2Q9UA

Crystal structure of the flavodiiron protein from giardia intestinalis
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
409
structure length
409
Chain Sequence
KPKYVQDQEMIPGVYWVGIVDWMVRIFHGYHTDEGSSYNSYFIDDECPTVIDSVKYPFAEEWLSRIAACCPLDKIKYVVMNHAEGDHASSLKDHYHKFTNATFVCTKKCQEHLKILYGMEKATWLIVDDKYTLKIGKRTLKFIPVPLLHWPDSTFTYCPEDKILFSNDGFGQHYATSRRWADECDVSHVMHLFKEYTANILGLFSAQMRKALEVASTVEIKYILSAHGVSWRGDAMGLAIAEYDRWSKGQHCQKKVTVVLDSMYGTTHRMALALLDGARSTGCETVLLEMTSSDITKVALHTYDSGAVAFASPTLNNTMMPSVAAALNYVRGLTLIKGKPAFAFGAFGWSNRAVPDIVAELRDGCKADVYDEKGITFKFNYTEELLEQAYNAGVDLGKRAIAYCEKNAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The O2-scavenging flavodiiron protein in the human parasite Giardia intestinalis
pubmed doi rcsb
source organism Giardia intestinalis
molecule tags Oxidoreductase
molecule keywords A-type flavoprotein
total genus 157
structure length 409
sequence length 409
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2q9uA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2q9uA01
1Y44A 5ACTA 3FJOA 3AF6A 2D5IA 4GCWA 3X2YA 2Z9BA 2AZ4A 2NZFA 5F12A 1J9EA 3N3BC 4BMPB 5FA6A 4LAFA 4FX2A 3ESYA 5HIOA 5AEBA 4NULA 3MD7A 3U7RA 4LE6A 2VW8A 4C09A 4P62A 4C1CA 4UBQA 3BK2A 1YCGA 2XODA 4HKYA 1YCFA 2BC2A 3L9WA 1I1OA 2H6AA 2NZEA 2MWMA 1KO2A 1QHEA 4EXSA 1TIKA 2BF4A 2XF4A 4HS4A 3F6RA 4HEQA 4UWSB 3NHPA 1CZKA 4DY4A 5LE1A 5LMCA 4KEPA 4YSKA 2FU7A 3W78A 3SW3A 2FHXB 2Q42A 4WD6A 5A87A 5HH4A 4GQIA 1F4PA 3GFRA 1OBVA 5HISA 1H69A 3NHKA 2F1OA 3OJXA 4QOIA 4CF6A 4J8PA 1AHNA 5KIKA 3SFPA 2QEDA 4O98A 3O73A 4OXXA 5B3RA 3RPCA 3I11A 3DHBA 5AXRA 1L9YA 4HL2A 2KLBA 4UA4A 1X8IA 2ZO4A 3FX2A 3G5MA 3RPEA 1FUEA 2XOEA 1VJNA 4FR7A 4C1HA 1BU5A 3RKKA 4EYBA 2GFKA 4YAWA 3NHYA 1P9EA 4AX0B 4CHLA 3P2UA 4N9QA 1BMCA 3TEMA 3X2XA 5LCFA 2V5VA 2R96A 2HPVA 3ZNBA 1XT6A 3IE1A 3I15A 2OHJA 1WUOA 2GSWA 3S0ZA 5EMNA 2ZKIA 3TE7A 1VGNA 4H0DA 2DKFA 4TYFA 4C14A 1AMOA 4D1VA 4BP0A 4PTYA 1YDGA 1YRHA 1DDKA 2QINA 3SRXA 2P4ZA 2QX4A 1AKQA 1A7TA 1CZRA 5LCHA 4PU0A 3NLLA 3I13A 1XTOA 1C7FA 3NHRA 5ACQA 1AZLA 5B1UA 5EW0A 3OX2A 4QOEA 1QRDA 4BZ3A 2YNVA 3OJWA 3IOFA 1D04A 3KAPA 3DH8A 2M6SA 1WSWA 4DILA 4NQ6A 4QOFA 3TZBA 3A4YA 4Z5ZA 3K20A 1QH3A 4NQ5A 2X2OA 3OWHA 2AIOA 2QJSA 4UWOB 4PTZA 2Y87A 1J8QA 3I14A 3LCMA 4ICIA 1FLNA 1FLDA 3I0VA 3HLYA 3W7AA 2YNVB 4AWYB 3PY6A 2X2PA 4C0WA 2Y8AA 4BMOB 5A4KA 3D7NA 3EDOA 2FX2A 3B6IA 4XWTA 4C1FA 3IELA 5LM6A 5TGZA 2MTBA 3IEKA 4Z6XA 3RKJA 4FGLA 2BTNA 2BG8B 4M0CA 2ZWRA 4QOGA 5FQAA 1B1CA 2WC1A 1YCHA 2P1EA 3UXHA 4QOJA 1XI2A 3B6JA 1KBQA 2BG6A 3L6NA 4FGKA 2OHIA 4EFZA 3T3NA 1JT1A 3P0RA 1ZWKA 2Q0JA 3KNRA 4KEQA 1C7EA 3IE2A 3ESZA 1OFVA 1FVXA 2Q0IA 3SD9A 5FQCA 2FCRA 1DXQA 4RBSA 3KNSA 4GYUA 3PY5A 2WYMA 2I7XA 2FOXA 4ZVMA 2I7TA 4C1DA 4FGJA 3ZQ4A 4ZEJA 4S24A 4B87A 1CZOA 1CZHA 2BG8A 3NHWA 4Z67A 2MT9A 1AKVA 1FX1A 3QFRA 4LTNA 3DHCA 5EVBA 4D02A 5EAIA 1M2XA 5K4NA 1DX9A 5F51A 1RLIA 3EYWA 2YCBA 3BV6A 1JJEA 3F9OA 4PVTA 5A0TA 5K4MA 4U7HA 1ZWLA 5KILA 4N65A 2QDSA 4JO0A 2OHHA 2V9CA 2QX6A 1KR3A 4Z7RA 2WYLA 3GFQA 5F4BA 1KO3A 1XYVA 1RLJA 2BZSA 3FNIA 4Z5YA 5LBTA 4UAMA 5K0WA 4ZVNA 2QDTA 2FM6A 3T3OA 1J9ZA 4DIKA 5ACUA 3NHSA 2P97A 4YAUA 3UXEA 2FU9A 2ZZIA 5JROA 4C76A 3KAQA 4YALA 2BFZB 2FHXA 4Y9RA 3OVMA 5LJLA 1YOBA 2QMZA 3R6WA 4ZO3A 2BMVA 1H66A 3ZHOA 4XDGA 1AKWA 4F6HA 4TZ9A 1XM8A 2ARKA 2BGAA 3FCZA 3QFCA 3B6MA 1T5BA 3N39C 4Z60A 4YAOA 2GKLA 1WW1A 2B3DA 3ZWFA 4XWWA 3FVWA 2AMJA 1ZKPA 3L9XA 2Z9DA 4D1TA 5AYAA 2CBNA 3BC2A 1AKRA 2BG2A 1KBOA 3ADRA 3ES9A 4LTDA 2FZVA 3X30A 2ZNBA 3SPUA 2BPOA 2MOKA 4ESEA 2GCUA 5EV8A 3IOGA 3K1YA 3KEGA 2FAXA 5BUCA 4NQ2A 4C1EA 2BFLA 4AD9A 2YZ3A 1E5DA 4TZBA 3FW1A 1X77A 4F6ZA 3GFSA 1SG0A 3B6KA 5NULA 1ZNBA 5ACXA 4GYQA 4UWRB 3NHJA 2N1MA 3DHAA 1X8GA 5EV6A 1J9GA 4D1WA 2GMNA 1ZTCA 2BN4A 3F90A 2FU6A 2P18A 2QWXA 4YSBA 2FLVA 2QMYA 1AG9A 2M5DA 5EVDA 2BFKA 2QR2A 3OWXA 2WYMC 2YNTB 2BR6A 2Z98A 2Z9CA 4YSLA 4EXYA 5ACPA 2W5UA 2M5CA 5LSCA 3NHLA 5AHOA 5FQBA 4TZEA 1AKTA 3AJ3A 5DPXA 5EWAA 1CZUA 1VMEA 3VPEA 1FTGA 5LS3A 1OBOA 3LVZA 5LJIA 3NHFA 4RAMA 2R97A 4YQEA 4U4LA 2QX8A 4QODA 2BFZA 4D1UA 5HIQA 4ZVLA 1AKUA 5ACVA 1D03A 4RAWA 3WXCA 1WSBA 1V4BA 5B3LA 1FLAA 4FSBA 3SBLA 2NXAA 4NQ4A 5LCAA 1BVYF 1QBGA 3QH8A 4HL1A 1A8TA 2DOOA 4PVOA 1WUPA 5ACRA 1WRAA 4XUKA 3IE0A 3ESHA 4H6PA 3JXPA 3AF5A 5ACWA 2FDXA 1CZLA 1QR2A 4TZFA 5ACSA 1X8HA 6NULA 1MQOA 2HNBA 5HH6A 2Q9UA 3FAIA 1JA1A 3N3AC 4Y9UA 3KLBA 4TYTA 3X2ZA 2Q62A 5LLDA 2Y8BA 4CETA 3W77A 1RCFA 1DXKA 4Y7CA 3ZR9A 4U7FA 4GI5A 5EHTA 1TLLA 1SQSA 3H3EA 3F2VA 4F8YA 5HIPA 1XYYA 2GFJA 4FEKA 2BIBA 5K4KA 3Q6VA 4J5HA 3IEMA 4R81A 4XDHA 3S2YA 5A5ZA 4RL2A 2R2DA 1T0IA 4H2DA 1DXOA 4EY2A 3U7IA 4J5FA 1ZX1A 2OYSA 2QX9A 5AHRA 3R2UA 3HR4A 4RM5A 3JSXA 2E7YA 2A5LA 5ULLA 5B3KA 4V0HA 5IQKA 3LT5A 4LA4A 4YAFA 4UWPB 5LBUA 4U7GA 2FVXA 4ZO2A 3KL7A 2FZ5A 2WRSA 4AX1B 5A0VA 1JA0A 5EH9A 5FUQA 1NNI1 3HA2A 2I7VA 3TP9A 3O2NA 3NFRA 4EYFA 1FLVA 3ESXA 1JJTA 3T9MA 1YKGA 5LVAA 4QOHA 4LTMA 2M6RA 3G1PA 1K07A 3SVLA 4AWZA 2XR1A 1BVTA 3BK1A 5HH5A 4N82A 2FK6A 1CZNA 2NYPA 3OX1A 1DD6A 4C0XA 2YNTA 5EA2A 3OX3A 1BC2A 5EVKA 4GR9A 2V5UA 2WHGA 3VQZA 1RTTA 2KQUA 5B15A 4ZNBA 4NLLA 2FU8A 2YNUA 4ZVKA 1D4AA 2HB9A 3PG4A 3F6SA 2HNAA 4RL0A 3W79A 2BG7A 5AXOA 4EYLA 2YNWA 2RG1A 1GG5A 4C1GA 1SMLA 2UYXA 3QE2A 3NHUA 2A7MA 1QH5A 1HLKA 2BMIA 5FX2A 5NLLA 3GAMA 3IDZA
chains in the Genus database with same CATH superfamily
1Y44A 1F8FA 4DQXA 2UVDA 5A2GA 4IDDA 3T9BA 1EK6A 2Z58A 2BFEA 3MWLA 3DTVD 1NXSA 2XDQA 1ETHA 2PM8A 4BNVA 1PVVA 3Q7PA 2JVJA 4QUIA 3NOXA 5FCDA 2W6IA 4NULA 1M5RA 4LE1A 2GZ3A 1L8QA 4HDAA 4Q05A 4C3VA 3U7RA 1QANA 1NLFA 1F38A 4L0MA 2P27A 2X76A 4FMDF 4UU0A 5DGIA 4LQDA 2ZPUA 2E87A 1XZLA 1Y3AA 2C54A 1ADJA 5JCJA 3ZYZA 4D9FA 1GTRA 3UFXB 1W5FA 3O74A 2GTPA 4DJEC 3LVBA 3A28A 4U39A 1ULTA 4GLBA 2O9JA 3RW9A 1B8OA 2HEIA 4OBWA 2Y67A 2I54A 3S6JA 3U48A 1HI9A 2ID4A 4EDFA 1KO2A 4I1UA 2BGMA 1EP3B 1R0RE 1CQWA 4ZEOA 3R5KA 4UMDA 2PJDA 4I50B 1CUFA 2WSLA 2QRVB 4R41A 4LF7B 2P6OA 3NEAA 4RQBA 1I7DA 2QG4A 3RWOA 1KEWA 3D31A 2O2DA 1RAAA 1CZKA 3AVXA 3QVLA 3GIDA 3I2GA 4XWGA 1P2SA 2QTNA 4OQMA 3ADCA 2HJSA 5B53A 3SI7A 3TO5A 1J39A 4QVIA 2QRUA 2WJVA 2XD9A 1FE8A 3MK31 3NORA 5JXIA 2BHTA 4PYJA 1PT5A 4W1PA 4X90A 3FJYA 4Q9JA 2J41A 5JDCA 4M8SA 3HNPA 5GONF 3OCJA 1Z28A 3AG5A 2QTGA 1ZJ6A 3KS9A 3CVXA 1QE5A 1VYVA 3EVEA 2VXCA 3F6YA 3OJXA 4QOIA 1GNQA 4X44A 4A82A 3SDSA 2HMYB 3BK7A 4WGFA 2JEZA 3MS2A 3M83A 4O2AF 1ZOSA 4JBLA 4ED9A 3OEED 5IVPA 2ZSJA 2C9OA 1DIGA 3KFXA 4JODA 2GT1A 2DSTA 1QVWA 3X43A 2CLMB 3EIFA 3EGWA 4N8EA 1TO1E 4HNAA 3VR2D 2HQOA 1PJCA 2NUPB 3SBXA 4RZQA 2PS1A 4C0KA 3RKKA 2GFKA 1XOIA 3G02A 3GA5A 4I5FA 4R2KA 4HB3A 1H5QA 1V1RB 4JOQA 4LNAA 4GBGA 5LD2B 3U44A 3CRZA 5CGQB 3REGA 2J0UA 3VTFA 4TL7A 2ZIEA 1DCMA 2FSVC 3NIDB 3OMLA 3O8RA 3KOOA 3LW8A 2JANA 4I36A 5D7NA 4U9HS 2IYPA 2IQ5A 3FI0A 3M9XA 4FWIB 3VOSA 5TQ0B 2MR6A 3F8TA 3KD2A 3ZV7A 1G8FA 4JL8A 1VI6A 1NN3A 4U3JA 3ECSA 1VGNA 3CZRA 1AC5A 4M9RA 4X24A 3OETA 1L5RA 3QEMB 1JFVA 1P4HA 4MV1A 4OJNA 1X0VA 1YDGA 4D8TA 4YAGA 2X5NA 1UPCA 3KLPX 1AV6A 2XB8A 3SG0A 3DMPA 1ZPDA 4XM0A 3T3GA 4JI7B 2Z1DA 1J33A 4TXLA 5K0GA 2BMEA 3EGDB 4K2AA 4L6AA 3K9BA 4IOLA 1C7FA 4KYTA 2JAOA 3V2UA 2VRBA 5FTKA 3T7IA 3M6LA 1YSCA 1LDNA 3TPZA 4DUYB 3EUAA 4MYSA 3EBOA 1TMGE 4MKRA 4FDMA 3CNBA 3LT0A 4MUKA 2IIPA 2G6TA 3WDMA 4EB6B 2ZM5A 3W8FA 2YNVA 5HHTA 1RTKA 2P0YA 1OUMA 3K35A 4HDQB 1IOWA 3M9LA 2I6FA 3PGLA 2MSEB 4P5DA 1RQXA 2ZRHA 3KQHA 1NHWA 3PI7A 2VI5A 1MNAA 2HRZA 4EQ6B 1QAMA 1P74A 2EX4A 3ROKA 3VJLA 5HFJA 1RI5A 3AHGA 3VNRA 1C7JA 1JE1A 2XWJI 4HXFB 2QZSA 3P0IA 2IEZA 1Z0IA 3PT5A 5DT9A 2B8EA 4AYTA 4DIEA 3C43A 3I4CA 3TBKA 1WM1A 1X1QA 8ATCA 1FLDA 3QKSA 3VC7A 1MEEA 3WBFA 2UAGA 1LDEA 2YHIA 3U4AA 4AJ1A 5AW3A 4G09A 3WIDA 2QP9X 4GVPA 5KHAA 4E5VA 3QWFA 2OZPA 4RX1A 1VMKA 2D4AA 3L84A 1W4CA 4MK4A 1AOXA 3AUFA 3B6IA 3B5IA 3H97A 3SICE 4CTKA 4BYGA 1F12A 1LPNA 1J99A 1Y5IA 1HM5A 5K03A 2XXAB 3GRVA 2C03A 5K0FA 1ORRA 5AKGA 4D0GA 3S2IA 2BTNA 3FHOA 1YMQA 2V4ZA 1LPPA 4CN9A 5BMVB 5J4VA 1ZXLA 1EMDA 2FMHA 3NAGA 1UC8A 2X3UA 3WLIA 2DR3A 4JV5B 5FQAA 4BFZA 4HLDA 3NHZA 2RHDA 2Q7OE 4DKJA 3VDQA 2FPMA 2AQ8A 3E03A 4IEFB 2CXHA 4JBHA 1RLUA 3CF4G 4IQ8A 1DLIA 3RAPR 1XI2A 6CHYA 1II8B 4MR9B 2ZTLA 4HMQA 3TSAA 1UDAA 1QLWA 3L6NA 1NX9A 1II0A 1SUIA 2D0IA 1EGMB 3LP5A 4GXNA 3VC2A 5JAMA 1CD5A 1Y8CA 2CJWB 2JD2A 2O14A 3G5LA 4KFSA 4KLCA 3HJCA 3Q9SA 1Y42X 1Y7LA 5LZ2A 4ZKDA 3ET5A 4LF6B 1OFVA 2KS6A 1XWFA 5B5SA 4BS9A 1S7CA 4HDSB 4ZO7A 1NTOA 2JLWA 5KNDA 3EVDA 1DKNA 3H8WA 2PTHA 3SXUB 1OKKA 5A03A 1LV8A 1BX1A 2EKPA 1JLLB 5C8YF 1DFIA 4G63A 1WW1A 4H1UA 2QD1A 5AM2A 4C5BA 1AUXA 4OHUA 3ONNA 1JTEA 1EJ0A 2XGOA 4R1NA 4BZQA 3KETA 1QWOA 2R8XA 3TOZA 3ZVNA 2NYRA 2WHRA 1NE7A 4CMBA 1ZNYA 1L8XA 1P1FA 3SF0A 1Y8RA 4F6CA 3DYVA 4ZEWA 4ZO6A 3C3MA 4CIAA 1BKYA 4FS8A 3ZJYA 4ZDIA 3DDUA 2O8EA 2C9ZA 4GLOA 3JAWB 1BXZA 1XTJA 2R5FA 3UHFA 4A9AA 3OC0A 5FTLA 1P44A 1TZCA 2JAPA 2VBIA 4PC1A 3RC9A 4CIVA 4YAIA 3HJAA 3LQKA 4FCTA 1JJEA 1CRZA 2QW8A 3DFIA 2JJ1D 1K6XA 1GUDA 4KWIA 4JI0B 2PTGA 1W30A 2WDPA 1OI3A 5H81A 4DHWA 4RDIA 3A9RA 4PY2A 2AX3A 4DABA 3W9YA 1JFFA 1A8SA 2EFJA 2P79A 4K1XA 1KFJB 3DEIA 4KXFB 1KR3A 4J7AA 2IW1A 4I2VA 5JXJA 3GFQA 4F2HA 3EWAA 1COWD 2O7RA 1U04A 2PGNA 1P91A 2BZSA 1JPJA 4JLJA 4PZCA 3VRHA 3IL2A 2RONA 3R0VA 2X5JO 4UAMA 4DJ5X 2BRUC 1A3CA 2Q9CA 1XUOA 2R6AA 2CY0A 4J0EA 2QDTA 2CLHB 4DM7A 3UXEA 5J47A 5EGNA 4IMJB 4W1QA 2HT6A 2JIRA 2YXNA 2JGDB 4JI1B 5JS8A 4ZJZA 4EH1A 1J6UA 4MWGA 3RSGA 1FSFA 4I55F 3FDZB 5GM2A 3DLHA 1GKLA 3SIRA 5H0IA 3HB7A 1RBYA 3AHHA 4MW1A 3WIVA 2B1IA 3K0EA 2IE0A 5FI0B 4EHBA 5K8VA 2C2OA 2ORVA 3WQHA 4HX5A 2OB1A 2GZDA 1TJNA 1U5AA 3ZVKA 3OOHA 3B89A 1PS8A 4I81A 4R6WA 1WKBA 4MHTA 1C14A 3WYDA 1ZYUA 4MLZA 1TECE 5F1YA 2YDYA 2YNMA 3EIEA 4NBNA 4AVYA 5HOEA 2JGNA 4YP9A 1MHTA 3MBIA 5AYAA 4DCUA 2PZMA 1NBMA 2IHZA 3FPLA 3WMEA 3P9PA 3ZBTA 2PD6A 4KB5A 5KJ6A 4QM7A 2D8MA 2BM8A 3OO1A 3QV2A 4G0UA 3BFXA 5C7LO 4D4LA 3DZ8A 4V03A 4JYBA 2PGJA 1ZMOA 3EGEA 1XJ5A 3ESBA 1F8YA 4LDRA 4Z4IA 1WTAA 3DAFA 3I37X 4OB8A 1SC9A 2F17A 5K3AA 1VPEA 4GF5A 4LKRA 5AW6A 4WUTA 5KHLB 1N75A 3RU7A 1QE0A 2ZBEA 4GOXA 1UFKA 2QQFA 4F4IA 3N75A 4KGVA 4ZAVA 3KCQA 4LY0A 3A37A 3TTUA 5G4KA 1O6GA 3PQ4A 2OD2A 5BRAA 3BD7A 4E11A 4RH1A 3G59A 1V5GA 1XTIA 1ULHA 3MTBA 1HF3A 1N5MA 2OY0A 3KAKA 5DCUA 2I6UA 5NULA 2HF7A 9LDBA 1WR8A 1Z06A 1E7MA 1NUUA 1V7ZA 4GLFA 1XEXB 4H7HA 4U7JA 3H2BA 4NX2A 5CIQA 3T7AA 1KZ1A 2XA1A 4XZ3A 3FOZA 1QYDA 5BYJA 1WO8A 3MTJA 3OEWA 4HDMB 5HE8A 1VP3A 1C3XA 2YIDA 3TRIA 5ARCA 1ZGAA 421PA 1F60A 3DM5A 3EHDA 4N12A 4OXNA 5CT8A 1M6YA 2WF9A 3K5IA 4B3CA 3NM5A 4NYMR 3ZCSA 3NTQA 4ZOLF 2PMFA 3IOEA 1E1DA 3RSQA 2PLWA 1PFWA 3D6VA 5EZYA 2Z8YA 4J0QA 3PDJA 4O1IA 3UK2A 1UMBA 4O4HA 5ESRA 3QLTA 4ZVVA 1YB6A 1SUSA 4YJHB 1Y4UA 3MCZA 3PFNA 1CUDA 3QPUA 4JFRA 2DFNA 3INGA 3GXOA 2Z9CA 2BH2A 1XQ1A 4FZ5A 3KYCA 1K88A 4BX0A 5FQBA 2JCSA 5K8TA 2I76A 2VNJA 4EYBA 5BN4B 5LS3A 1XZDA 1HT3A 3GMIA 5K0ZA 4NURA 1TU3A 3PFBA 2WHGA 1F8XA 3COZA 3DMNA 5AIBA 1QS0B 2VXOA 2WWTA 1YE5A 2CK3A 2IPNA 4Z1MD 1Q95A 1VKRA 3NBUA 2DHDA 1RYDA 4TROA 1Q1QA 4Y9SA 2LKDA 3MJVA 1G2QA 3MPUA 3ND7A 4YREA 4E5YA 4QODA 4RTRA 1G8KA 4D1UA 2EQ5A 1WVGA 4AM8A 3ZOKA 3A2MA 3F3YA 4WTOA 3MS7A 1TM3E 2JCVA 4G1EB 3D7MA 4IM7A 4KI7A 4KQEA 5MHTA 3QZUA 5LQDA 1F1BA 4R1PA 2V9PA 1SZPA 3GRCA 1R6VA 4XWOA 3H18A 3LQ2A 3SS7X 1QHHA 2VP9A 5ACRA 3KQQA 13PKA 4EQZA 1KXJA 5EHQA 2F00A 2N75A 3DAGA 3MJDA 1CETA 1PKXA 3PA6A 4LXQA 1JA9A 3PQEA 2F7SA 5IJXA 3VISA 3ZKAA 3ZHQA 3R7LA 3A25A 2GPNA 1GT6A 1TVMA 3AO0B 3NYQA 4XVCA 3T9DA 1YOVA 4HD8A 2HDWA 3IUMA 3JAMA 1CDOA 2ID9A 3KSMA 1XNGA 1WG8A 5ECDA 4BYMA 3FRJA 3HCEA 3WLFA 2ZYTX 2WA2A 1ORVA 5IKEA 5KYTA 1U28C 1PO7A 1BTOA 2C04A 3OIUA 3H2ZA 2XLCA 2Q46A 4KFRA 4Q48A 1VOTA 4RUKA 1OQAA 5DFAA 4TMVA 5A06A 1V35A 1QV9A 2HJ9A 2YWXA 1I5OA 3NDJA 4K46A 4HI0E 4U6QA 5HIMA 4A0GA 2BBOA 3UG6A 3WQBA 2OAEA 1OIXA 1R8SA 1TLLA 2IY7A 2JFZA 3T35A 3F9RA 5DN6A 3ZI4A 1K8RA 1NPDA 3F2VA 1Q0ZA 1GL3A 2BMAA 3LQFA 4WWHA 5FADA 1XYYA 3MC1A 1JWBB 5L95A 1TA9A 3IAAA 3K72B 5K4KA 6ADHA 1DBPA 2GX6A 2Y0EA 1G8YA 4PO8A 4D1YA 3PHGA 4IIJB 2V7UA 1D5CA 3AESA 2QD2A 4GOOD 4DSNA 4F3KA 3UV7A 4JYPA 4X1OA 1ONPA 2GJ9A 2HXYA 1NUTA 3AQIA 2EFCB 3G0BA 2BR5A 3LKVA 2IF2A 5EIEA 5BOVA 2YW9A 4C4ZA 3LYHA 1ZIYA 3GBSA 3T7TA 4ARIA 3TOXA 2R2AA 4IRUB 5SZJA 1YQTA 4JLSA 4JQYA 1CY1A 3GW8A 4RPGA 2JAHA 3RCBA 3C15C 5E3HA 2FMIA 1KARA 4DB2A 3IUJA 5JLAA 2FW0A 2XV1A 5F7OA 4A23A 3R7BA 3OOEA 4CEJB 3MW8A 4PNHA 3O8OB 4AX1B 4B34A 4WZBE 5DGHA 4KK3A 4AZWA 4CUZA 4JMPA 2HJVA 2QW0X 4OJMX 5CB4A 1XMQB 5CGZA 4KMSA 4O4LB 4PPQA 3OA0A 4IDAA 4PS0A 3LZDA 2RH5A 3DEKA 2V6MA 2AMLA 1EFUA 3ESXA 2FPPB 4P3XA 2FPKA 1DG3A 2V03A 3MOGA 4QGFA 4RM3A 1UZUA 3R24A 1L1RA 4R69A 3SVLA 2DZDA 4MYHA 1OXMA 1NW6A 3QUCA 1TQHA 5CG1A 1GZ7A 2TYSB 4RD3A 4YRKA 5BOSB 1DD6A 4XTCS 1V25A 3STHA 1GTMA 2IDKA 2ZXFA 4G25A 1YVDA 4QPZA 1M2HA 4JXZA 3G2HA 2DUJA 3DD5A 3IQWA 2IHYA 1QGUB 3NANA 2IY9A 3WLRA 1U11A 5C8DA 1ZAKA 3E1GA 2E48A 4ZVKA 1DMRA 3F6SA 3KDPA 4IDQA 1NR1A 2OLJA 1DRJA 3CISA 1Y5NA 5ALPA 2HAEA 5JD6A 3ZK7A 4OL9A 4YRBA 2PUDA 1Y37A 2IPMA 1U2DC 1E20A 4BVKA 3AKDA 3ZHVA 4JA2A 4YRCA 1SHZA 3ROXA 1PFKA 1EJ6A 2P90A 2PUTA 4IGKA 5CNKA 4ZOCA 1LPSA 3KFVA 4C0LA 1MGOA 4NARA 2DF8A 3HPRA 4CR7A 5SY6A 3O82A 3OU6A 5I4IA 1ZVQA 4BMXA 4E4RA 1YBVA 1ZD5A 3ZCVA 4DUGD 3LPCA 1J9EA 3N3BC 1NQWA 5ALZA 1I32A 1RAGA 1M2EA 2F48A 1L8OA 3ODPA 5FA6A 2OPHA 3RV4A 4C6TB 3FOEC 4DMFA 3SVZA 1GL9B 1NKVA 3ZZTA 1JN0A 2DQKA 1Q6ZA 2PKRA 1AE1A 2YRFA 3R3HA 3SU8A 3DTVA 1HWYA 3A6GA 5G0SA 4OJKA 5BR4A 1WL8A 4UBQA 2ODNA 4ILEA 2QRLA 2PXCA 3IAUA 4FXOA 4GXRA 5EWMB 1G5HA 2A7QA 2XCIA 3KT0A 1YCGA 2XTZA 4Z0NA 5JNLA 3NDRA 1VMAA 1EUCB 1U0SY 2DPXA 4M9UA 3WL6A 4P83A 1Y82A 2Q6LA 3PNPA 1F06A 4E7OA 2FF5A 5BRJA 2XYPA 4G2TA 1J24A 4FHEA 3QLEA 1Y33E 3GEGA 3HGMA 1J8FA 1SA0B 2WU8A 3KKEA 3GPBA 4GBMA 4N3NA 3G7NA 1EGVB 1AURA 4HJRA 3SX4A 4PLYA 5I6DA 2BL4A 2JKVA 2OUIA 4YA6A 5ALWA 3WYAA 3EA4A 1H2BA 2PX0A 2W2OA 4QUKA 3F3KA 4RA9A 3AF1A 3FWYA 3NH9A 4Q7QA 2YV4A 5DDIP 2WU4A 4W5OA 2EKLA 1CNFA 1BCSB 4EHJA 4GQIA 1Q5PA 2AC7A 1T5LA 1XRSB 1UOPA 3HCBA 4BLUA 5D86A 4B46A 4A10A 4DILA 2J46A 4LCBA 4RULA 4KIFA 3I5YA 2ONYA 3SXPA 3GFVA 1L5ZA 3ONWA 1U4SA 1L7VC 3EAFA 4OH7A 3SM9A 2GBCA 3BMQA 5GM1A 3WB1A 3N8IA 4HEHA 4D80A 5IJ9B 1PJ4A 5KIKA 4OQQA 2I2FA 2ZRAA 2EFGA 2AFHE 3LPNA 4RK6A 3ZNPA 4EVSA 1N8KA 4HL1A 4JBYA 4IJ6A 2I4MA 3OZDA 4HYYA 3BB4A 2ECQA 5F73A 1FUEA 1ECCA 1GTG1 1CE8A 2X9GA 1SVLA 2FJPA 2ZQYA 1AKNA 3E82A 3N58A 4GUAA 4I1SA 4LWOA 3JARB 3V2IA 4RKYA 3NKFA 4X7PA 4PO9A 3WGKA 3WGLA 3ILVA 1SCUA 4RK1A 3ZHCA 1BMCA 1TM7E 1Z4JA 4UDOA 4GECA 3Q12A 4DSZA 1WVMA 2DSNA 3WAKA 2C9DA 2HQRA 4CMIA 2CJWA 5C5DA 3I15A 4IEIA 5A5GA 2Z04A 3RANA 1OA0A 2HSDA 5FWYB 4DIBA 4ZVUA 3S5JA 1M0SA 2H63A 4UXJA 4ASUD 1HEYA 1XK7A 2V97A 1YR8A 1T4DA 1PK7A 1O5IA 2J7KA 1RE1A 2R6ZA 3GJSA 3JYNA 3MINA 2XRFA 4HUTA 1DARA 1JH8A 1RYZA 5M34A 5DWDA 3L7LA 2DRIA 3K4PA 1TC2A 4FJ0A 3S27A 3L0YA 1AZWA 2JGJA 3HHEA 3PIRA 1JHRA 3IMKA 5C46F 2IBTA 2IS4A 1MQAA 4GS5A 2JJ8A 1W85B 1VLLA 3K1AA 3N8DA 4L4RA 4LJYA 4MQ6A 2HY7A 4E7PA 2C2BA 1MRZA 2RHOA 3D7SA 4DE5A 5CBPA 1NBWB 4TLBA 5FL7A 5IXYA 5LL6P 4ND1A 5ED4A 2Y0BA 3GRZA 2TMDA 2P41A 3RFUA 1VHTA 1QB7A 2WRZA 2WM8A 2GYVA 3KAPA 4NCHA 1Z15A 4JR1A 1D2CA 1RPTA 3MQ2A 3BYZA 4UCXA 4QOFA 5GJVC 1WHTB 2XBMA 5IT5A 5ITWA 2X6QA 1KYWA 5KDOA 2A1UA 1D2HA 3ZI0A 3ETCA 1E18A 2C5HA 4LOIA 1I9CA 3OAAA 5GZ3A 4P5PA 3AEKA 1ISMA 2GS9A 3JD4A 3G8DA 3S68A 5B3JA 1OXVA 5B2EA 2CVPA 2NNLD 1XCGB 4HNHA 4YV7A 1JX6A 3KQPA 1UKAA 2Q4DA 2ZT7A 2LD4A 3D8RA 3PNLA 1VKOA 1U1FA 3L0CA 5C1BA 2B1RA 3RREA 1WY7A 2XPCA 3RJ9A 2QPLA 5JD5A 1RZRD 4PYQA 2F3PA 1MXHA 2YC2C 2Z4TA 5IHPA 2BG8B 4E5SA 1SFRA 3AHIA 4I1IA 3CLSD 1R4NA 2OCIA 1KVSA 1YZGA 4RE5A 1Z8DA 3R6DA 5A7FA 3ZLJA 1JALA 2YQ5A 3OC6A 3BHMA 4G56A 2PQ6A 4LJRA 2CFIA 3KVOA 2W6JD 3MAAC 4P53A 2GF2A 3A14A 2NVBA 3U60B 3WKBA 1NJ6A 5JYBA 3PGA1 3FSGA 2VCYA 2UYGA 1M7GA 1L2TA 4PCUA 2RK6A 3VOBA 2Q27A 1J8DA 3DUFA 2OHIA 1B00A 4RZ2A 4B8YA 3RBXA 3T7EA 4DY6A 1ZR4A 2LBPA 2NT4A 3BJZA 4BE4A 4TTQA 3O94A 2A9JA 5I7UA 1CT9A 2LDXA 3T5DA 4FLFA 4OQZA 3V46A 3GLIA 3AP1A 1GL7A 2JFQA 2OLEA 2WNHA 1C0LA 1ZP6A 1V71A 2O6LA 1U1GA 3L0SA 5ETJA 3KFLA 1GDTA 1E60A 4KACA 4HGRA 2I7XA 2WYMA 3MERA 2PGDA 4E5UA 5CVVA 3D0OA 1XJCA 5CX1B 1IVSA 4O4IF 1ACLA 3HXOA 1PD0A 4YRFA 1DAIA 3HL0A 5LP6A 5BT8A 5ITVA 1EFAA 3DV9A 4I7EA 4RM2A 5IPFA 2R1TA 2HIMA 1G9SA 2BKLA 1Q3TA 1QZUA 2RK3A 3GCGA 4URYR 3KTDA 4GOMD 4KXQA 3VMMA 3EYWA 2CBGA 2ZYHA 3L8ZA 5GONA 2XUAA 4NCIA 4OIFA 4AF8A 4P3OA 3I3OA 3D8UA 3QKSB 4A6PA 3AV0B 3MELA 3RK1A 5LQKA 1ZWLA 4M0KA 1VSBA 2CSXA 3UNXA 1ZIPA 2CXPA 4YLGA 3FKSA 3GFPA 4PN3A 1T0UA 2W42A 3FMIA 3QXHA 2H4FA 1G8SA 5DYYA 4DSAA 1FRFS 4L16A 5H4HA 5D85A 1D8AA 1FNDA 4D3ZA 2FG5A 4P4NA 3ZE2B 1ZRSA 3NOOA 4TUYA 4MCJA 2P77A 1EYZA 4DEVA 1OLUA 3LXUX 5EHIA 3OE4A 4IDCA 1GUBA 3SCZA 1L1QA 1QC5A 1GTSA 3JAKB 1H93A 2QYHA 4ZT4A 4Q3AA 3Q0EA 3VHXB 2ZZIA 2B30A 3H2GA 3C87A 2HEGA 1Q92A 5DLDA 2FWBA 3IILA 3JQEA 2B4TO 1NJ2A 3CLRC 4HOYA 5CUQA 1VPTA 3UJPA 5AK3A 3JATB 4I4LA 4L51A 1U2ZA 4QTUB 1KR5A 4BCCA 4H4EA 1CRLA 1NSYA 2EDCA 3FYUB 5ICFA 2Q2OA 1BJKA 2WTMA 3GDWA 3U3RA 1I3LA 2QI9F 2V74B 1YNSA 1XKXA 2D8AA 1G5IA 4ZTBA 3RJZA 4QO7A 4NYJQ 5AESA 1TADA 4K40A 5IK2A 3NZEA 3S2SA 2ZYGA 2H1WA 3LBFA 3T3EA 5JO0A 1BEZA 1W0JA 4X97A 4A26A 4MIYA 1ISHA 1LH0A 1R0SA 1TUGA 5BUZA 3SMVA 4BQEA 1M2OB 1KXZA 2RGWA 3ELDA 2R1TB 3L7OA 3KZKA 2XDYA 1D7AA 3FZYA 3UGKA 3EHEA 1K5DA 2ACVA 4EG1A 3D7KA 1U8YA 4BDSA 3JD1A 3WP0A 2C1EA 1J7KA 4LZOA 1YJXA 2JAWA 3CUTA 3IUQA 4C4TA 1OHHD 3E9RA 1OAOA 4EHLA 4E2FA 3TXAA 4YLEA 4D3YA 5ICSA 3N8HA 1X9IA 1YVRA 1B42A 2XB4A 3N6VA 2IW3A 4LQ4A 5ADUS 1E1MA 1IFXA 4GNRA 2FAXA 4NQ2A 1TOAA 2GUGA 2YV5A 5FWXA 3L82B 4RE6A 1XLTC 4KAXA 2PWYA 1EDBA 2NUTB 1PGQA 3JVIA 4WFJA 3IOMA 1PS0A 2D1RA 2ONCA 2WJ3A 1BO6A 1IC6A 3LX8A 3A1UA 3TNDA 4BVJA 2YZ2A 3SLKA 4LX0A 1F7UA 4F1JA 3DF9A 3BCHA 1G21B 3GRFA 2XUHA 4MVCA 1Z25A 4HLUA 4O1MA 4RV9A 4TV9B 1BX3A 4C4RA 1XXHA 5KOHA 3U4DA 4QUGA 1Y1TA 4TKVB 5LQRA 1ZSVA 1GY8A 2Q1UA 3DLPX 4GMHA 4Z7NB 3FPCA 4S1VA 5JXWA 2GMNA 3NB0A 2B69A 4LVNA 1VQ1A 1JHUA 4UTOA 3LJKA 4OAOA 4UD2A 4G24A 4ZI7B 4YRRA 2QWXA 3AHJA 1XTSA 1KPHA 1Q11A 1KETA 1ISPA 3OWXA 4JEIA 1FFXA 1XAGA 1XCLA 3DBVO 4LQCA 3UV6A 2W2LD 3EXFB 3EEBA 3VDMA 4JJAA 4MR7A 3N7AA 2PH7A 3UANA 5HW0A 2B4QA 2GO7A 3G23A 3BRWA 4HDCA 4I1VA 4ZQCB 5EWJA 5JJCA 4JT2A 4BZZA 4EJ2A 5FNVF 3ST7A 3USCS 1UFQA 3O4HA 1VGRA 4BFVA 4CG3A 1RXSA 1FTGA 1HRKA 1MZVA 1ENZA 3AJ8A 4NTZA 5U4QA 2VQSA 3KXDA 3D6NB 1LA2A 4YJ3B 5FF9A 3WHIA 5L45A 3ROMA 5ALSA 4DQ0A 5BWOA 2CVQA 1BIFA 5HF6A 4G26A 4G5SA 1JTFA 1P1RA 1TVCA 1RWOA 1XNHA 2QX8A 1U2SA 2ENUA 3PPVA 4TVBA 3TIGA 4J9VA 1HQDA 2PKQO 5HJEA 2VCEA 5DK6A 1H4VB 4TT3A 3PCRB 3DTYA 1ELOA 5I9NA 4CCSA 2SECE 4WN9A 5JAIA 4PCLA 2JLQA 1NT4A 2IY8A 5A4AA 3CNHA 2Z4RA 1R27A 5ER9A 2HA6A 3RODA 3GPLA 3KDSE 4XD7A 3RO7A 4N7RA 3R5JA 1J00A 4EZBA 1CS0A 1QM5A 1DTWB 3L0IB 5CDHA 2I71A 2OGWA 2V6BA 3NDBB 1R88A 4EK9A 2HOQA 5KNCH 3CT6A 4GM0A 5GJCA 4RMHA 3QH8A 5IULC 1B8NA 1A8TA 1RRKA 3ISTA 2LDBA 3UW3A 5LWQA 2LWIA 2QTTA 1YBHA 1E2UA 3BE6A 2JAUA 3C8HA 3ZX5A 4DNXA 4EUSA 4TZFA 4MVYA 5ADWA 2IF0A 3BQNB 3HGQA 4BJHB 4E70A 4CRWB 4CR6A 4TKVA 1UODA 3ZR4B 1MQOA 1GGVA 3NMUF 2JCYA 5LZ7A 3BXPA 3WXMA 1RAIA 1VHJA 2A9OA 4Y30A 5DRYA 3NYWA 3T4UA 1R8YA 4RTMA 1YT5A 1QU3A 5CDYA 3FAIA 3PHIA 4MGKR 4GKJB 1OAAA 1YR9A 2ADMA 1PQUA 1Z4NA 3QH4A 3PVSA 1Y1LA 2X2FA 1UEJA 3AJ9A 4TL6A 2BP7A 3GO4A 2I3AA 4L8YA 4P9NA 2Q1WA 1HG0A 4WKNA 4ZPJA 2IU4A 2QTWB 2VNIA 4TUYB 2PG3A 3CN7A 2P2DA 3H2SA 3OZIA 4XAQA 1G21E 2A7XA 4WE3A 1BOFA 2GO1A 1TCBA 1QYXA 1MENA 4LGVA 4F12A 4XWKA 2RCYA 4G5QA 3W9SA 2XMZA 3BJMA 5CA1B 4CLOA 5GVSA 5IMSA 1YVEI 2XZLA 1JG3A 2C7BA 3NR2A 2PMEA 1Z4LA 5DO9A 1EQAA 7MDHA 2OAP1 4MQUA 3AIMA 2O8BB 2DR2A 4R81A 3WWYA 1UOEA 3D5QA 3B1KA 2X6TA 3BFKA 2I87A 3FOAA 4RDHA 5E4TA 1RAEA 1G6Q1 1Z0JA 3HA5A 2Y77A 4UHCA 1AXGA 5DEOA 4MPPA 2WMNB 2MMGA 2YWFA 2Z1MA 1BX0A 3CIOA 3EQZA 4G9EA 3ND5A 1B16A 4M76B 5FUXA 3HJRA 3A32A 3KZOA 1U0BB 2EEZA 1W5BA 4E2XA 3C74A 2A5LA 4XB1A 4B45A 3HCAA 5B3KA 2PWPA 1PNTA 5CM8B 1QAOA 2BUCA 2BKEA 2I80A 3AF4A 3NV7A 4OP3A 1LQ2A 2Z09A 5EVCA 4V0HA 2PPLA 4UEJA 1SXJE 2H1LA 3MCAA 1JHQA 1Y8AA 1K2WA 2C3PA 1MA0A 3GJZA 1XHLA 3H7IA 4HL6A 1B6SA 5LP6C 3RIXA 4EYGA 2Z8XA 3NALA 2X5KO 5BSVA 3F4BA 4ND8B 4ENWA 1OILA 4C5AA 3QSYA 4K9SA 4NU5A 2WVAA 2ZGVA 5FUQA 1EESA 3A4IA 4QPCA 2P2YA 4U4AA 1PKEA 2Q9BA 4ISBA 1JV2B 1V8OA 4X1IB 1KI2A 1KF0A 3A9WA 5TMDA 2W2KA 3SNKA 4DR1B 3EDCA 1GZVA 5AM4A 3U6KA 3F96A 2ZWOA 3QVTA 2VAXA 4ML3A 5ESDA 2VHJA 3H5NA 1E6LA 3BK1A 2WZCA 2ZBRA 3LNTA 5A62A 2NGRA 3CLUD 3F8WA 3PHBE 1J2EA 4Z53A 1OLSB 2GARA 1QPBA 1XPRA 1QV7A 1I30A 2PRKA 3D5TA 3PGXA 3IBCA 4QDUA 4KH1A 4PC3A 3RIHA 2YNTA 5EVKA 1XF9A 4MW9A 2CXSA 1FSGA 3VR4H 5C0OE 2LR0A 1NQTA 1PF7E 4WCDA 4KFCA 1CG6A 3JU3A 4ZAXA 1B2RA 1YDEA 1AKYA 4IMIB 5K2OA 2FU8A 3QVGB 1ND6A 1P1IA 3C48A 2VT7A 2RI6A 3DC2A 3K0KA 3IMGA 1OWLA 5CB8A 2BG7A 4XUGB 3DJYA 3LNCA 3NAZA 3R8XA 2L82A 4RLHA 3SS9X 2C98A 3NNNA 2XTJA 4KR6A 4UM9D 1GZSA 3OEHD 1OLOA 3VFDA 4C0AC 3R6TA 4ZEXA 1U7WA 4HVCA 4E07A 2R00C 2DCMA 1H85A 4HDKB 5ALUA 2B8WA 1X7YA 1K27A 1R15A 2R8EA 2YJ4A 3FYSA 3S1AA 1FF9A 4MW5A 2C5LA 3PUKA 1F1JA 3R7FA 2HJGA 4DCJA 4QQ8A 4BMPB 4J2HA 4IXTA 3IH5A 1NC1A 1YQWA 2PD3A 2YXBA 3SBDA 4TWAA 3SXUA 2ZB7A 5DCLA 3WSVA 4N76A 1K2VN 3R9WA 2GZMA 2AG5A 3EX7C 2PL5A 3NPAA 4AAYA 1RJ9B 5DBOA 1H05A 3GUVA 1ACMA 1TJ4A 1U80A 1LSJA 4RIFA 2C2MA 1YFZA 2FZLA 2XODA 2ZVQX 3BGVA 3FPBA 4QDJA 2P2LA 1LDBA 1N5LA 4PLFA 3UFXA 2B8TA 1WXDA 4OUKX 3O95A 3RFCA 4AKGA 3KYDA 1LDMA 1TO2E 1VC2A 2XOKD 4M3NA 1PSDA 1P29A 4XEUA 3F49S 5FBKA 5FI3A 4B84A 5HGXA 5LOVF 2M5CA 1I3CA 4WVFA 3OM1A 5D7BA 4Y2GA 4O29A 3CX7A 4HS4A 4OK5A 5BVGB 3AUXA 4BEWA 1G8HA 2VH2A 3M33A 4J0GA 3W05A 1R66A 1XJ0A 4J3FA 1CYEA 1I3MA 5GOZA 1GZ3A 2O59A 3QKUA 2JL1A 2UYOA 3OLXA 4RGYA 1QIJA 2P8JA 3OCXA 5DTQA 4BMNA 1RKBA 1EIWA 3QI7A 4WD6A 3DCNA 4LJAA 2XKAA 2D74A 3JYPA 3A8TA 3VYTB 2B21A 2IV7A 4QUBA 1AIPA 1UIRA 1H3EA 5DXFA 5HISA 1GVHA 2G9UA 2BE9A 4CCYA 2DXIA 2Q0XA 1X8JA 3U3JA 3B1ZA 3EZ7A 5F76A 1SH7A 4PRLA 1Q57A 3AR7A 3UA4A 2O7QA 3VSBA 4RTJA 3P45A 3R8FA 4TWBA 2CMHA 5JPCA 3U40A 2HXGA 1CEYA 1U0LA 1Y1KE 3THXA 3MVEA 3FWKA 1DJNA 3RLIA 4BLTA 3FCEA 1CUUA 2FA9A 1NM5C 1KSGA 1C3OB 3SOPA 5KTPA 4DJFC 1F2UB 1P8JA 1HT2E 1ZMTA 3PZRA 4OJQA 5LCFA 3WNDA 4FNMA 4JX9A 2WKQA 3I0MA 4F4CA 1MAWA 3JQGB 4HZUB 2R7MA 1TB4A 1VECA 5EIOA 1BS2A 4E1BA 2OQIA 4NESA 3RRNA 2COEA 3MGGA 2WWIA 1OR8A 4TRNA 5FQOA 2VYCA 3DE5X 3V8NA 5J23A 4X20B 4P7BA 4RF3A 3RYCB 1RKVA 5FXMA 1K4MA 2DBQA 3IAHA 5DYIA 5CEEA 1F9AA 2CKMA 1XEFA 5FEMA 1DDKA 4EMTA 4KK4A 3VH1A 1W2GA 4HAIA 4JH0A 2Q9AA 3NONA 3GNSA 4NCXA 4US1R 4GPEA 3L0ZA 5E95A 2AW3A 2NSYA 4ROSA 4KQCA 1P7WA 5AVXA 2PUFA 1FBTA 4V3BA 4M86A 2JHFA 5KHOC 3K6SB 5LCHA 3CZ9A 4EL5A 2JS7A 1H4QA 5CA0B 4JJFA 1BGVA 1D4OA 4MIKA 3RG8A 5IAJA 2EFEB 4NV0A 3GMDA 1PT7A 2B5WA 3VO2A 2WU3A 3PWTA 5IM4F 2V7XA 3ZLTA 1F7VA 3A36A 1L4HA 4I8IA 3FD8A 4UPDA 4C4PA 1J2RA 3MLBA 5J40A 2R00A 3ZDQA 1Q0TA 1C9JA 3TZBA 4Z5ZA 2VJOA 1E1QD 2OSVA 4Q3OA 5JMTA 4F21A 4QLOA 2NZXA 4AS3A 1N6OA 3QEJA 3FVTA 3OM9A 3AY6A 4J75A 4OBEA 4YROA 3U7JA 5K05A 2YXEA 3FROA 2UYCA 3GQVA 4ZVSA 4PTZA 1ZD8A 2C20A 3KTFA 4OREX 1TYBE 4F3RA 3ROEA 1IM2A 4CM8B 1CIVA 1E99A 2Q5IA 3SE0A 2OHXA 1SOAA 1PCXA 4IRMA 1MC1A 3PD0A 4Y2SA 4CXMA 3ZE7A 4B76A 2RGGA 3L8GA 4PC6A 4DR3B 3O4VA 1Q2UA 2P0AA 3KQTA 3R77A 1UJBA 4QGHA 3T4XA 2YV3A 4DR7B 4FP9A 2ISQA 5AIJA 1GCGA 5C8XA 1KVQA 4UHEA 1VJ0A 4RBNA 2CVOA 5AKEA 2C4TA 3A0UA 1CR1A 4FGLA 4FQ8A 1WXQA 2EW1A 2XIJA 3R44A 4ARCA 4L02A 2JIZA 2L17A 3O4IA 4MQ4A 4Z7QB 4ZQBA 3TBFA 2VP2A 2NO9A 2PH1A 1DAOA 4Q9DA 1GAQA 4Q47A 4UMEA 1FNBA 2GN6A 2W2VA 3C3BA 3V6LA 3PFGA 1V95A 2Q7DA 1BW9B 1P4AA 4WFQA 1HDXA 3SQMA 1OBFO 1TFRA 1LFAA 4IOJA 2V0CA 3HN7A 5TVGA 2O2GA 1AGPA 2VYQA 3DNPA 3ZJTA 1JT1A 3GVHA 2GEKA 4LBZA 4W5QA 1ZWKA 3Q3JB 1H3NA 1RACA 4OKIA 4URVR 2FPIB 4JROA 4BQRA 3IULA 2VDVE 4UHKA 3LTEA 1E9FA 4FHFA 5B7QA 1YUNA 4TPKA 3JZAA 4A6XA 2PUGA 2XTNA 3C8UA 1LK5A 4NMMA 3W6OA 5BPFA 2FSHA 2I7TA 4S04A 2XA2A 1JKMA 3EQ7A 4OV6B 1V47A 4YUZA 1NA5A 3SIPA 1WBBA 1LVGA 3K53A 4P2GA 4M8LA 3GFTA 4JI6B 3MMSA 1W76A 2F8SA 1XTOA 3AYZB 5CTJA 4RCYA 1N4AA 2PCLA 2BVNA 3DYBA 2Y27A 3VOAA 1QO9A 3CMMA 1DX9A 3OP4A 5D87A 2PXHA 2EFHB 4HLQB 3GFBA 2QZ4A 1V5WA 1VCHA 1UDXA 4DM3A 4M9SA 3COSA 5HRUA 3CZAA 1DIOB 1IZ8A 3NP9A 1T13A 3N53A 4QARA 5KOYA 4B4DA 5DCYA 1HDIA 3TNLA 3LECA 5AW8A 4WASA 1G20B 2D7JA 4MUAA 3ZJ4A 3ICEA 3P9YA 1VBFA 2Y92A 1Z8FA 5B55A 1M8FA 1GDHA 1KO3A 5A4MS 1YTUA 2ZWMA 4Z5YA 5JEEA 3LBAA 4X1KB 3VR6H 3RTAA 3BVPA 4RH3A 1SCQA 2CNKA 3CW9A 3N2GA 3OE5A 4PWZA 3BIXA 4WGGA 4MV6A 2BFOA 1I2ZA 3P2KA 4K6CA 4KPUA 5EKXA 1U6JA 3B70A 4S35A 1NIPA 2X40A 3KKZA 2BM9A 1SBHA 5T8KC 2RKBA 5KJEA 3UGTA 5MFZA 3N76A 4D82A 3SHFA 1TTHA 2XNKA 1ZEJA 5DSTA 1KAMA 5GPBA 3K73O 4L5CA 3JZIA 3HDQA 4YI5A 4C0HA 5IXSA 3PFCA 1Z63A 4RKQA 3AI2A 4KN5A 1QCYA 3RD5A 3WIEA 1H3FA 2WTXA 1ZDMA 5F64A 1T5BA 3GLIB 4G8DA 2CDAA 5B6PA 2Q28A 1K86A 3IR7A 1OX4A 5DWQA 2BHNA 3D6MA 4YCLA 4NKRA 5J9FA 1ONSA 3ZIDA 1YI0A 4NCBA 3L9XA 2FDRA 3PHHA 4BZWA 4NNOA 4E88A 1W88A 2H51A 1DCKA 5DM4A 3ES9A 5CA0A 1OH6A 3PNQA 2X0RA 1ECBA 3RFTA 2IHUA 1H6CA 2POCA 1IOVA 3HDVA 1VB5A 3GH1A 2BEUA 5ED0A 2F4VB 3BMNB 1LLCA 1YMVA 3CLHA 4HS9A 3UTDA 4BNFA 2FUNB 2ZIWB 3HPQA 1M72A 4DCGA 4OHXA 5EV8A 2HK6A 4B6OA 2CXXA 1L1EA 1UPFA 2WBLC 5DGCA 3PYMA 4JBXA 2QUAA 3H0CA 2E1PA 2YZ3A 1VG1A 3SEQA 3IALA 2DWPA 4TZBA 1IUPA 4NAHA 4R1LA 1KJJA 1P1HA 3RT7A 3ZIUA 1PWYE 1ZMRA 4TTSA 2Q6IA 1KGDA 3FFBA 2WLSA 2IZZA 4R98A 2V0NA 4REOA 3HKCA 2GZAA 3U3ZA 2J4DA 4ZCMA 2I7CA 1SCNE 1QNFA 2AR9A 1W0KA 4P0TA 5IBRA 1QG6A 5LC1A 4E6EA 1QAQA 1RHKA 3PQCA 4HLCA 4DBLC 2LIVA 5K99A 4G3XA 1YS4A 5EZ5A 4R6XA 4G1BA 4KDFA 4WXMA 3C8DA 5HTKA 5IRCD 4F3CA 3NH6A 3T06B 4LK2A 1EH5A 2AXEA 4QPNA 3KHKA 1PYGA 3N2IA 4ZYLA 4HR7A 5HMLA 3EQ6A 3TQRA 1W36B 1NI3A 3UUGA 5A23A 3DXZA 1T2CA 2B37A 3K0FB 1ZEMA 4E2ZA 1XEWY 3NAQA 1XD2A 2HWYA 3D2BA 1P45A 2R66A 2QR2A 2BFKA 4W7SA 4QJBA 5K8IA 2FETA 2HSGA 5F3DA 2BR6A 1GPWB 5J2TB 2ZRLA 2ZSUA 3AJRA 1QH0A 3LBNA 3T7CA 1F0KA 4OMCA 1HYBA 1EUQA 5JV5A 4R8KA 1AKTA 1A5ZA 1OE0A 1AN9A 3AR5A 2C57A 3K0CA 5LQNA 1PQWA 3EXAA 4DXAA 1ZK1A 1SC1A 1Q0UA 2WYHA 3KEQA 3BZBA 1EVJA 1WCIB 1DEOA 5KNBA 2EW8A 4AUEA 1QHIA 1E3WA 2F1KA 2YWGA 3TNYA 1Z0AA 1L7BA 1VLJA 2IZOA 3GBVA 4L72A 3D4LA 3GDFA 2NU7B 1CR2A 4KKXB 4MW4A 4WFKA 1JHVA 4GC9A 4L57A 2KLHA 2DQ4A 4EAQA 4RJTA 4ZT3A 1FQJA 3U44B 4GI3A 4O4IA 3INYA 4OHFA 1Z88A 1AUOA 1WPQA 1BWRA 3PSHA 5CVDA 5I5GA 2W70A 5U9CA 1RYMA 5E7MA 5C53B 2E37A 4LRXA 4P1ZA 4ILKA 3TOCA 3HVIA 1V8PA 3TLZA 3IV9A 1C41A 4F06A 5FWYA 2HM7A 1PVDA 1SG9A 4TQUS 5GGYA 2IH2A 4LPSA 1M6VB 4R2HA 2PZJA 1BU8A 1K7XB 1YJAA 1WRAA 3IE0A 5LYYA 3I09A 1PGJA 1SHUX 4Y1RB 2WE7A 3IP7A 5EP2A 2C5GA 2G83A 3ZGOA 2P4HX 1X8HA 3I2KA 3FYDA 4NBTA 4RMIA 1Q84A 4JI8B 1E3SA 2BT4A 4XPIA 4UBKA 1OF1A 5BSKA 2AZTA 1IMOA 5FLYA 3WGNA 1UKCA 3I5MA 2Q62A 4HWTA 5K3FB 2QG6A 2EJWA 3SZGA 5BWMA 2OOKA 1HH4A 2DT5A 1T29A 4UEOA 2R2GA 2PYIA 4YAEA 5ALDA 1SURA 2AE1A 3PP8A 5IYZF 4QZVA 4K8OA 4O02B 2JZCA 1P4GA 5JNTA 4HAVA 1IN1A 1GIAA 1T0HB 1DX4A 3IAXA 4EHFA 4RHEA 1Z0KA 3PGVA 3H11A 4RZUA 4WVLA 4NPAA 5FTJA 4C2BA 2B7BA 1X1BA 4E1AA 2GFJA 3TR0A 4KR7A 1V2HE 2ZB4A 3D0QA 3IBFA 1P0IA 2G1UA 3E5RA 1BKSB 3IEMA 3LSTA 4ZXPA 1R0YA 1UWCA 1FOEB 1WB5A 3CM0A 5CFZA 5ILOA 2JFWA 1F48A 2CMKA 2HIAA 1FP4A 3L8CA 3TMYA 4H6XA 4QHSA 5IDVA 4EKNB 5AHRA 3RC1A 4A8JA 1NMZA 3JSXA 3RT1A 4B6SA 2E7YA 4V2UA 5TQVA 3SKVA 1N0VC 3EEYA 5HKLA 1CX9B 1I51A 3HCDA 4YDQA 2DE0X 5A9TA 4Q34A 1ZISA 2OE2A 3A9UA 4PPGA 2VPTA 2ZIGA 1DDIA 521PA 3SF8B 4LJ7A 1VSVA 3I01A 1RJGA 2E4UA 3P0FA 3TLAA 3IUNA 4Y6GB 3RRXA 1E9DA 2QP3A 3FRIA 4RK4A 3UCFA 2Y1LA 3BL8A 3M6VA 1PL7A 3CCBA 4MVJF 3HA2A 5CD9A 3G1WA 3NFRA 1T5IA 2I22A 2Z5FA 1Z5VA 3DEAA 1BNCA 5E2BA 1JWLA 1FQKA 3LU1A 2AS0A 1I10A 2ZRMA 2FSGA 4MWBA 3DJFA 1A95A 2P3OA 3KOUA 3TTYA 2H31A 2C59A 5G4KB 5JVDF 4DDMA 1K07A 1BVTA 1O9HA 1S96A 4J76A 5EJ2A 4F56A 3L6EA 2XVZA 4ESHA 1QTRA 1YQXA 3OX1A 1YO6A 3E5MA 3U26A 1G3UA 3WV4A 3IPXA 3EGIA 4CIXA 5TXGA 3NYIA 4IZIA 4O33A 2H1RA 1GTL1 2C99A 4EKDA 4AWXA 1KK2A 3R5FA 4YASA 5B15A 7GPBA 1JU3A 1T1RA 2Y1KA 2BD0A 1K1EA 2ZBPA 1PNOA 2QN8A 3F8SA 3G8AA 1HLDA 3JQ7B 4OHOA 1TJ5A 3UMBA 1IU9A 3HY3A 3W5JA 2AEJA 2DHCA 4Y2HA 1BROA 3EIUA 3W79A 5I48A 5IF3A 2O2ZA 5BQXA 4HFNA 1CB7A 4C1GA 3LFTA 3HJHA 3LUDA 4H6VA 1CUHA 1H1LA 4FMBB 3RNLA 3K2IA 3FYHA 5IEJA 4DBZA 1ILEA 1Z47A 3AUYA 4M8NE 1TNDA 2EFYA 1OAOC 2EEPA 3M82A 2RGUA 5EJFA 5SY9A 3TQQA 1ZOLA 3U7QB 5JMPA 2P9QA 4AFNA 3FJOA 4NG5A 3EPHA 2ZB2A 3HSKA 3DZGA 3P9IA 3C3CA 2ZTSA 3VMFA 1GYRA 3NNSA 1VLZA 2CJXA 3PC3A 5CDTA 3A4TA 4JN6B 5LZ4A 4MRAA 2IRWA 4BUJA 3LHDA 3CZ5A 3MJFA 5AHWA 3VU1A 3F1LA 3SF8A 1KDOA 1XRPA 3C8MA 4D99A 2D4HA 4XKJA 3NFYA 4JC5A 3OD5A 3HUDA 4JQZA 3RUIA 2ADOA 3VHRA 2OBBA 5ERXA 5JNSA 4UVEA 2WU1A 3CR7A 4ZEVA 2XMPA 2AFVA 3KU1A 1QYRA 4I4TA 4IJQA 3VAYA 4ARUA 4CKEA 2Z2IA 3A27A 1GPLA 1I9GA 1C8KA 3P2JA 4K9OA 4QUEA 3WL5A 4NCNA 3TZLA 2WHQA 3AEXA 3DW3X 4AKTA 1KY4A 2Z6AA 2OENG 1OREA 4RIGA 2FPOA 3C5VA 3KB2A 2F3QA 2VQ6A 3ECAA 3PXCX 1KHTA 4AW9A 1OWOA 4M1TA 2K6GA 3IT3A 3T9EA 1B1AA 4FI3F 1JEQA 3JQPA 4RXMA 3K70D 3QU2A 4UWSB 1GPDG 1H2RS 3GCZA 4E5PA 3PWSA 5KSZA 2RGXA 4MVJH 4MWZA 5LMCA 1PJZA 2FU7A 3ADPA 1OZGA 1E66A 1X7WA 2AEMA 4M1KA 1UXKA 4M55A 4MUIA 3VPHA 1GUAA 4M53A 4QXRA 4DXDA 1M6WA 3VAAA 2Q42A 4AV7A 1ODLA 3BGDA 1NBME 3OLQA 4N48A 1Z29A 3QLJA 4V2IA 2A0FA 5KTRA 5LNK6 3MMPA 2BISA 1VZ3A 2VRCD 3HFGA 5K0JA 1X9HA 2F1OA 2VL7A 1G17A 1TPYA 5ICMA 4DCMA 1XALA 5EXDA 3UJCA 5JNUA 4DLNA 4NBKA 3O92A 2A5YB 3L0DA 1Y8QB 3PL5A 4PYOA 4AU1A 3ORFA 1CVRA 1EUDB 3FGOA 4KMMA 5DM2A 5JMWA 4GMKA 4C4OA 4OHPA 1SM4A 2PMDA 1E2MA 1QP4A 4NZMA 1P5ZB 1HGXA 4MUHA 4Q1AA 5AW9A 4LHYA 2R6GA 3OZCA 4LXYA 3RPEA 3TSWA 3TYXA 3ZNOA 3PEYA 5FJIA 4DNQA 4JLWA 1Y4DE 4N3AA 4PFJA 2IWHA 5I7VA 3QBTA 3ZGXA 3H11B 4GSYA 4PFSA 4N7JA 4O63O 2CG3A 1X14A 3OJFA 3ORQA 3PC6A 5DHTA 5SYMA 3ZXIA 4GC5A 2OXTA 3A0RB 1OFHA 2XT6A 1E61A 4ZREA 3O03A 4A2CA 2BFNA 3G13A 1R12A 3O7MA 2JLSA 3EWNA 1NBAA 3HFRA 1DC6A 5B2FA 5AVTA 1T9BA 2QL7A 2H4HA 2OCAA 4OHZA 4W4TA 4TYWA 1OFTA 3KB8A 4H0DA 4KU4A 3Q8LA 1X1AA 2HADA 5LDHA 1E9SA 2J48A 1LBSA 1K7EB 1GQ2A 2Q5JA 2J9FA 1Z5WA 2OC4A 4IIJF 5LQCA 2O3TA 3DXYA 2P3SA 3FWPA 3O8OA 1VB3A 3OT5A 4TTPA 3ANTA 1AKQA 3NIWA 3WNCA 1YGPA 3WOVA 4E13A 4QHTA 2PX5A 3GVIA 3AJAA 1FTQA 3I58A 1K8ZB 4LF5B 4B3GA 3T5BA 2WM3A 2AH5A 3JZMA 4U9IS 1EVYA 2AF4C 5AIAA 4C43A 3E27A 2ODWA 1T8WA 1IHYA 3FKQA 4IDOA 2IHTA 3SQLA 3V8MA 4BZ3A 2EJCA 3IDQA 1SIOA 1VHLA 5EZYB 1IZ9A 5AK4A 2JIOA 3GFGA 3WB2A 2QUKA 5BT9A 4PXAA 2J3KA 1CKEA 1GU1A 3H8JA 3LUJA 3LWBA 1UZLA 1JVSA 3VVBA 2PR7A 4ZK6A 1N6NA 1TM5E 1AS2A 4MI6A 2BAGA 1RYBA 1QQTA 2VF5X 5LCXA 5I7RA 3MOSA 2WZDA 4PAWA 3RJ5A 2Z5VA 3A6HA 1G21A 1HQKA 2YY5A 1HOXA 1F8GA 5DNWA 4DIMA 2O52A 4NBVA 5KOHB 1SXQA 2XDQB 1AK1A 2D2VA 4HEJA 2ZYDA 4BLWA 4XGIA 1M8KA 3HLYA 1WXWA 2FQYA 5CM2Z 2C8JA 3AKEA 5TARA 3Q87B 4C0WA 4IHQA 1Q0HA 4M1MA 4N0PA 4BNGA 3MHTA 1O0SA 4KSYA 2VYFA 3UYKA 1HYHA 3S8EA 1UC5B 3UHJA 2MINB 3GT3A 5KTSA 4YXFA 3C5HA 1UBNA 1TZMA 1YR7A 3K9LA 2GCEA 2J3JA 2HA5A 3GHHA 1CJVC 1WCWA 3GMSA 4AS1A 1FX0A 1ZNQO 2OILA 4IFTA 4KQGA 3ONDA 4UPVA 2BY4A 3E4DA 4Z6XA 1DAGA 2GAOA 1MTOA 2EARA 1RRCA 2W6MA 1FP6A 3TIXB 3PA8A 4EX6A 2D0PB 2GILA 4E5DA 1EXWA 4YRIA 3LOUA 1AX9A 5F5LA 1EFRD 1U0EA 3HVRA 2J67A 3IAM6 2O5VA 2ZK7A 2HLPA 3EODA 3O21A 2WEKA 3A7DA 4LCJA 2XW6A 4PSUA 2C5AA 5TQ0A 1TK2A 1VFPA 5M2QA 5JWHA 3N0TA 4AY4A 2PBLA 2WAOA 1BMFA 4FR2A 2WT4A 3Q2OA 2ATIA 4XDZA 5JYDA 1ATIA 1NFFA 2WF8A 3C39A 4WESA 3RGWS 5PGMA 2VRNA 1N9GA 1QF9A 3MTGA 4LGCA 2KJQA 1SUFA 4M8IA 1G5QA 3K0AB 3V48A 5LSAA 1Y9JA 4NDZA 4YIKA 4KEQA 1TZBA 4G5GA 1LDYA 4BO6A 4DA6A 4DCOA 4HQKA 5GAJA 4ZEMA 4RK0A 4IIXA 1TQ6A 4JJZA 1Z2OX 2FCRA 4KHPB 4RBSA 2XQKA 2Y05A 3AM5A 2WWGA 3BH6A 4RHYA 4EPTA 2ZIXA 3KR0A 4GYUA 4MLCA 1UOOA 1A2KC 1RWWA 4ZZ0A 1ZK4A 1Z6PA 4QRDA 2GA8A 4QFMA 3MFQA 1PK8A 4DV3B 2XKJE 1T9KA 3IUPA 3RFFA 2GRUA 4PSAA 1UK9A 3NHWA 5DHRA 5THXA 4ARSA 2BHRA 4M38A 3DFFA 4LJLA 1UBEA 2AFRA 3WE7A 4W5NA 5BSRA 1UBCA 1UK8A 2B7CA 2WJHA 5EPOA 3VSAA 5CCDA 2F3RA 4TTTS 4XIIA 4DTIA 5TMPA 5CNIA 1TYEB 3QPBA 4QTXA 4ZOBA 3W2FA 1L3IA 1OPRA 2NIPA 3ED1A 5CFPA 1XVUA 4LVUA 4NL4H 5SZKB 2QLBA 4POOA 1M74A 4GZMA 4WZBA 1WUYA 3G2OA 4I1OA 2WLTA 3TTXA 4I9FA 2ZCUA 5DTEA 4L3WA 1CLEA 3BE5A 1JTVA 1WB4A 1EVIA 2HZ7A 4L28A 4M0FA 1FDVA 2DY1A 2ZM6B 4QU5A 5AKIA 1C0EA 5JY6A 4D0SA 3IB3A 2WG2A 2G6BA 1MABB 4C1EA 2FZEA 3DS8A 4CFYA 5DM70 4LJ5A 1YR3A 4CFZA 3CRNA 3HBJA 3ZWKA 3L1VA 1RM3A 4BXOB 5K0WA 1KNQA 4PBTA 1RQPA 1JAYA 3EC2A 3M1YA 3BD6A 4XW2A 2XYRA 5FHQA 4B83A 2A0YA 4D97A 2VSFA 1ND5A 5AMXA 5JYEA 2FU9A 1T3GA 4L9AA 5BSMA 3ZIAA 1MB3A 4RF5A 4HFMA 1CY0A 3HB0A 4L3OA 3A6PC 1GPKA 3D54D 4LYDA 3PUZA 3CH4B 5AJHA 3R41A 2C5SA 2GZ1A 2KB0A 3MLAA 4KQHA 4DWVA 4CMHA 3OLZA 2FH5B 3U1BA 2BGWA 3DDWA 3KJGA 4DCSA 2IJGX 3LSYA 2OBXA 3A7EA 4HDSA 4O2BA 4BFLA 2FP4A 3EOBI 1VGQA 5BNWA 1M0EA 2VZ9A 1AS0A 3F6EX 2YUIA 5EQDA 5C1DA 2FOLA 2AMJA 5IJ0A 3UK1A 3VYWA 4DV2B 3PD7A 5JSZB 2FX5A 2Z9DA 2C4KA 4R8LA 2CBNA 4G0MA 4E5NA 1KEKA 1W35A 2RARA 1NN5A 1VPWA 4KR0A 1I7NA 3TSYA 4YQZA 4A0FA 2LCFA 1PX2A 2NQ8A 5BV7A 2FZVA 2I66A 4PX9A 4IJWA 5TMEA 4OQNA 3MJSA 1L3CA 4R8SA 5LOVA 5T4FA 3ROFA 5IC4A 3CINA 4C1BA 4F2WA 3B1FA 3KR2A 1XQ9A 3URMA 4MVWA 3TDMA 3IMEA 1SOWA 3OM0A 1XCOA 4IH9A 2IXEA 1FPQA 1UJ2A 2J3IA 3THSA 2HSEA 4PC2A 3FW1A 3GUCA 4RQUA 1HNZB 2QTFA 3RKUA 3B2EA 1CUEA 1FNCA 5BR1A 4RFSB 4I9NA 2NUTA 1JQ3A 4M1EA 2DPHA 1P1BA 3LIPA 3GEPA 5FPHA 1UBRS 4Y18A 4YP5A 4FB5A 5HKOA 4Q93A 1T0BA 2HSZA 3UMMA 2O2XA 2PT5A 3HUFA 3WLSA 2QAJA 1LBEA 4WKBA 1HG1A 3MBOA 2A78A 5EUQB 2ZT8A 1R3UA 1K7SN 1H9AA 3L7IA 1R0KA 4Q12A 1N2EA 5TMBA 3C3WA 5JT1A 4Q37A 1ZUHA 5KC8A 1OWNA 3KKOA 4DB4A 2XCLA 3CO0S 5EXPA 4YSBA 4ZMBA 3FLBA 3E70C 3O2JA 1IEVA 2FPIA 3ADKA 2ZULA 4F96A 2FSVA 4DR4B 1D0SA 4L07A 5EZ6B 4EO9A 2QXTA 4TLDA 1F0PA 1A1SA 2Z98A 1FFXB 2QAGA 1AGYA 2I1QA 2WTNA 2PIAA 3EGVA 3CUWA 3O84A 4JASB 4UMFA 4RETA 3PHJA 5E38A 4EXYA 3KTOA 3KEMA 4L7VA 2C2HA 1Y8RB 3C97A 3ENWA 3DCYA 3HDHA 1VMEA 4JP3A 3U13A 4AZ3B 4B4UA 3RVQA 1BCSA 2O6HA 1AO3A 1IY9A 4ZZ2A 3TLMA 1XTQA 7AT1A 1USUA 2VZLA 1JKIA 2P1RA 4OG2A 4PW0A 3TINA 5H3CA 4B6QA 5K0TA 2ZVDA 1PR4A 1US8B 2C0PA 3WL8A 3F71A 2BFZA 5CVEA 2Q4TA 3W34A 1YQQA 3C98A 2C5EA 4JLAA 1XZFA 4MP3A 3V6MA 5JAUA 4NE7A 1H4TA 3GRRA 2JLBA 3P4YA 2VA8A 4NOKA 2C4MA 5TEWA 3V1UA 4G0VA 3SSOA 1T6ZA 3PENA 5AD1A 1B4DA 1D4ZA 4ISCA 4YACA 5E6UA 4Q18A 5GV8A 4BNYA 3IPLA 1G8AA 3IEUA 4G0NA 3CSDA 4P36A 3ZUGA 1ECJA 4GYJA 1RYYA 4KMOA 5DVZA 4Q9KA 3MZ0A 2UXCB 2BTQB 5FLXA 3JD2A 4C2TA 3ILXA 1IWPB 3L7KA 3PFWO 4DLUA 1PJSA 5IBQA 3O91A 2W2NA 1T1EA 5ACWA 1H2EA 5KWSA 3RAFC 2J4FA 3WBJA 3KQSA 3URKA 3FFWA 2QVZX 4F85A 3JWGA 3P5SA 1ZUNA 5CW1A 5L8VA 1E3MA 1HZJA 1MKYA 4PC7A 1A50B 1YWGO 3IAM1 1IXYA 1XMIA 3R5SA 4KPUB 1L9XA 4ND4A 5CVTA 3GPCA 1IG3A 2QYSA 4TYTA 5CXSA 2OYRA 5P8WA 1JR3D 5K4HA 4EUKA 2AF3C 1SK8A 4A0SA 1P72A 4ZRNA 3E9EA 4LNUA 1UBHS 1XMJA 2PK3A 5ENDA 3VO8A 3D6AA 3P2IA 2DX7A 1U8AA 5DSXA 2QE7A 5KTKA 2NU8A 3HZRA 5EHTA 2RK4A 3AC0A 4JWKA 1YIOA 4Q01A 4RVDA 3CLTC 4ECEA 3GG9A 1YJBA 3DBOB 3JATA 2AXPA 2JJMA 3EG5A 2DUNA 1L5SA 4I14A 4R83A 5GTDA 2DB3A 1CRWG 4PG5A 2OD7A 1ZHFA 3E3NA 3GLVA 1ZJWA 4J5HA 4AT1A 4H4CA 5AT1A 3WDSA 1TJ3A 4XPZA 1JDJA 1K9SA 4W63A 4JGGA 2HLNA 2H9AA 3DWGA 1KZHA 2NUBA 4RANA 4MRPA 5GGXA 4H3HB 1CS0B 2W2MA 1WD7A 5ALNA 1ZCBA 1UADA 3DH0A 3IAS1 1PYOA 1HE8B 1EBUA 2W6OA 3I2FA 1I4TD 3AZPA 3I04A 3JD3A 3L4BC 4DNFA 2QUIA 1MO3A 4PLVA 1XMVA 1ZBDA 2XUOA 3HEMA 2ZUEA 5IAAA 1X94A 2CLEB 2GM3A 2ZBDA 4HEA6 2GYWA 4X1YA 3T38A 3TCXB 1A82A 5BR8B 1BDIA 1JA0A 2JFVA 4UVIA 4ZT6A 2YMLA 3EY9A 3T3IA 5JC1A 4B4VA 4I9HA 1ZA1A 4RVFA 2W7TA 2VP6A 1USWA 1A7UA 1XYGA 3E7DA 3LWNA 4FYPA 2CFOA 1Z45A 2RG7A 4IGEA 2QENA 4JR0A 4Q7MB 4F9EA 3PE6A 3B6EA 3BGIA 2XJ9A 4FX5A 4ND2A 3ZHUA 4B9AA 1G98A 1NTRA 1GPMA 1F14A 2CFTA 3FUVA 3T1QA 2FHPA 4WXEA 1T5TA 5E1DA 3IDAA 3I12A 1CY8A 2A0XA 2OBFA 2FWIA 5KU7A 4BEVA 3MBKA 1F6DA 3SX0A 1PQYA 2C82A 2EJVA 1Y81A 2V5UA 3ANMA 3RSFA 5HDBB 4LRTB 3QE4A 4JVNA 2DERA 2C3MA 1E79A 1QOPB 2HU5A 3F6CA 4FE7A 1Q19A 4DCVA 3OPNA 4A2WA 2OWEA 5IZ4A 2C7RA 5EP1A 3WKDA 5A5FA 5EHZA 2O0HA 1JFFB 1RZVA 3IAS6 1SZCA 1M7BA 5C34B 3UHPA 2WT8A 3E15A 1QQBA 2ZSAA 3IR6A 5AHXA 4I50F 5FORA 4RYLA 3OPYA 5LA6F 4DZRA 5FOSA 4OHKA 2XCSB 2NTVA 3Q2IA 2UYXA 2IXTA 2IV2X 2A7MA 3RVKA 4ZCLA 5F52A 2AEEA 2JRLA 3GRAA 4Z4HA 4F6ZA 5JNWA 1QB8A 1NKSA 2ZJ4A 1T9CA 3VAZA 5LKAA 1BE1A 1LPBB 3GGGA 1E3WB 4FMDB 2PGXA 3UY4A 1N0WA 1R5NA 3X1DA 3GR6A 1E1KA 3DSRA 4KIGA 4U1RA 2FFRA 1U1DA 5FR1A 1KMIY 3WMXA 4C0SA 4RTPA 3ILYA 2AJCA 2YTZA 4TWIA 1I2MA 2XQIA 4XYBA 3AUKA 2KE5A 2OXCA 3GEMA 4BMVA 2ZB8A 1L0BA 3BWEA 3SR0A 4BASA 1EIZA 1QFZA 3NVMB 3O9VA 3DPIA 3D64A 3RTBA 5TSDA 5E0OA 1QGDA 4MV7A 1PZXA 1TLTA 4DLWA 2AKEA 1PP4A 4II2A 1MC4A 1QRTA 2D2XA 3EXHA 3L4EA 1MX1A 4RIIA 2ZI9A 3V4ZA 5JVDA 4GI2A 4GPIB 4P4LA 2FHSA 2IZ1A 2YINC 1XL1A 1RXVA 1UAAA 1QHEA 4EXSA 3N28A 3HBFA 5BXYA 2IX3A 3MQFA 2ONJA 3BD9A 4BNKA 2FPUA 2V7QD 1WW3A 3J7TA 3T41A 1EU1A 4EB8A 1OZFA 3L02A 5EQFA 4OI1A 5JLJA 4QBIA 2YR0A 2VWHA 1KQPA 2NO5A 2HJRA 4H9GA 2F1IA 1LSOA 3PNMA 1OAKA 4P22A 1HDRA 1LGYA 1S4QA 2ZJBA 4M21A 4UZEA 4D4JA 5JJ5A 2XAAA 4HTAA 3ZV6A 3Q8MA 1E9RA 2X1MA 1G7SA 1XMOB 2O8FB 3DKRA 4B3FX 3VZPA 3RH0A 1XLTA 2JGFA 2FLWA 4U7DA 2OGSA 1NXQA 2PS3A 3IGFA 3H04A 2OORC 4XX1A 3C85A 3E8MA 1TGYA 1HR0B 3DMHA 1JR4A 2OXEA 3G2LA 5A9SB 5AP9A 3O3CA 1L9YA 3FTPA 2JGKA 5JS2A 3WGZA 3D43A 5C31A 2FPGB 2OAQ1 3UH1A 4BKQA 2JARA 1G6KA 5LA6B 4FYYA 2ZJ6A 4AY2A 3I0NA 1VSQA 3ZW9A 3COPA 3SZOA 3X1MA 1OT5A 3U2QA 3NBZC 4LMRA 2ONKA 1ZIOA 1SXGA 3D5EA 1MQ9A 4IAOA 4PBSA 2ZBUA 1H2YA 1X8KA 2PLRA 4P86A 3E35A 4HN9A 2PCJA 2HPVA 1JHMA 2OHVA 4RPJA 1JQDA 2NN3C 2PSFA 4V0SA 2BCEA 5FFNA 4MVJD 1TC1A 1QGOA 3D6FA 3DLAA 5BNFA 1VKZA 4PQYA 4KC0A 3AY7A 1FW8A 3HV0A 2FPXA 2NO0A 1G5TA 4WNYA 3E7PA 3DQQA 2AN1A 1A5BB 3W6ZA 3A6KA 5F7JA 3X44A 4M99A 3PC2A 3GD7A 4QUDA 3DL0A 4ZWNA 1MG0A 1T1GA 1YNOA 3B9PA 4F8JA 2VK4A 4PTYA 3U7EB 5TPWB 4GZ3A 4HPXB 2H4JA 1MXFA 1I13A 5U1PA 3OZWA 4FPXA 4ND8A 3WGOA 2J3DA 1JDBC 4JSRA 4N5MA 10MHA 1HFEL 2IELA 2DG2A 2BEUB 3WNZA 4FNOA 4CKCA 4E21A 1YHNA 1K0UA 2I65A 1M2VB 4O4LF 1C4KA 1UP6A 1W47A 4PIPA 4A8TA 3DV0A 1L7RA 3NHRA 4BRUA 2KX7A 2GI4A 2C9CA 4ECAA 3D6JA 4ARZB 4UFPA 1WCYA 1RRMA 1VLVA 5KOJA 1QUEA 5DMXA 5FBQB 1R2QA 3IFSA 4YRGA 4HWPA 1WS6A 4JXJA 1M5TA 5C1PA 4NQRA 2YOGA 5EYPB 1IVYA 4QYTA 4FXPA 2PEZA 4ZOEA 4BCBA 3FCCA 2G08A 1UWKA 4FEEA 3KKMA 4U6SA 1C3OA 2H16A 1R8QA 3C41J 5ESXA 1JFSA 2ZSIA 3HSYA 1TLFA 3FZNA 2C00A 3PDCA 5JSHA 5EJ6A 5LIPA 2AIOA 3BGWA 4ICIA 1IJFA 1U0TA 3TZKA 2QNBA 1H8HD 2GLTA 4YRMA 3TW8B 3I9KA 2HMUA 3RS2A 4CHGA 2M9MA 4Q3KA 4O6VA 3ZKWA 2VT3A 1KQFA 1QK4A 5ALYA 5GVRA 3KJXA 3S3TA 1TKRA 5HCIA 4CGZA 3AI7A 2XCQA 4KVGA 1EPUA 5TGZA 3GNQA 3EUFA 2HIGA 3R5XA 4YJ2A 3BOSA 3DZBA 1PJRA 2QMQA 1JSXA 5HF5A 4NOJA 5I7OA 1ML3A 4QICA 3UWKA 1PWXA 2D1YA 3MIIA 3R3UA 5HF8A 1U8TA 4GWGA 1NVEA 4O4JF 5A5DA 5CVJA 1UUFA 5EJ5A 3LBYA 4ABYA 1KZGB 6LDHA 3H5AA 3SX2A 2HPHA 4WV3A 4CMEC 1V11B 2CCGA 1HE3A 1ZJZA 3OLCX 3ZDDA 4UDXX 4EEXA 5DLYA 2B5VA 1A27A 4GPTA 4ZO9A 1E77A 3DVQX 4A36A 3PC7A 1YS1X 1WDLA 1PV4A 4CQNA 3ZY6A 4JUAA 4ENSA 2Q0JA 1QMGA 2VDUE 2ATVA 3ORHA 4JLKA 4IQGA 4OY3A 4EUFA 5E6SB 1GEEA 5EP4A 5CDSA 4NMWA 5C9ZA 3ZPXA 5H9WA 5HVNA 2QT9A 1RLTA 2BGNA 2WIDA 3QELA 4G65A 2HPAA 1DXQA 4HQ6A 4JXKA 2G8LA 3KVVA 4Z9YA 2M32A 2NYUA 3I01M 4INZA 3PTZA 1MIHA 2QAGC 4D0LB 1RHRA 4OM8A 3NT4A 3RTGA 2H4YA 3AETA 3WVNA 3R2JA 1Z35A 2CXNA 4LHZA 3T6KA 2RIPA 1I1QB 2MT9A 1V9CA 2YVUA 1M10A 1FYWA 3Q0IA 4HRXA 5CFQA 5JZVA 3VGPA 3IUEA 2FVYA 3EVZA 1FQOA 4P84A 2GBIA 4O25A 2QTRA 4UFOA 3OE7D 1EE9A 4KNWA 4QFDA 4BLSA 2GBLC 4EG8A 1JEDA 2PX3A 5A04A 1N5OX 4Z4EA 3LLVA 4CMIB 1FW6A 3MG9A 1DLJA 3H5LA 4LBWA 2R8RA 4TGLA 4E4YA 1WXFA 1YBAA 4LOHA 5K1ZA 2A1TS 1J07A 2EJTA 4M88A 4WXHA 3H9BA 3LA8A 4R31A 4WECA 1NASA 3JWIA 1YS2X 3KXKA 3LC1O 1GD1O 2ZRDA 1XWWA 4G1CA 4N65A 2OHHA 3EJWA 3QVKA 1SKBA 4KO4S 4WK6A 4AG3A 1BOOA 4CL2A 4OLAA 5D51S 2VATA 3VJKA 1X1EA 2H1FA 2NADA 3ZWPA 3DBLA 2PU5A 4LHXA 5KWJA 3R75A 1FU8A 5L7TA 1XN1A 3TB6A 4COKA 4DC0A 1E7YA 1N2GA 2E4ZA 3EASA 2JRCA 4HQLA 1ZJ5A 2O0MA 4M46A 3K0AA 1WP9A 4GZ5A 4LDQA 2Z3ZA 1WKVA 2AOUB 3U7FB 4DEXA 3PEUA 5L3QA 5DXAA 1K6JA 4DPMA 1Z75A 1LK7A 4REMA 5C37A 4CV1A 1A04A 2X8WA 3QITA 2LV8A 1SRRA 4C76A 4M83A 5LLTA 1M1UA 2YVAA 1WETA 3A04A 2W4QA 2VNSA 4L85A 1G7CA 1T2EA 3ETDA 3HB5X 4JQSA 2IYZA 1H6BA 1UBJS 4M49A 5A7HA 3CPHA 4XUEA 1J4AA 2IUFA 2P35A 3HFSA 4U2DA 3NBAA 3QOYA 1XEWX 2OHGA 4WKOA 6GPBA 4RTSA 4ZHQF 3T0GA 1ECGA 3GRPA 3QFCA 1T9HA 1EHCA 3G68A 3GJQA 2ISCA 4Z60A 3DBHB 4GPBA 1DTWA 4YAOA 4J9UE 2NZ2A 5K5EA 1PNQA 4LYEA 3MWDB 2QW1A 1IK6A 5DM0A 4XWWA 1UWLA 3VM6A 3OCWA 4Z9XA 4AQDA 1GL6A 3TR5A 2FQXA 1VYHA 1A9RA 4JL5A 5F2OA 4F6LA 3DHEA 5EG5A 1SXJB 4XX0B 3AX6A 1UDBA 4I08A 5SV2A 5C80A 1ZM3A 5K8UA 4EUHA 3TW4A 4DKXA 1MX9A 2W83A 2HRQA 2A86A 4RGBA 3TD9A 4EA8A 2CL6X 2YC4C 3MQ4A 4OGWA 3VC1A 4FKBA 4FFBA 4W1SA 3V42A 2A0KA 4QE3A 1JJAA 1MJFA 2QTHA 2P75A 1R00A 2W48A 1KH2A 5EIFA 1EXNA 1V6SA 1WXGA 2O3RA 2QJOA 1XZNA 3OZBA 2MYNA 5CFLA 4DCTA 4F4UA 2CVFA 1DX6A 5ES4B 1O77A 3GJYA 5LDDC 3ITNA 3ED5A 3U16A 2WYIA 2IZ0A 2AYZA 3JALA 3TM5A 2B0CA 4EM6A 1AMNA 4MUFA 2FK8A 4TL8A 3SYNA 1MABA 4BL5A 4INPA 2GAFA 1X8GA 1ZNWA 1RRGA 2D62A 1XNJA 1OFIA 4B31A 5EE0A 5MGBA 2N42A 4NI5A 4WBSA 4IWYA 4P34A 3V32A 4HRAA 1ZTCA 1AHHA 1LWOA 1ZUD1 4R1QA 3TFWA 3T4PA 4REQA 1WF6A 5FPPA 3L0BA 3VSEA 3SS8A 3VI4B 5BWNA 1L4YA 1SBTA 2O57A 4OJTA 4EB3A 1WMAA 4LEIA 4AJEA 1FA9A 2VOJA 2VQDA 3BMOA 5KCMA 1SBYA 3T5GA 1IZ7A 4JUFA 1WDMA 1JP7A 1U2EA 5FUWA 3O93A 2ZJ1A 4O1HA 4XGRA 3KKNA 1PSWA 1CIPA 4HVAA 3K5HA 3N0VA 4LY3A 1DV1A 3NASA