G9XA 3LPNA 3KNZA 1VSQA 1UBLS 1U2GC 3BSSA 1EB8A 3B52X 1TKRA 1Q1QA 5IZCA 3RVMA 1EWQA 5DRYA 3SQOA 3SNKA 5JTTA 2JI8A 3O1JC 1OX4A 2ONYA 3QF4A 3U7FB 3KYDB 1J23A 4PVOA 5KNCH 1DPGA 4P62A 3NZEA 2WUGA 4PO3X 5EXSA 3WGJA 1X9GA 4B43A 2FP4A 4HFJA 1JQKA 2Y0CA 2DOKA 3D6VA 4O2AA 3O3OB 2J3LA 3SFZA 4ESEA 1SXIA 4X64B 1CRLA 2OCPA 2BEVA 4Y30A 4DKJA 1DAPA 5AYVA 4AMVA 4AD8A 2O1EA 1BRTA 4GLBA 5CITA 2QVXX 3DLHA 4EEXA 4XR9A 9GPBA 5IYZA 3QEMA 4OP2A 4X7BA 3T6KA 1C9JA 2FSVA 1ODFA 2AMVA 4ZOQI 2EP7A 1N8SA 2A9KA 3MSXA 3B20A 2O7QA 1E3QA 5LQNA 2P30A 1YFJA 4RJTA 1NLUA 2JFGA 3ZQJA 4ZPXA 1KPHA 3M5PA 4PAOA 3B2NA 1IJBA 3KELA 3TP9A 1E5VA 3A9VA 3IAUA 4HDKA 1U1EA 1QDLB 4IBOA 4MQUA 4AU1A 2H06A 3HCNA 3RM3A 1SCUA 3HA2A 4PYJA 4CQLA 5JTUA 2GZ2A 1A8IA 1IN8A 1AXGA 4LWPA 1JQDA 1HG1A 4RK4A 5FBZA 1MAHA 5HBRA 4A2WA 5JMWA 3OF5A 1WB6A 1FK8A 3FYHA 4CIAA 3PY6A 4IJVA 4Q1CA 4C4RA 4KFRA 4OKSA 2YNMC 4EQZA 1HRDA 2BFFB 4NY1A 5DX1A 3KSRA 1EZ4A 5FBRB 3H4VA 4WERA 2VA8A 4IR7A 1JQEA 2M2IA 2I3GA 3F9IA 1WZ2A 3JPYA 2I4TA 1VSTA 2CEKA 2CVZA 3N2ZB 1UP4A 4BIMA 4LQCA 4N7MA 3U62A 5DNDA 3TLZA 3LCVB 4E5UA 3DPUA 1PV4A 2NYUA 3C3YA 2O2YA 3TTYA 1YOVB 1ZX1A 3FPFA 5LKAA 2QGNA 2NZ2A 2XMSA 3VZCA 1QFZA 1YD7A 2XZPA 4DZZA 3O8RA 5FPTA 3VTAA 1PJAA 4FXOA 3AHDA 1JJBA 2YZ2A 5AUNB 4WUVA 3WMRA 3M6FA 1M2JA 1T0PA 2OG1A 1N2CE 1FLAA 4E22A 1O77A 1VL6A 1P2GA 2F2TA 5IJAA 5DOZA 1AK9A 3U4GA 1G59A 3VSDA 1O95D 1HURA 1LEHA 3DFIA 2AK3A 5A2GA 2W6PA 2XDQB 3HE3A 2V0CA 4KEQA 7ADHA 4YIHA 2ZB8A 3A4VA 4GI7A 1CDDA 2JA1A 4DIEA 4DSNA 1TQHA 4MW2A 4C76A 1JHRA 3CRVA 1GO2A 4CCSA 4NSNA 4WGGA 3L40A 2FPPB 4N39A 4TTIA 4IHJA 2N75A 3TVYA 1OFVA 5BSVA 4ZEMA 2P3OA 3LZ6A 4Z4FA 3V8NA 9LDTA 3MUNA 5EN4A 1COZA 1Q95A 2CLMB 3WIDA 2Q6OA 4CN9A 2Q2NA 4UQOA 4AZ0A 1C30B 1W1IA 3MWLA 5MN5A 4NOKA 1PEKE 1R10A 4I0WB 1T9AA 3ZDXB 1XQVA 5ILGA 3WISA 4F6ZA 4FE3A 3F8SA 3RUPA 3HFJA 1QPBA 2TMKA 4L50A 3T34A 2V6GA 1KWKA 3OTWA 1L4HA 2ZSJA 1RRGA 1NN5A 1ZFNA 3PLRA 5LYJB 2AVNA 3BFJA 2L0XA 2QZPA 4KQXA 1PS8A 2XGGA 3FX2A 4JJFA 1RMQA 4X8HA 5T4EA 1L1FA 2ABWA 3VPFA 4F5WA 5JVDA 3BGIA 2W6JD 3S0JA 4AUMA 5JDCA 1B1CA 4HUJA 3N8GA 1SG9A 2TMGA 3V00A 4D8WA 1WHSA 2Y1XA 5HEKA 5LZ8A 3RASA 4HS4A 3ILSA 5JCXA 5JSFA 1PV2A 2LVBA 4RVOA 5CW1A 4EJFA 4R0VA 4CFYA 4KYUA 1QH9A 4QGBA 4X1OA 2QP9X 3NONA 3R77A 2IUYA 1JHXA 1KO7A 1TIBA 2AG8A 4FNGA 4CDNA 2CLLB 1COWA 5AJUA 4ZREA 3L18A 1DXYA 1KMCA 2VYNA 2C0QA 2RG1A 1DWPA 4LXYA 5B7QA 1PZNA 4DJTA 2JAUA 5J5CA 2VG8A 4N3GA 3K6RA 1X1QA 3Q2IA 3HJAA 1Z28A 3HM2A 1J5EB 4LF4B 5EVBA 5EUQB 1ZIDA 2FZVA 3ACDA 5AW3A 4LI0A 4LUCA 1XU9A 5J2TB 2LCFA 2P7HA 4RK1A 1PR5A 2XKJE 3D3WA 5DI9A 4ASUA 4C7BA 4CM8B 5CYGA 3GVPA 3UAYA 5I7SA 4IIJB 4JSTA 1GTSA 3IXMA 3LDUA 3H4IA 4LNUB 3QFTA 2VPTA 1WQ3A 4XIYA 1BCRA 3DKKA 4C6TA 4BY9E 3N87A 3TL2A 3MINA 3QWHA 1P72A 1AV6A 3PYMA 1VG9B 4G1UC 2C3MA 3U4AA 1BHJA 4BBPA 5F4ZA 3C5VA 1H2XA 2XF2A 3QIAA 4O02B 5EGNA 1VKJA 2VK1A 3MJVA 3OA0A 4JB3A 2VDNB 3GFGA 4A15A 3CF6R 3PHGA 3TTVA 3CE6A 4JFAA 1Z2AA 1EH5A 2A1TR 2ISSD 5LZ2A 4FUTA 3TZKA 3NKLA 5EY5B 3SD7A 5LD2B 4HB0A 4Q12A 2Q3LA 3K72B 4ER6A 1PJRA 1HX7A 1PW7A 2J85A 1UXHA 5EV6A 1LPAB 3GLUA 1Z07A 5J3JA 3X1YA 1CQIA 2EV9A 2ZUVA 1DTWB 3HC7A 3JALB 4R3WA 4KBFA 2MSLA 3AG5A 4J4BA 5JAMA 1HDEA 3F6PA 1R0SA 2R0QC 2EERA 1WSBA 2KWIA 5AVOA 4DBZA 2ZWAA 2ST1A 3GJ3A 4URVR 1PEAA 1NPDA 1UXJA 2XQJA 3HVRA 3ZDRA 2H1LA 1MORA 3R3WA 2YVUA 5M34A 1UK7A 3IIEA 1WB4A 4ALLA 2YCBA 2QRNA 3P9PA 1BH2A 1JFLA 3BF8A 4WSOA 2H1HA 2HAEA 2B69A 3OEYA 3IIMA 2XYRA 1TFUA 4XFKA 5TQ0B 4DJDC 3RRBA 1T9BA 2IEAA 4R3UC 2HD4A 4FFSA 3VYUB 1N9KA 1E1RA 1E69A 1JRLA 2H17A 2X14A 4FYVA 5EE9A 3TAHA 1ZCJA 2R86A 1E18A 4E2XA 3JQBC 1W88B 4U5QA 4MUJA 2E85A 4YAWA 2Y93A 1Z18A 5BYJA 1FSPA 4C04A 1KSJA 2ZQZA 3SZLA 5HJ5A 4HL1A 3AUJB 3AFHA 4BQRA 3QITA 3ROXA 4DPLA 1NR5A 4QYTA 2WIDA 3NI2A 4H77A 5DF1A 4QAQA 3KRTA 2IQ5A 2JHCA 2OXFA 1WJGA 2ZBGA 4MVJM 4AUNA 3MJHA 3T7DA 3EMBA 1TADA 2RIPA 4M83A 5LIPA 4KQWA 1RQRA 1PSWA 4MWGA 3TSZA 3BXGA 1JHZA 1SEVA 2D7JA 2W2TA 1QWOA 3C98A 3GAAA 2W6OA 1N2GA 3UFBA 4AF6A 3IESA 3QW4B 3DWFA 2SCUA 2DBVO 2BFCB 1TJ5A 5FJIA 1WA5A 4FZVA 3DZCA 4F92B 2DZDA 4GNRA 1Q0HA 4LZPA 1U0EA 4TUYB 1U7OA 3PFFA 4BS9A 4ZEVA 1AQYA 4RADA 4AURA 1JX6A 2A0WA 1E2NA 2WF8A 1YZUA 1FU4A 1MQAA 4NOLA 4TLAA 4AFNA 2VZEA 4CCYB 4C0LA 1HE3A 5I45A 4HAZA 3NWPA 2A9QA 4KQ9A 1JNYA 1ESNA 3A28A 3TLGA 4Y1RA 3VR6A 1PS9A 5T4BA 4QD3A 4EA6A 5CFNA 1X7ZB 4XPIA 2EFCB 5DTIA 4GMDA 1PCXA 4HDQB 4JUAA 4PC1A 2QU7A 4O5OA 1DD6A 1KRHA 4IMIB 3RU2A 4WY2A 2GBFA 5KYNA 1I7NA 1JR3D 1VSUA 3OPMA 3U19A 2IH2A 3GLHB 1DQYA 1KKLA 5KYGA 1SZJG 4WFJA 1ZAYA 1WZNA 3ZGOA 5D86A 5J2UF 4QFCA 4L0MA 2QJRA 4Z0PA 1EFHA 1OFGA 1VCMA 3IBTA 3D8NA 4RK7A 4XIJA 2CGEA 5FQNA 4DUGA 3M0EA 4DCJA 5IJ9A 3NXKA 3PWTA 1DQPA 4D3SA 3DFKA 2D2EA 1KOFA 2EEZA 2ZBVA 5DTJA 5EZYA 1NYLA 1ZUHA 3QLUA 4IIVA 4BMDA 1PVDA 2IDKA 4S3MA 2JAPA 3TW4A 2D5BA 3HVHA 1L8OA 4L3WA 4Q9NA 1PRYA 5TQVA 3ERCA 2QDSA 4B7AA 4D44A 3HL4A 4K6FA 4B73A 3OY7A 1I5RA 1BXRB 2JNWA 3DAOA 4X6XA 4F5DA 3MWKA 4OL0A 4EGSA 4UAMA 3DZBA 1B23P 5C8VA 1F7VA 2WFAA 4FYHA 1FDRA 2XOKA 3M2PA 1B43A 4GC9A 4MLCA 1DX9A 3TTUA 4JBYA 1EXVA 2IYSA 3OQHA 1LH0A 2JFUA 3B7GA 5T6BA 4EZEA 2IP2A 5HK9A 1GN9A 2WJGA 3BB4A 3R41A 1VCOA 1KJZA 2WU1A 2X0KA 1R12A 3ND6A 4TTQA 4BO9A 3C8ZA 4ZODA 5JAOA 1BEZA 3UO8B 2UZ1A 5CW2A 1EBFA 3V4SA 4LXQA 2DY0A 5CA0B 2EKLA 2O14A 4FDTA 4JXKA 4S2UA 4NDZA 3M1LA 5FUYA 4Y1EA 4KL8S 3SC4A 3LTEA 4L8WB 4C1CA 4LHVA 4PHCA 1Z83A 1VMAA 5A7HA 5FWXA 1USUA 3A70A 1OBOA 1M34A 2GN2A 2BLNA 2RH5A 3DH0A 3NP9A 3TMYA 3WBJA 4BYMA 2ZRKA 3EJ6A 5HRAA 2P3QA 2YC2C 2JCYA 3I6MA 5JAZA 1L8XA 2VKQA 2VQEB 4WT7A 4PLZA 4TZ9A 2GO1A 2J46A 4MR7A 4NOMA 2HSZA 1J00A 2FW9A 3B1VA 1ZN7A 2VNIA 1XHFA 3P96A 5HSGA 3EVFA 3Q6NA 1F7UA 1IFXA 3VVBA 4O4JA 3QFFA 1AKTA 3N9IA 1J1ZA 4ME6A 2B4RO 5EC8A 3BM5A 1VIYA 3UHAA 4U2EA 3I6BA 3ZLVA 4YAFA 5FI5A 1G60A 3OM0A 4OJYA 4QO7A 8GPBA 2ZUFA 2X15A 3LF1A 1AS3A 3G82C 3GUVA 5KWEA 3H3JA 3WYFA 1LC0A 2Q0JA 3N2EA 4QEKA 4FQ8A 3BCHA 4YAIA 3BIXA 4IX1A 2QM3A 4CF3A 2NVUA 5JNWA 1UBRS 4K40A 3TNJA 4RULA 2QN1A 2Z2KA 2IDJA 1LLUA 3LOQA 2CXUA 1WG8A 1YQXA 1FSFA 3SEFA 4AN1A 5ISMA 4LKOA 3G0OA 2WVGA 10MHA 2BD0A 1XLTC 3MCUA 3X1KA 3OZSA 3ZBTA 5K6AA 2V65A 5BT8A 2Y1OA 2VHTA 5BXQC 3ESXA 3QPCA 1SIWA 4ZQIA 1CQPA 1P8AA 4RPJA 1XAGA 4B48A 5C1BA 1NNUA 2H2DA 3AT1A 2E4YA 2BI8A 2ZSAA 2UZAA 1VIDA 1RM0A 1ZONA 2P67A 3OBIA 4M9UA 5EYPA 1S9HA 2CEAA 2NZWA 3OUTA 4W1PA 5LSAA 2YCLA 2ZBPA 1F1BA 2X22A 4LTDA 4CIXA 3M6AA 1NSFA 5D3MB 4KE7A 1QDEA 1QIJA 2Q42A 4IXDA 4K9MA 1SC3A 1TC2A 5HIIA 1N6OA 5AW1A 2OKCA 2AHRA 5JSYA 3DXFA 4NLLA 1KZGB 1QVRA 1KTIA 2ZE5A 1EZ1A 1SQ6A 1EVEA 5IJ0A 1FZTA 1ZEJA 1T2VA 2NYVA 3CKKA 1S2OA 2I7XA 1P4RA 1TF5A 2ZWOA 2O2IA 3K0BA 3BE8A 2FDXA 1PJ8A 3SEQA 4FC6A 2FFHA 1O97D 2CJPA 2VJNA 1ECCA 3GRVA 3NHMA 4BHTA 1YDWA 1IATA 2WD9A 3N6RA 5HFNA 3M3DA 4CDMA 1R0KA 3L1HA 3T1VA 3PFWO 3PHHA 4HMQA 2GUGA 2JFXA 2WQZA 2P69A 4IIUA 2BAGA 4HWTA 3BMOB 1NRXA 1RE1A 3DO6A 2AJBA 5C8YA 1E2FA 4HTFB 4HH1A 1UPXA 2X4IA 4B7CA 1KO5A 2I1LA 1OWLA 2ZLBA 5E1MA 4Z3KA 3EPJA 1ULHA 2NUAA 1GGNA 3FSJX 1NFRA 3LUKA 1UQUA 1JKMA 4FR0A 4JJ7A 3EX7C 2F7SA 1QU2A 1KQFA 3DEKA 4GVXA 2Y2UA 4NNJA 1EK2A 2XYGA 1ZH0A 3OICA 2YFKA 4UTOA 4TMVA 3D2AA 3DFFA 3OWOA 4HMPA 5AHOA 5AO9A 1I80A 1OIXA 4DMHA 3PDCA 1VFPA 4AJJA 4B71A 1V16B 4AYXA 1N6KA 1U3VA 1DKQA 1VJ0A 3I9LA 3MQ2A 4D9KA 2M1XA 1NBWB 4MRAA 2OZVA 1M2HA 1ZN8A 1IHYA 2X2PA 2IS2A 2GZ3A 1IAVA 4G8CA 5AP9A 4ZAXA 3RLFA 1SUFA 2FXIA 3OZUA 4MWCA 2P4EA 2GCOA 3EDOA 5TVKA 4EMBA 2E4VA 2PXHA 3Q2OA 4P0PB 2BRUC 4RENA 3RTGA 3NM4A 2GF9A 2X8WA 5HIKA 3QOFA 3QLEA 1E4EB 1JR4A 2HSEA 4HH3C 4G0VA 2WM3A 2VTBA 2HBYA 2TS1A 3CCFA 4YC7A 4LYFA 4WXPA 1OR8A 2O6LA 4NATA 2FM6A 3LZDA 1SZCA 3DDSA 1V3TA 3AJ8A 1VG0B 5CPFA 2VWGA</