2Q9UA

Crystal structure of the flavodiiron protein from giardia intestinalis
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
409
structure length
409
Chain Sequence
KPKYVQDQEMIPGVYWVGIVDWMVRIFHGYHTDEGSSYNSYFIDDECPTVIDSVKYPFAEEWLSRIAACCPLDKIKYVVMNHAEGDHASSLKDHYHKFTNATFVCTKKCQEHLKILYGMEKATWLIVDDKYTLKIGKRTLKFIPVPLLHWPDSTFTYCPEDKILFSNDGFGQHYATSRRWADECDVSHVMHLFKEYTANILGLFSAQMRKALEVASTVEIKYILSAHGVSWRGDAMGLAIAEYDRWSKGQHCQKKVTVVLDSMYGTTHRMALALLDGARSTGCETVLLEMTSSDITKVALHTYDSGAVAFASPTLNNTMMPSVAAALNYVRGLTLIKGKPAFAFGAFGWSNRAVPDIVAELRDGCKADVYDEKGITFKFNYTEELLEQAYNAGVDLGKRAIAYCEKNAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords A-type flavoprotein
publication title The O2-scavenging flavodiiron protein in the human parasite Giardia intestinalis
pubmed doi rcsb
source organism Giardia intestinalis
total genus 157
structure length 409
sequence length 409
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2q9uA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2q9uA01
5HIOA 1VMEA 4TZBA 3N3AC 3I14A 1FX1A 2FU7A 4XDHA 1XYVA 3N3BC 2HPVA 1X8GA 1YOBA 2QJSA 2BG8B 2FU6A 2YCBA 1CZKA 1DXQA 2V9CA 2Z9BA 4CF6A 5LCFA 4UWSB 1DDKA 2MTBA 3L6NA 4AX0B 3G5MA 5FQCA 5EHTA 3ZHOA 4LTNA 1MQOA 4UBQA 5F51A 3W77A 1CZLA 4Z5YA 3OX2A 2D5IA 4AWYB 4NLLA 3ADRA 3F6RA 1XTOA 2Y87A 3NHSA 3H3EA 3B6MA 3BK2A 3N39C 2F1OA 3I13A 4Z6XA 3KNSA 4Z67A 1YCGA 2V5VA 2Q0JA 4C0WA 4C1GA 2ZZIA 4U7FA 3Q6VA 3UXHA 3UXEA 5BUCA 3D7NA 2GKLA 2X2PA 2Q42A 5A5ZA 3O2NA 2X2OA 3O73A 1DD6A 1FVXA 1XM8A 3ESHA 3IOFA 2UYXA 2YNTB 3DHAA 5AYAA 1AKRA 4YQEA 4RBSA 4GR9A 4PTYA 1JJTA 3KEGA 1A8TA 3SW3A 1X8IA 1J9ZA 3FVWA 1FLDA 4ZVMA 1KR3A 1DXKA 3L9WA 3JSXA 2FM6A 4RAMA 2M6RA 4D02A 3TE7A 4FGJA 4F6ZA 4HL2A 4YAFA 3I15A 2QINA 1D03A 3WXCA 2QWXA 1CZUA 2FDXA 1WSBA 5LBUA 5HH6A 2GCUA 1CZOA 1YRHA 1SQSA 1ZKPA 4BZ3A 5LMCA 3PY5A 3NHRA 5HISA 4YAOA 5NULA 4V0HA 2BFZB 4D1WA 4QOFA 3VQZA 5A87A 1ZWKA 1QHEA 1XT6A 3ESYA 4TZEA 4XDGA 4AX1B 3RPEA 2ZKIA 2QMYA 5K4KA 1QH3A 3IELA 4HS4A 1FLVA 5B3RA 2ZO4A 2GSWA 5EV8A 3X2YA 1B1CA 4B87A 4C1CA 3PY6A 4QOIA 5F12A 5FQAA 2FLVA 1AKTA 3R2UA 3F9OA 4ZO2A 3QFCA 2OHHA 3RPCA 3IEKA 4M0CA 2WC1A 3KLBA 3NHYA 1DX9A 2RG1A 5AHOA 1OFVA 3GFRA 4C09A 5A0TA 3OX3A 1QRDA 3S2YA 3LVZA 4H2DA 3KAQA 3QFRA 3RKJA 1F4PA 2HNBA 5EVBA 2MT9A 5EH9A 1X8HA 3X2ZA 2BG6A 1BVYF 1AMOA 4NQ6A 3EYWA 4HL1A 3ZNBA 4EFZA 3K20A 2OHIA 1I1OA 5ACWA 4ZEJA 3L9XA 3ZQ4A 2AIOA 3TZBA 2BTNA 1AG9A 2FVXA 2FZ5A 2BG7A 2DKFA 1J8QA 4LTMA 2FHXB 2M5DA 4GCWA 3HA2A 3B6KA 3SBLA 5ACRA 3VPEA 1ZX1A 1TIKA 2XODA 4FGLA 1BC2A 3OJWA 3K1YA 5HIQA 2E7YA 1NNI1 1RCFA 3TEMA 2QDTA 5EW0A 3W79A 5ULLA 1BVTA 2M5CA 4S24A 5LJIA 2OYSA 4KEPA 1KO3A 1QBGA 4OXXA 3T3NA 3JXPA 2QX6A 2NYPA 3ESZA 1GG5A 4DILA 4HEQA 3NFRA 1OBOA 2QR2A 2BR6A 2M6SA 2FU9A 5HH4A 1OBVA 1YKGA 5AXOA 3X30A 4U4LA 5A0VA 5EMNA 5K0WA 4BMPB 3KNRA 1YCFA 4YSKA 1M2XA 1TLLA 3NHUA 1ZWLA 3FJOA 3P0RA 2BMIA 2XOEA 1WRAA 2WYMA 5ACPA 5LE1A 2FK6A 4YAUA 2YNVA 1FLAA 2B3DA 5LSCA 2NZFA 4QOGA 3S0ZA 2GFKA 1WSWA 1D4AA 1VJNA 2GMNA 2MWMA 4XUKA 3EDOA 3OVMA 2NZEA 1SMLA 4GYUA 1ZNBA 1AKQA 6NULA 2Q62A 4F8YA 3I0VA 3R6WA 2BIBA 2XF4A 3NLLA 5IQKA 5LBTA 2BPOA 4LAFA 4YAWA 2KLBA 2GFJA 2I7TA 4Z60A 3GFQA 3KAPA 2BFKA 4DY4A 2YNWA 2R97A 3AF5A 5FQBA 4RAWA 1D04A 2P4ZA 3HLYA 2YNUA 3OJXA 4RL0A 5JROA 5KIKA 1C7FA 4H0DA 4J5HA 2AZ4A 1FUEA 2BG8A 3SPUA 5ACVA 4RL2A 5B3LA 4C14A 3BK1A 4Z5ZA 5FX2A 3IE0A 1YDGA 5A4KA 3LCMA 4U7HA 2QEDA 1WUOA 3FX2A 3B6IA 2WHGA 3OWXA 3T3OA 4EXYA 1RLJA 3AF6A 3OWHA 2Z9CA 5HH5A 3B6JA 4PU0A 4H6PA 4NQ5A 4NQ2A 5AEBA 4QOHA 1YCHA 2CBNA 4UWRB 1QR2A 4O98A 5K4NA 3FAIA 4XWTA 1AKUA 4C1HA 2P18A 4YSBA 4ZVKA 2W5UA 5LCHA 1JA0A 4EXSA 4YALA 4UWPB 3F90A 4XWWA 2BN4A 2KQUA 1AZLA 2Z98A 2BMVA 4NULA 2YNTA 5EA2A 1E5DA 4EY2A 1X77A 5ACTA 5EV6A 4FSBA 1CZRA 4QODA 4PVOA 5EWAA 3W7AA 2N1MA 2BC2A 2H6AA 4JO0A 2QMZA 5EVDA 4UAMA 4QOEA 2BG2A 3TP9A 1KO2A 4D1UA 3NHLA 3A4YA 2YZ3A 4Z7RA 4FGKA 1AKWA 1WW1A 2P97A 3F6SA 1T5BA 4CETA 4QOJA 5EAIA 1KBOA 5ACXA 4PVTA 4EYFA 3SRXA 1BU5A 2OHJA 3IE2A 2A7MA 2BFZA 2AMJA 2WYMC 3MD7A 3KL7A 3F2VA 3X2XA 2I7XA 4WD6A 5F4BA 4GI5A 3AJ3A 1BMCA 3SVLA 2XR1A 4HKYA 4YSLA 4EYLA 3NHPA 4N82A 2QX4A 1ZTCA 2QDSA 5FA6A 3DHCA 1Y44A 2VW8A 2BZSA 4ESEA 3NHKA 2WYLA 5NLLA 4P62A 4TYFA 1RLIA 4TYTA 4C1FA 4R81A 4PTZA 1C7EA 1K07A 3HR4A 2Y8BA 1KBQA 4ZO3A 3IDZA 3U7IA 3BC2A 4FX2A 2Y8AA 3IOGA 4ZVLA 2R2DA 3G1PA 3NHJA 2ARKA 4GQIA 5LCAA 3IEMA 5AHRA 2QX9A 4UWOB 4UA4A 3ZWFA 1HLKA 5AXRA 4GYQA 4J5FA 4ICIA 5LVAA 1T0IA 1CZNA 1H69A 3OX1A 3T9MA 2WRSA 3NHWA 2P1EA 3IE1A 4D1VA 2FAXA 1JJEA 4EYBA 1QH5A 1WUPA 5HIPA 4AWZA 3NHFA 2Z9DA 1L9YA 4LE6A 4C76A 2Q9UA 5KILA 3ZR9A 3ESXA 1FTGA 2HB9A 5LS3A 3FNIA 5DPXA 3DHBA 5B1UA 5FUQA 4KEQA 3SFPA 2NXAA 3DH8A 1P9EA 3GAMA 3QH8A 1XYYA 4LA4A 2BGAA 1XI2A 2BF4A 4DIKA 4FEKA 2FHXA 5EVKA 3U7RA 4C1DA 5B3KA 2I7VA 2HNAA 4Y7CA 4U7GA 4N65A 4J8PA 1RTTA 3W78A 2FU8A 2V5UA 4TZ9A 4C0XA 1JA1A 1VGNA 1JT1A 2FOXA 4FR7A 3LT5A 4Y9RA 3QE2A 4N9QA 5B15A 4BP0A 5ACUA 3P2UA 1H66A 4RM5A 4D1TA 4LTDA 1DXOA 1CZHA 4NQ4A 4AD9A 3BV6A 2YNVB 1FLNA 1AKVA 4TZFA 4C1EA 2R96A 2Q0IA 3PG4A 1J9EA 1A7TA 5TGZA 2QX8A 5K4MA 2ZNBA 3FW1A 3FCZA 2FX2A 4CHLA 4BMOB 2BFLA 5ACQA 4Y9UA 2DOOA 2MOKA 5LJLA 3GFSA 4ZVNA 5ACSA 4F6HA 3I11A 5LLDA 2A5LA 1J9GA 3ES9A 3RKKA 4ZNBA 2FCRA 3SD9A 1V4BA 5LM6A 2FZVA 1SG0A 1AHNA 2ZWRA
chains in the Genus database with same CATH superfamily
5EJMA 4JLWA 1XJCA 1L8XA 1ILEA 3G02A 2PU7A 2PMDA 4ZAZA 721PA 3X1KA 3V1MA 2DY1A 4X3PA 5LB2A 2BEVA 3RBZA 1LF0A 2QN9A 1Y3CE 3JQ9A 5DNEA 3KKPA 2VNKA 2EL7A 1AN9A 1LX6A 4MLDA 4L22A 4BUJA 3CA8A 5C8YB 4G26A 1PK8A 1G66A 2Y1WA 2VZ8A 3WSTA 1WDMA 1K6MA 2MTBA 3CMCO 2VTVA 3WQSB 1F14A 1LY1A 1I7LA 4PSKA 2VSFA 5DNUA 3BAFA 4FEEA 4R2LA 4EO9A 2BE9A 4QGHA 5F9MA 4M1MA 4U1RA 1PQ4A 5LQKA 1U7HA 2WF6A 3KHTA 3UHJA 1NVXQ 4HS9A 3KTAA 2AEJA 1XEWY 5ALDA 2GBFA 5BSVA 5MFPA 1BS2A 2YWHA 2D5IA 1JFLA 3BJZA 1UP6A 5DWDA 5TRTA 1XTOA 2IOHA 3IDFA 3N39C 1M8FA 3GRRA 4HC4A 3AFNA 4KN9S 2IX3A 1E6EA 1Z17A 3ANTA 3EIFA 4OK5A 1ZGAA 2CW5A 4GX2A 2WWIA 4BMDA 1A0OA 3L7LA 5FCDA 2JFOA 4KXUA 1SOAA 3H3XA 1AKMA 3BXXA 3UK7A 2Q3EA 2BBWA 5ALZA 4E5NA 3DL7A 3WBFA 1PU2A 2BBTA 2VWPA 4MJXA 1LJ8A 1IHUA 1KJIA 5KYKA 4J3JA 1SQGA 2BEJA 2Q5CA 2VPPA 5DX1A 4NE2A 3SZUA 3CF6R 2MDTA 4HDQB 1W36D 3NDRA 3UT5A 4H7DA 2W2QA 2RB5A 3K8QA 1GGNA 1BAPA 3AOEA 2JFHA 5DM2A 2H1FA 4IX9A 5FOVA 3DNMA 5HKKD 2PXXA 3ICEA 3SYRA 1M75A 2CL0X 1VJDA 3DFMA 3WAKA 1SCUA 4S0XA 4GPTA 3D8NA 2Y4NA 4AX8A 4D02A 2JIPA 4MICA 5EPOA 2OAQ1 1CUUA 4O0MA 1T0JB 4RELA 5DW0A 2P30A 4JJ6A 4UXHA 3L0DA 4CKWA 3AJDA 3NBAA 4UFOA 1II9A 5T8KA 2Q0XA 3TRJA 2VT7A 3WXMA 1OZ0A 4BV9A 3AUAA 3HEBA 4IO1A 4B76A 2FG6C 2PMKA 2WTEA 4D98A 4D0SA 2D3TA 1SVSA 4ZIRB 3OQNA 1TKRA 1K5GA 2X8JA 3BYZA 2I87A 3GLGA 1L7RA 4NCKA 4D0NA 4OFBA 2QV7A 1BXRB 3IBCA 3USES 4WVFA 1FPQA 4OLJA 4CMEA 5FI0B 5DB4A 1IULA 2EG5A 2OE2A 2WJ6A 3NRCA 3MCTA 4OK6A 1WTAA 2XQFA 3SHVA 3JYNA 4BJHB 4HAUA 1J07A 3LX8A 3AHDA 4LUCA 3VU1A 4B87A 4AMGA 4C6RA 3INRA 3MFQA 5HFJA 3EZFA 1FJ2A 1WCWA 2ONCA 4E21A 4PG7A 3GAAA 3R2UA 2G3YA 3ZWXA 3DNPA 3LBIA 4G56A 3QWAA 3IL2A 3R9XA 1E0KA 3ISJA 4KWCA 2H18A 4MVJE 3RYFA 3SMVA 3WHKA 3MRTA 1VIAA 2WZCA 3Q7EA 4F11A 4GOLD 3SN6A 3E3MA 2OK8A 2ZOSA 3EZGA 1J8FA 3MBIA 3MUOA 4HNHA 1L0BA 2RG1A 4UNNA 4AZWA 3F6PA 1CB0A 1TQDA 4MCAA 1T8TA 2AOVA 1MFZA 5LDGA 3PUZA 2ZSEA 2L18A 1SWVA 4KFSA 4OU5A 2BD0A 2H00A 1KJ9A 2FUNB 3BFJA 4WNIA 1H5QA 1MEJA 2PPVA 1L5WA 1GTJ1 1CQJB 1E1QA 2YY7A 3N59A 2NMVA 1Z3IX 5CX1A 1NATA 3DMRA 4A2CA 3G5AA 2M1XA 3KWFA 3CUTA 4OHKA 2FFAA 5AOAA 3FOFC 2B6NA 2BG6A 1QORA 3GFTA 4DNOA 2QY9A 2HJSA 4NQ6A 3OIVA 3KB8A 3EYWA 3PFCA 4IBOA 1QHHB 3EFOA 3AFGA 4LMBA 3AR9A 2PR7A 4MKHA 5DLQC 5BWMA 3EPKA 1KH3A 5THKA 1JSRA 3NC1C 2OO3A 2P0YA 3D4BA 5JD5A 5LKRA 3B8EA 3P9XA 2K6GA 2VP9A 1NNEA 5DCUA 3A31A 5T4FA 4DM3A 3S2FA 5KQGA 2R5WA 3E4CA 1L5RA 1P6QA 1G21B 1EK2A 1V26A 4ZU1X 1VM6A 3OD5A 1BFKA 4MGEA 3T12A 1Z0ZA 5BP7A 3BRCA 4LTMA 4TTVA 2FB9A 1H93A 4ROSA 3B6KA 2FUKA 3TCXB 4C04A 2GN1A 3VPEA 4P7FA 1I4WA 3SR4A 4HGRA 1QWSA 3PQEA 4U63A 4F4JA 3UUGA 3KB6A 3PXUA 4CM8A 2OILA 1XVVA 2F6RA 2FX5A 4ASUD 2FMUA 4F4IA 3R3VA 3V4ZA 1JGTA 5B7QA 5D87A 4MPJA 3SHOA 1FFCA 2CHFA 3LC1O 4P32A 3EPHA 1XPJA 1BG6A 2D8AA 1AO3A 3V33A 2RJOA 4EFDA 1JXOA 1P7WA 4CF3A 3VXKA 3A32A 3B1XA 3QE0A 2VDLB 4MVJA 3K1AB 1JNYA 3T3NA 4FB5A 1U6KA 2JW5A 4MOWA 2QN7A 2QVGA 4NAHA 1FRZA 1MG0A 1ZC4A 4O5AA 4BCBA 3HY6A 4R3UC 4FONA 1BRTA 3C5EA 3ESRA 4CL3A 5TX7A 2XBMA 4DXDA 1NM5A 3C4VA 3K6RA 1NUHA 1RMYA 3H2HA 3L7KA 4KXVA 3ABZA 4R1UA 5I7HA 1NG9A 1P9WA 2GN9A 1RRMA 3BA1A 2W9XA 2W2MA 1NWCA 5BRNA 1ACMA 2ONYA 1QH8B 2ZJ1A 4GHWA 4N3GA 2H7CA 1HEIA 1R4NB 3GK3A 3OM8A 4BQIA 4Z7NB 5IWCA 4DR3B 1KEEA 3ZJ5A 5KIAA 1ONPA 3WLEA 2B4TO 4JCCA 4FJ1A 3NHUA 3CH7A 1ISHA 3MWDB 3WYFA 3F97A 4ZZIA 5F23A 4E3ZA 1ZEMA 3IAS1 1Q0LA 3GH3A 2P9FA 2VHYA 4TV8A 5ELXA 1LBEA 2ZZMA 1XFAA 1J6UA 4FQ7A 1OI2A 5F3RA 5A2QA 1E5LA 5IK2D 3CJRA 1K66A 1HKHA 1EEHA 4B33A 5T7BA 5ESRA 5FPSA 1THGA 3BQMB 4KYVA 4O2BB 1KETA 3H6HA 6YASA 2Z2XA 4M55A 1KQOA 4G4JA 3L79A 4E2XA 3SDBA 5E2IA 2EJVA 4A36A 3WWPA 2AUTA 4C0AC 4PCLA 3O3OB 3D2CA 3GMSA 4BMXA 4DUPA 4MPDA 4YJGB 4ALLA 2JLCA 4OHWA 3T9BA 3KAJA 4W6QA 5JSFA 2F00A 4QU8A 1ZNBA 1LI5A 1U7XA 1Y3DE 2ID4A 2RGUA 1FFXA 1ZESA 4Z0HO 1O77A 2GDJA 3MJSA 2YFQA 4B3JA 5E7MA 5AM3A 1RM4A 2EDCA 2MYPA 1M0EA 2BPOA 2HADA 4M0EA 2G70A 3G89A 1WW8A 3O82A 4WXPA 5KNCD 1VMAA 4R8RA 4ZARA 1K6EA 2DSNA 2GEBA 2BM8A 4K9RA 4NS1A 2JANA 1A9SA 4AWBA 4HNAA 2ZM6B 3I2HA 4RAWA 2J0UA 3ZTTA 1MOZA 1PEDA 1DIAA 1M72A 3B2EA 3R9IA 3VBCA 4BU1A 1PJLA 1IQRA 3UB2A 1TLFA 2VP4A 2EZ4A 3F8TA 1R27A 4ZT6A 2BUAA 1T1SA 4OM7A 4UEOA 2Y68A 2QD1A 4MRNA 5TMPA 1KFEB 1NFRA 4W1SA 1V3UA 3HQ4O 4OB7A 5GP1A 5FO0A 3REOA 3BH7A 4UXIA 4J07A 3H99A 5CAEA 4X66B 3OZRA 1EK0A 3EFEA 1QIHA 2QN1A 4LVCA 3Q9LA 3P2KA 4ZOAA 2C4UA 1IK6A 4B0OA 4U02A 3OE7D 4Q5IA 3LZCA 4X1KB 3VPSA 4CHGA 3EWAA 5FTNA 1Z5UA 1DAOA 3V8VA 4YCMA 4ZT5A 4NKRA 3IEPA 4JX9A 1GPYA 4FMCB 3B6JA 4P7BA 3WIDA 4D92A 2B35A 4RPGA 3M6MD 1SMKA 2PV0A 1KL7A 1SOMA 4QOHA 4JC4A 1YQEA 4D4KA 3EBLA 5DE3A 4F72A 1M1NB 2P5YA 3PNYA 4KXXA 5FAKA 2ODBA 2KBEA 3NYRA 4DJEC 1E7QA 3TSZA 2FMTA 4ZJZA 2P18A 1A9ZA 3AC0A 1VI2A 1V41E 1O6BA 1FXSA 2N47A 3K4QA 4IF6A 4ZVKA 4NQZA 1KAMA 4YALA 1O54A 2R00A 2ZUDA 5EE1A 3O8OB 3P27A 2E87A 2HLNA 2AMFA 4RV9A 1JAHA 4K6FA 2R8PA 2JI7A 4J2HA 2J85A 1OXXK 4R2KA 1P0FA 3VH1A 1I6LA 1MIOB 4FSBA 3INGA 4IDEA 3UJ6A 4GOJA 5LBIA 1QVWA 1R5BA 2BC2A 2XDYA 3A3YA 4I50B 3D2LA 5T64A 4IJ5A 4PR0A 4ZWNA 1CE8B 3CUSA 1U3DA 3OQHA 3BE5A 1X6VA 1Z2CA 4UNSA 5KYWB 1KMIY 1DI0A 1VYUA 3F6YA 3UGKA 3CUVA 3WB2A 2F1JA 4QVIA 4TL7A 2ZAIA 5KWVA 1NAIA 3F6SA 2PRZA 2ZR9A 4JBYA 5HNKA 1U7PA 3D1VA 3VPXA 1BE1A 4G0UA 4BNKA 1G7RA 4YP6A 1WULS 1RVV1 3H9EO 4RF4A 1JEOA 1EZZA 4LRWA 3P4YA 1ZIXA 5DSXA 1RBQA 4GUAA 3R8CA 1PNTA 1QCZA 4LGVA 5GQSA 3KQHA 3PLAE 2R9VA 3ABOB 1NJ2A 2IOFA 1X9IA 1H1LB 3KJNA 1XN1A 2VLBA 4QEDA 3OQJA 2PAFA 3P2MA 1XAJA 1GLNA 1OKKA 4Q16A 4ESEA 5CRIA 4IAOA 1QK5A 1KC3A 4Y9SA 2FPGA 1FBNA 2VTKA 4OX9Y 2BTEA 3KKOA 3E9YA 3NBXX 4R81A 1JF8A 2KMLA 5LQUA 4BFLA 3KUDA 4HGOA 2CB9A 4ILEA 4DS3A 4QO8A 5HUJA 5E9JA 3K96A 4A3SA 2PX8A 1T1JA 1YACA 2APJA 1S3SA 4RE6A 3VZDA 4NQRA 3UG6A 1C8VB 1LSJA 3FWZA 1BDMA 3STUA 1QGZA 3O0TA 4AS3A 4D79A 4G9BA 1TK9A 4I4TA 4HB4A 1J2TA 1ZM7A 3QFSA 1BC5A 2JCYA 3ENWA 2HLPA 5AKJA 3ETHA 1K2WA 3ZC3A 1I7SB 4UD6A 2I03A 2BEVB 3Q85A 4TWJA 1TCAA 2QX7A 2HMVA 3ZK8A 1I51A 1A5SB 1JAIA 3U9LA 3L3BA 5P8WA 2BMFA 2N42A 5B2FA 4Y2GA 5IS2A 4L85A 5CYFA 2AG8A 1QRTA 3H9BA 2FFBA 3O8QB 4C78A 4IH9A 4Z8XA 4ZREA 2PGXA 2CDRA 4DIFA 1MX5A 4V03A 3PRHA 3J7AC 4KWIA 1HH4A 3D6UA 3W2TA 1E3TA 2HHJA 3K1ZA 4B35A 2GILA 3E9DA 3OZDA 4LRUA 1W7AA 3EULA 4C4RA 1JKXA 3AL2A 5CB6A 4OLAA 4BGVA 2DWCA 1VE6A 2W2PA 4Q1BA 5IBQA 2ZUEA 2NUTB 4A23A 2HGZA 1AUXA 1H5UA 1N6OA 2R4UA 3CR3C 3GX1A 5K51A 4ARZA 3QH8A 1XYYA 2OKCA 3TPZA 2CXXA 1N9ZA 2JLBA 3DAOA 2I80A 3F49S 4RFSB 4S35A 4E11A 2J33A 2EHJA 2ZRHA 3NM5A 2WTMA 4V02A 1T3GA 1GA6A 2ZSIA 3AHIA 3KQTA 4TWIA 1SPXA 4XLZA 5BOVA 3UJHA 3ZI4A 4C08A 3K32A 3S8MA 2P1ZA 3QHPA 4GRDA 4LBZA 5ES4B 1C4OA 5FUMA 2WAMA 5IMSA 2VN8A 1CJSA 1LC0A 3OQBA 4UFPA 2I4TA 4NE7A 5IT9A 4RZSA 3D0OA 4YO7A 4NECA 4EHAA 2J30A 4Y98A 3UT5B 1HNXB 5M34A 4MIEA 4RV5A 4XPIA 7AT1A 4DCCA 2MHCA 4OFXA 1MB2A 1O95C 1PJZA 2VQDA 3K15A 1DTEA 1EQUA 2A5DA 3M33A 4BQSA 2OLEA 4YP9A 2ZAGA 2PA0A 3ZGNA 5CITA 2EJWA 3MT7A 4S04A 1J56A 3RUIA 3WP1B 2NUBA 2KX7A 2XWBF 4F6RA 4CKWB 4XX0B 1BEEA 1NQWA 3K73O 4RXMA 4F9GA 1P7YA 3SY8A 1CRPA 2QAJA 3F3KA 4R9RA 3OEHA 1VBFA 3W5SA 4YB8A 4B47A 3UKOA 3W34A 1EGAA 3P0JA 4FFLA 2ABWA 4GIBA 4NG4A 3EIWA 4XYGA 5FI3A 5L6LB 1DBVO 1YQUA 3PL5A 1FE8A 2FFQA 3GLGB 2FEOA 1N5DA 5FA8A 1QC5A 4QPCA 1CYDA 1Z88A 5DBFA 3P94A 1NVBA 1PZEA 2NNWB 1QF9A 4KRXA 4TV9F 4YPVA 1DAFA 4JI4B 2FWAA 1JJBA 4LHSA 4HFRA 3MMZA 3JQ6A 2Y0DA 3M3HA 4P4NA 2QSJA 5LM6A 1NDHA 3O95A 4N0QA 4Q4HA 1FW8A 4E5PA 1ZA2A 2WJWA 1Q91A 2J9GA 2ZRLA 4NEHB 5CK4A 3VDMA 4RPHA 4JLBA 2CWWA 2P9CA 2QP9X 4EMSA 1SVUA 4W7SA 3C7TA 3VZRA 1C2YA 4LDPA 2LPMA 1J0DA 2G83A 3TLCA 4ZOEA 4LISA 3GARA 4N47A 4MW6A 3LBYA 5A1JA 3A3PA 1J00A 1L7EA 3R77A 2YIVX 2ZATA 2A78A 1XZPA 1QQ7A 3PLRA 3R9XB 3RYFB 1MB3A 1P60A 1PWZA 1P1IA 4HH0A 4BHTA 4H1VA 1SIWA 3HB5X 5CP8A 1Q6YA 5B7PA 1JHZA 5JFGA 3G5MA 2AN4A 2FV8A 2XVAA 1E1LA 5EJ2A 2ZE7A 4C22A 2Q2QA 5CBPB 2XZPA 3U44A 4GLLA 1GYPA 2DH5A 3VAZA 1RHUA 2OC9A 1NP7A 2P0EA 3HLKA 2VPYA 1QTNA 1YHNA 3UATA 4IDNA 4E51A 4RDXA 2ISCA 3K0CA 3QPDA 2BGGA 1E62A 4X5OA 4V38A 4EPYA 3T3MB 5CX1B 4DBLE 3K6KA 8AT1A 1F0KA 3FLEA 3B6MA 3F96A 3NM6B 1XTQA 3JASA 3AHEA 4OL9A 2F1OA 4U5QA 1LI7A 5T67A 5IVHA 3H0KA 4Z6XA 4G8JA 1BCRB 2ECOA 4CG3A 1YCGA 1HE4A 4RMJA 5AKIA 5HIAA 1X1DA 4KPUB 5HKOA 3GDWA 1QIGA 1R0WA 2OXFA 3RUPA 4U7FA 3SZMA 2RCYA 4EG5A 1JMKC 3IAS6 3V8MA 4TLLB 5BUCA 2XKAA 4OQLA 1I8TA 4AURA 4H15A 1Z45A 2H0RA 1H8HA 2C4VA 2Z2YA 1X7XA 4MR7A 1BWQA 2JAXA 3RSHA 3W2EA 3IKTA 3MWJA 2JCBA 1H2ZA 1YUMA 2O48X 4BE4A 3IOFA 4GPEA 2YNTB 5DCYA 3KEGA 2QYOA 3LWBA 1E79D 1EFKA 2JGDB 3A6GA 1QB8A 1V5IA 2C1XA 2PH5A 3BKWA 3DMGA 3M5DA 3MRVA 3I0NA 1E2PA 4B5LA 2CT8A 4WESA 3M1YA 3PT9A 2JD0A 2UAGA 1TX4B 2JD2A 3O1JC 5FYQA 3D7SA 4DFDA 4RZ2A 2DB3A 4YRDA 5F1OA 1JFVA 4CWAA 2MCFA 2KLHA 4Y6PA 5F2KA 3C3AA 3U16A 1UMCA 4RY8A 1KFJB 3GIDA 3M81A 4BB9A 5F5NA 3CF4G 3TTSA 2IITA 3LGXA 3P2IA 3SJBA 4DRXA 2CD7A 5G41A 5AR1A 4EJ6A 3FYTA 5GV7A 1F8GA 1PHPA 5E1DA 3TKYA 1H2HA 2DCMA 4C01A 2HK6A 5F52A 4EJMA 4EQ6A 1JH9A 4ACAA 1AS3A 4Q47A 1GP2A 4QKQA 3KQSA 2QLBA 3IELA 5ABPA 4DB4A 2JJ1A 2ERCA 4IUDS 4X20B 1DRVA 4K86A 1HUQA 3ZY5A 2VDVE 2JLVA 3TVTA 4JIGA 3ZU3A 2P2GA 4JB2A 2W2NA 3JWJA 2QVYX 4N5NA 1YRYE 2GCIA 3T7EA 3WNBA 1L7QA 4MUGA 2PCJA 1XK7A 1UP7A 2XCRB 4WT7A 3MJHA 3L0PA 3AY3A 4CTKA 1KHTA 3UWMA 2YL2A 2ODPA 4NATA 1W30A 4O59O 3UJ3X 3SOZA 4JOBA 2ZRIA 1QGUA 3PGA1 2A0YA 2B34A 4TS1A 4E08A 5JTUA 1YV9A 2DQ4A 3E81A 2WPDD 1JQJC 3EK2A 4YDRA 4GD3Q 3SKVA 3U4DA 5B1YA 2Y1OA 4PPYA 3T7KA 4B82A 5I7VA 1Q20A 4C5AA 2QTCA 2Z56A 1E1CB 5FEMA 1JE1A 1QRDA 1YU6A 2ZRNA 3OM0A 2ZPUA 3KQNA 1KRHA 2WTNA 4H2DA 4JUFA 1P2SA 4HADA 4AN4A 1F4PA 3W4IA 4FZVA 2QVBA 3JQ7A 5IUKC 3EIEA 1CDDA 3FI9A 4DLUA 1FFXB 1JVBA 3TM5A 4KJZA 5DTMA 4M88A 4WQMA 4Z4CA 1Q7GA 1HK7A 5CGZA 1V0JA 4MX8A 4QE3A 1SKAA 1MD9A 4R8LA 2QG9A 2PEZA 3OZEA 3AV0B 1YBVA 5CH5A 2CCGA 3PQ6A 4MW7A 1BCSA 4HNAB 3HSSA 4QYWA 4AUKA 4KSYA 2GXUA 4ARBA 1AA6A 1VKHA 3WGOA 3FZNA 1Y7PA 1Z13A 1JR3A 3BS4A 4EHIA 5IU6A 3CG4A 1R4ZA 4P1ZA 3ZJTA 4NZMA 1Z2AA 1XVIA 2WF9A 3UYKA 4TMXA 1WEKA 2DFTA 1F6DA 2M5DA 4TMTA 3EDMA 2D1RA 1XC7A 5EGNA 1FL9A 1NMXA 1N2JA 1IBRA 5GPBA 4L0QA 5T6BA 2C54A 3UHFA 5I7SA 1JQDA 4MAFA 1GL7A 1EBUA 1A4UA 4CM7A 1BC2A 3R41A 2CLLB 4FVTA 4KUGA 2HZBA 4EO7A 2I7DA 3BMXA 2UYHA 4JVNA 4OAPA 1U63A 2POQX 4RZQA 1SKYB 2W6ZA 3OE4A 4G0NA 1OXTA 1Z0KA 4BNVA 3S81A 2VH1A 1UOQA 2GLXA 4YCBA 4OMDA 1VMDA 4M0MA 5F77A 3RVMA 3ZQKA 3FNGA 1X13A 3KIPA 1AS0A 3M0EA 1EB9A 3L7AA 4JSRA 4RF3A 4YO8A 5CLJA 1WQ3A 4GPBA 2RGDA 2VPZA 4UBLA 4D42A 1FJHA 4X64B 4DQVA 2BDEA 3PNQA 4FE7A 4DPKA 1VJGA 1YC2A 3FBTA 1DCFA 2PJZA 1C9KA 4OJTA 4E07A 4UTVA 1SUWA 1T0BA 3ELUA 1N2CE 2QN3A 5DNVA 5A4IS 2GD1O 1W4CA 3JQAD 3OO1A 3JQBA 2RHTA 5KJ6A 2O59A 2FU9A 2C7RA 2GPTA 4BBPA 4BLTA 1EFLA 4F8EA 3ZDYB 1ZK1A 1P9LA 3FCEA 2VHJA 3X30A 4C2TA 4JB3A 1QVVA 1ZICA 1ZMXA 1N75A 1PX2A 2X5NA 4PTLA 3BXFA 5KWSA 1QAOA 4NMLA 2RI0A 3R44A 2BOVA 3QXJA 1KDYA 3FPBA 4V0OA 1NPDA 1XLTA 2CHQA 1NV9A 1Q57A 3ZY2A 2AEMA 3KT0A 3JD3A 1JPVA 3W05A 1DQNA 1JKFA 4O4IF 4NBUA 1USGA 2VPXA 2Y8EA 2YMQA 5AI5A 2ZB8A 5BQXA 4Z3OA 1QQAA 4MGIR 3WFIA 1NBMD 1VCIA 1XSEA 1PVVA 4IIEA 4Y2JA 3VOAA 3ZCPA 2JH9A 1XIVA 1W94A 4ND7A 4GQAA 3KSAC 4CMCA 3FSEA 3KR0A 3T1YB 1NQXA 1RIFA 2NACA 2HBZA 4LN1A 2IYUA 4CL0A 3AIOA 1KEVA 4Z9XA 1IZ7A 3LHDA 3NZEA 4TT3D 5E9QA 2NZEA 4EUEA 4FEGA 2EWMA 3M34A 1VP3A 4XFJA 4O08A 3SQMA 4HDKA 3ZBUA 3WA7A 4R1PA 4JDUA 5HRUA 4YV2A 3NLLA 3OP1A 2BP7A 5IQKA 3L8ZA 4E31A 2C4KA 4YNBA 4YMUA 1WBJB 4QLOA 1JLKA 1E61A 1F38A 3DAPA 3LUAA 4DNPA 1UJMA 1J0CA 3E2IA 3M2TA 2O07A 5AVKA 5TQJA 1XQYA 2R97A 5FTWA 1UDWA 2FPGB 2XMDA 2VF4X 3B48A 2HRDA 1L5SA 2B2XA 4IFIA 5TGTA 5FQOA 4D9MA 4I1PA 3OJXA 3PPVA 5EZ6B 4RL0A 4IHJA 2H1CA 1Y8QA 3I3SR 4KSBA 3WJ7A 2CFCA 1M2XA 4A8JC 3VHXA 1DC3A 1BKYA 2AZ4A 2HWUA 1LQTA 3H05A 4RL2A 1VE1A 1GZVA 3EE6A 1G291 3MC1A 1H2XA 4K81B 3BK1A 3OD1A 2GXSA 4B40A 3HGTA 3LC0A 1M5UA 1VJ1A 1XDZA 4FB4A 2IEDA 1NF8A 3I32A 3ZHVA 1KZGB 2D4HA 3FYUB 1AE1A 3WB0A 2XA2A 3LCRA 2X5KO 5KOHB 3KYCA 3GJ6A 4TMFA 3FCAA 4MHTA 3TLAA 2SHKA 4QJ5A 2MYTA 3S2UA 4JVSB 4XJTA 1Y9DA 5AVSA 3HL0A 5EZ5A 3OWXA 4KUEA 4V0RA 4TMKA 3H5VA 3AW9A 1EWKA 1QDUA 2CMGA 1LNZA 1RI4A 4PYIA 1TCBA 4PRLA 2ATEA 3T52A 2H51A 2PRIA 2O2SA 4NQ2A 5AEBA 1W9MA 2FWBA 4M8IA 2EFYA 1WNTA 1DTSA 1MDBA 3O47A 4M36A 3TAUA 2VXBA 3VHXB 4I5IA 1U9CA 1GVHA 1IHOA 5CUQA 1KQ3A 3ANYB 4Q3KA 4GOOD 1CUXA 1HA3A 1D2AA 1UINA 1B6TA 4QUAA 3UTDA 2GKSA 4MV3A 4XIGS 3AM1A 1QHXA 3EW7A 4MV7A 2FGJA 5BPHA 2C5LA 2ET6A 2LUOA 4URZR 2BFMA 2A0KA 5LB4A 3R7SA 4OQDA 3IPAA 4RH0A 1P5ZB 3IQHX 3AESA 1RI5A 5AKHA 4ARZB 1W59A 4CQLA 2WFMA 3W5JA 2IW3A 3U1TA 2BIFA 3UPDA 2CVQA 1XD8A 4ZV7A 1FUIA 3OC0A 3G9UA 3U4CA 4F9TA 2XUAA 4NI5A 2D7DA 4ZJPA 5AM4A 2HXSA 2XX3A 2N1MA 3H2IA 1COWD 4HZUA 3KZOA 2ZIUB 4IDCA 5T57A 5L4SA 2LGJA 4NZNA 4DN6A 2QBYA 1RPJA 3ZDBA 5G0TA 4DJJA 5EWMA 4P31A 4OQ4A 4ETNA 2TS1A 2B4AA 1C3JA 3FYUC 4EKEA 4KPEC 4R71A 2WAAA 1PS8A 1E6LA 3BGVA 3H11B 1ANKA 1T26A 1GWNA 1XAHA 1U1CA 1T9GS 2BKXA 2NQ8A 3D7LA 3JZFA 4AMZA 3I8OA 3D2BA 3IPRA 3CG0A 3ZHZA 1HLPA 4F85A 1NHGA 1HM5A 3VSBA 4R2WA 1KAHA 4XIFA 3ZCQA 1PDOA 2RHLA 1POXA 4F6RB 4FKZA 4NF2A 2PWBA 2ZIXA 3LU1A 4W5HA 2RD2A 3D6VA 2NGRA 5K4AA 1VXRA 4K46A 4B4VA 2GJ8A 3UMFA 3WY9A 5H80A 4MW1A 3CRMA 1K86A 2V7QA 2XJ4A 1G20B 1N3IA 2E5LB 2FJPA 2RKWA 1NVDA 4PX9A 2HOQA 2CYBA 2PWPA 2HYDA 4ZI7A 1UK8A 1KP9A 1SC9A 3SQDA 1UIMA 4L07A 4D4LA 1T5OA 1QC5B 5GV8A 5FXMA 4DXHA 1SUFA 3F7NA 3WMWA 4UKDA 3WQQA 1Y82A 4KFUA 5TS3A 3LY5A 2GDZA 2QSZA 2A30A 4DIEA 3MCWA 1AS2A 3FLMA 4NYIR 4EGJA 1FUYB 3OY7A 4WEQA 1VSQA 2CGEA 4HQNA 1DWPA 3R6LA 4Q4HB 4NENB 1LQUA 4WX2B 1QHIA 4ZXFA 4ECAA 5H70A 1MCZA 2QROA 3E70C 3B6EA 2BFCB 1E3EA 3LQ1A 2ZSBA 3A9RA 2R2DA 3NHJA 3G1PA 4HX9A 2RGNC 4I1RA 4PFKA 3KZVA 1O58A 3MOGA 5FOQA 3CWCA 3IEMA 4RVSA 1JHOA 1SBZA 1O0CA 5EJEA 1HLKA 5LA6F 3ZWFA 1ADYA 1GN9A 3C4QA 3L7MA 2EJUA 1TM5E 2PXCA 1KWKA 1UBGA 2VH5R 5DBGA 1XDUA 2HT6A 2JFNA 2Q46A 4BO1A 3QSYA 1NBAA 5AM2A 1T0UA 4AJOA 2HFKA 3NAGA 1QMGA 3JALB 3UPUA 3ZD6A 2QQGA 1F5SA 4C4TA 1CR6A 3UJCA 5HBGA 1JJVA 4AMYA 4N7BA 3R75A 4EKDA 5K8UA 4R1OA 2CL6X 2XUIA 3TNFA 4EYBA 1EXMA 3ABIA 2ZWPA 1ZINA 3A9TA 2B8WA 1C2TA 2C0PA 2EC5A 3PHBE 4Q9DA 3WJ2A 3ESXA 5LDHA 1LSOA 1GZDA 3NETA 3OOEA 1XL1A 4RSGA 5LZ5A 5KEIA 2C82A 1YTLA 1JXMA 2JIRA 4D26A 8ABPA 3CY6A 4L4YA 1O0BA 4EMTA 2DHCA 1R3DA 1N0VC 3FHLA 1PFKA 3C6MA 3D8TA 3JASB 1UC9A 1GXSA 1TAQA 1VPEA 2H4JA 2Q3DA 5FBZA 3EF3A 4HDAA 5TEVA 3H5WA 4XEHA 1W96A 2HPZA 4FEKA 4CV2A 5DYYA 4Q4CA 2Z0MA 4R1SA 1GCOA 4QUHA 3V34A 4LXTA 1XQXA 1RP7A 1KZ4A 1RWOA 5B3KA 2ZRFA 1M2VB 3PFBA 2BT4A 2OGSA 3PIDA 4Y7CA 4JI8B 5AI4A 5K3AA 1YFJA 2R85A 4MR7B 4LYDA 1EGQA 4K87A 2C0QA 3HUDA 5G1PA 4G84A 2X0DA 1C30A 3RC3A 2G04A 3DE6X 3LO5A 3RTAA 4Y9RA 2DGDA 1TO6A 4N9QA 1GFWA 2GF9A 3T7JA 2Z8YA 4RM2A 4WK0B 2Q0QA 4M8SA 2WB2A 4OMFG 1RBYA 1TMGE 1M2GA 2FEWB 1DOHA 2WSSA 4OGLA 3DZGA 1YT5A 1MC5A 3UMYA 4HGPA 1NLYA 1N0UA 1Z5WA 2OG1A 3H5TA 4I5GA 1D9ZA 1P8JA 2YNVB 2PXAA 2AW3A 4FBMA 1Q7TA 1N5LA 1QQTA 4V0ME 1O97C 4DSAA 1DDGA 1REQA 4IRXA 4MPPA 4Q4LA 4IILA 4BUZA 4YJ2B 1NOKA 3JAMA 1KI8A 4ZYUA 3FRJA 4RA9B 5YASA 3OZSA 4PC6A 1N78A 6REQA 2BLLA 2V54A 3L4BA 4DRXB 1E2NA 4FYJA 1I36A 1CHDA 5IMBA 1AGPA 2Z2KA 1EE1A 1AZWA 3EXG2 1SH7A 2FEMA 2MOKA 2ZRQA 1AURA 2HCBA 5IBRA 1C8KA 3FTNA 1UBLS 1GTRA 3V8EA 1T91A 1E32A 4NYIQ 1OXKB 4QC2A 3WNDA 2IZ1A 1A9TA 1QR6A 1UIRA 2OLJA 2QUKA 2QUAA 3GLKA 4JC8A 5IJAA 3T5AA 3BQNB 2I3ZA 1TMYA 1HZJA 3OEWA 1M73E 3MWGA 2FFJA 4WY5A 2LRHA 1PZHA 2ZIWB 4PZ0A 2QVZX 5C8VA 3HDQA 4LJRA 2R1VA 4Z3DA 2WSBA 4CM1A 3FUUA 4E2WA 4TZBA 1CJMA 1A1SA 3I14A 4PVCA 3UUWA 3U19A 2V7EA 1K89A 1YR3A 1YS9A 4WFJA 2ZB2A 3K9GA 1MRNA 1EFAA 1N33B 1R0LA 5JU6A 4RQAA 4XGKA 4QTZA 1CZKA 1QGUB 4QPNA 2V9CA 2O1WA 1FS6A 1I0ZA 5BMVF 2G77B 1BW9A 2R1TA 3BMCB 3CCCA 3LLUA 4IPTA 1IWBB 1CERA 3L0CA 4QLAA 4RZUA 5D2CA 1JR6A 2OVBA 2H17A 1I4TD 5ERYA 4NPAA 1IJEA 1K27A 2ZQZA 2FSUA 5BNWA 3M89A 2C5EA 3QNMA 3COJA 1YC5A 2HF9A 5C8ZA 3U7HB 4KSCA 1P4SA 5KNDA 4U4AA 2OSVA 1JE0A 5C8DA 1XK6A 2XMRA 3WYEA 1QTIA 2PLNA 1H6CA 2VEOA 2XYRA 1V43A 2RHWA 1H2BA 3DKIA 3FCCA 3JQ7B 4QQKA 2FWJA 4I6JA 1A2BA 4IGIA 3HJFA 4V0MA 1IMJA 3SNKA 1RI1A 3AL0C 4ZQFA 3FRIA 3F7OA 4CLDA 1IXSB 1Y5RA 4J16A 4AI6A 2FR8C 1MNAA 1BCSB 2QUIA 4YQZA 3QA3E 5HF5A 2XJ9A 3RU9A 1J5PA 1TJ4A 1EVLA 2QD5A 3NUZA 4IMJB 4ALJA 4BO2A 4CEJA 1PSZA 4QJBA 1U1EA 2BCJQ 1J0BA 1LDYA 1MO4A 1RR6A 4F5YA 1L5LA 1WB9A 1A7AA 2AXNA 4YQEA 1E2FA 4GVLA 2XE4A 3WV5A 2JA1A 3AR6A 4P84A 2F4VB 2I4IA 3AVWA 2VJDA 1AT1A 4N8DA 3NS7A 4NYJQ 1K75A 1HC7A 1QYXA 4ZOLF 3U7FB 1TXGA 4JJGA 1NQUA 2WM3A 2OBNA 2C4MA 4GZLA 5IM4A 3ASYA 4E46A 2FM6A 4RAMA 2TMDA 3S70A 4BO9A 3N70A 4MH0R 2EAUA 3GDOA 3TI9A 4DG8A 4A6EA 3K72B 4J29A 1D03A 4FDLA 4PQRA 4M6WB 1Z2EA 3Q3GE 1ZEJA 4DDMA 2BTQA 2GCUA 1L7VC 4EW2A 2EV9A 2QIPA 3RAGA 4H7PA 4KEAA 3STYA 1AHIA 3DM5A 4PYNA 2V7WA 3ZE7A 5HHTA 5D84A 4RIGA 3EXEA 4DLBA 2IYPA 2QTWB 3SYKA 5F1PA 3I1FA 5IN4A 2QT9A 1DBPA 1G4AE 3PUIA 4NBRA 3AT1A 4P33A 1RQGA 3GEIA 5CA1A 4C7OB 5JFTA 4GBGA 2YWRA 5J2UB 2C57A 4PBTA 2FZGA 1BVUA 2X5XA 3ZIAD 1NI5A 4AZTA 3ZVMA 5GGYA 3UFXA 2YJ5A 3X3HA 3SBOA 2QJTA 3CMMA 3C7CB 1E2LA 4L08A 4UUOA 4XVQA 4HHEA 3R7WA 3L4KA 1RYZA 2X8AA 4XW2A 1ZIDA 4WZZA 5ALPA 4UHJA 1N5RA 5AM1A 3SX2A 2WA1A 5MN4A 4FFMA 4YXFA 1GPDG 2REQA 2ZQ5A 1DKOA 1HORA 1XJQA 3DOOA 1KSGA 1KZ6A 3TR0A 1W75A 2CNBA 2O1SA 4HWSA 5ECGC 1JWAB 3QITA 5EIBD 1FTQA 5EKTA 3V1KA 3ZY4A 2F1IA 2XXJA 4LWQA 1JAXA 2LDBA 5D00A 3TIXB 4ZEXA 1EFRD 1YI1A 4OOEA 5DXAA 2K7FA 2X5OA 1SHUX 4OYLA 1A9PA 2A3NA 1ZGBA 2NW6A 2WD8A 3QMMA 4FI3F 1E4EB 4RTLA 1PS0A 2VOEA 3DCNA 3K70C 1NV8A 3HWSA 4YT8A 1RXWA 3L1UA 3Q8MA 3QOXA 1CEEA 4YR7A 4X8OA 5A0TA 3QW2A 2IP2A 1YQWA 3FZGA 4QASA 4RC9A 2I1QA 3ZYCA 4AIRA 3VNAA 2DSTA 2W93A 2VDUE 2JCGA 2PRSA 4GPIB 4TMYA 1K3UB 2R8EA 3ZX4A 5E4JA 4MV5A 3TWOA 3I64A 4XCXA 1UC5B 4UAJA 1J4AA 3QKSA 4UDYX 4WOCA 2F7SA 4WKBA 2RGYA 5DYTA 4DSZA 1P2UA 1H9AA 4LY9A 3IAFA 1BOFA 1NBOA 1CTQA 1W47A 3IT2A 1E9SA 3NJRA 3EVFA 4NIMA 3ZZUA 1BTOA 1V5FA 1XA4A 2GTHA 3W2IA 1ISRA 4RKQA 4BE7B 2EATA 2CNWA 2GX6A 4GBJA 1V71A 5ENVA 3WGVA 3JWHA 2FHSA 4XUDA 3DLCA 3ZQ4A 2H63A 1RAHA 2X4LA 3N7AA 4IHJB 5EFZA 1Y8QB 3LC2O 4X94A 1VSVA 2ORVA 2V6GA 2OHXA 3ZWNA 3MXOA 3BB1A 4BP9A 2OO7A 1PLJA 3S1LA 2EBUA 2BFWA 1TKBA 3I9LA 4MS4A 1U2SA 3M7IA 4ZYTA 4J0HA 1BH6A 1TUIA 4RMIA 3UW1A 2VK8A 1TIKA 5KKAA 1A2OA 4HBZA 2BFNA 3W0LB 4PRKA 2WVHA 2WU8A 3LX5A 3K6JA 5E1OA 3T5GA 4DLAA 4PPGA 1C1YA 1XZEA 3HDGA 4F2DA 2DERA 2P27A 1VPLA 3GVPA 3L40A 1PFYA 4Y3UA 5CT4A 4CV0A 1Q84A 4D9FA 1K68A 5JO0A 1T2NA 4ZQBA 2PGLA 3ANMA 1GU0A 5LJIA 4DLNA 1A71A 2DHEA 3TVYA 3I61A 5TY0A 4OK3A 2RHHA 4JZKA 5ESWA 3CZ5A 2AR9A 2OB1A 4ERNA 1S96A 1XZMA 5KWEA 3V8QA 2NYPA 4D5GA 4LJ6A 2VJKA 4RU1A 2MSCB 3T0GA 4HFNA 2C5SA 1V35A 5K3FB 5HH4A 2V1UA 4CQLB 2XIQA 3RWBA 3TYXA 4TZKA 5A04A 3R8FA 4IHKA 2YOFA 3PWTA 4GX0A 1NVVR 1RCUA 3DZJA 3AY0A 3K0HA 3LFHA 4M86A 1CJKC 4U6NA 3RF7A 4JYAB 1TO1E 1NMYA 1W5BA 4M7RA 4RYLA 1L8AA 1WBDA 2REOA 3D3JA 3VOTA 2GASA 2OG2A 1E1NA 2YUTA 3DLPX 1VOTA 4NV1A 2AZMA 5FAXA 3N2KB 3A2NA 4II2A 5EWMB 3W8DA 3VNBA 1D0IA 3M8KA 3TJRA 4C2BA 2UZ0A 3MIIA 3I4FA 1W2HA 2X14A 3LUBA 3QKRB 3ZW8A 1Z6QA 4KQHA 1IEWA 2XYGA 2D0IA 2IUYA 3EHDA 2X9NA 4RANA 1YZLA 5LZ7A 1DB3A 1FNBA 3PXGA 4WJLA 4QDKA 3HHEA 5L4LA 2Q3JA 1ZMTA 1EWQA 5L95A 1XD2A 4RCZA 1N2XA 1IONA 3H8VA 3MT9A 4LBWA 4YLGA 4BL5A 3RHZA 2YVUA 5B30A 1VPVA 1H9CA 1A8QA 2NX2A 3C8ZA 3OZXA 4ISCA 4ZVPA 1TT5B 2XB6A 5TJ9A 4KXFB 1N32B 2ZIXB 2GRJA 4ZVVA 1P2VA 4AZ0A 5KQMA 1L4GA 5M29A 1XMQB 3ESAA 5EIXA 4EA9A 2F55A 3R4CA 1HEYA 1FNCA 3S2IA 1ZM2A 2AC7A 7ADHA 3DE0X 1HEUA 1F48A 3E3OA 4EKYA 1NOJA 3WLJA 4E6EA 4ZI7B 2YXNA 4OGWA 1D04A 2LP4Y 1Q1ZA 2O8EB 5AUOB 2YZNA 1MB4A 1SXJB 2Y9MB 5J47A 4KIGA 4ZU3A 3KQMA 3LSYA 4KE8A 4RJIA 5AKZA 3AUXA 4LXIA 1JG4A 5JAHA 1LA2A 1FUEA 4FHCA 2VSOA 5C4IA 2OCGA 2XA9A 2ZM5A 4KRYA 1ADGA 5U4QA 2JRLA 3IE0A 3LVBA 4U00A 1YDGA 4CIYA 4RENA 4QBHA 5HJ5A 4QTTB 2CXSA 3DE5X 2UXDB 4RGVA 2P2SA 4GUDA 3BH0A 1CY2A 4JJKA 2BR5A 4FSDA 4ER7A 1UANA 3DG9A 1LNQA 3FZYA 2OV8A 1QVAA 2QAGA 2IXGA 2WIKA 1T4BA 3CVOA 4JC0A 4KQEA 4NONA 4QD3A 2I4NA 3G2HA 1S8NA 3BN3A 5EJ6A 4DLYA 3KQUA 1HTTA 3Q10A 3U62A 2EBHX 2CJPA 4NDZA 3TW4A 2EGHA 3LD9A 4ENRA 1C3EA 2GTPA 1C4KA 1SUBA 4BVLA 1DBSA 4N0EA 1YTUA 1QR2A 1IEQA 4DZRA 5K4NA 2X0RA 3FAIA 4XWTA 2OQRA 1M6VA 5CIWA 2EKZA 2W22A 3A6FA 1M2FA 1SHTX 3L41A 4D3XA 2W4QA 2E3JA 3L43A 1P81A 2FDCA 3OMLA 4RTRA 2D7CA 3LZDA 3TLMA 1JAZA 2FPXA 2JHAA 3OJCA 3PXXA 4A0QA 3C1OA 4H59A 5JTTA 1HRDA 5MGNA 3ROFA 1YB7A 4DRYA 3NTQA 3T9FA 2QLNA 2VDOB 2ORED 3NDJA 4RFLA 1UBKS 2V45A 4R7ZA 1G42A 1XZQA 4Q1FA 3WX0A 1EK1A 1WXFA 4V0SA 5DXJA 5GY7A 4C5BA 3OLCX 3ZV3A 3KT3A 3BILA 1B26A 4GPZA 3G6KA 3THWA 1H6DA 4LMAA 1I01A 2PYZA 5JZBA 4UTPA 2PVPA 5HJ7A 3G3EA 3E9EA 4HPJB 1AKWA 3ZW7A 1W34A 3GJSA 3WAJA 2A84A 3FWYA 4QDOA 4OV6B 2ODAA 1E0SA 2ATXA 5BN1A 3VNVA 3WLMA 3NHAA 2OZVA 3M6VA 1O87A 3NXSA 3O4JA 2VRCA 2ZUCA 4FNOA 3C87A 3GEDA 3BJEA 3KXLA 5K0EA 3JYQA 3O2JA 1EWTA 3UCEA 3ML1A 3UN1A 2D4AA 2FPIB 4ZAFA 3R7DA 4UBJA 4YSLA 1E2UA 1L5MA 1TL7C 4B4UA 4RSMA 2O6HA 4RD4A 5CG1A 3EG9A 1KO7A 3ZU6A 3A05A 4EKNB 4ETMA 2O19A 1JYFA 2BVNA 3QOYA 2J4CA 3O6VA 5E6SA 4X7PA 4DDUA 4H7FA 5KOJA 3A1VA 3QFTA 5DDIP 3ZLVA 4H0CA 5ITZA 4HV4A 3IUQA 3GGSA 3FSGD 1NY5A 1SIUA 4C1HA 4C1FA 1QMPA 4AG5A 5CCBA 3KUUA 3DSRA 1PDVA 1DHTA 2DWUA 2E4YA 5GZ1A 2C9YA 2D54A 4OUDB 4C30A 1IQPA 4MEBA 3URKA 3W5BA 1J8DA 1A2KC 2O2GA 1H4QA 1WZ2A 4DRZA 2Y8AA 1KMQA 2DJ5A 2R1VB 1E5VA 3JRNA 4UNQA 3P2JA 3T95A 3NDIA 1D2MA 1JZQA 3FHJA 4EF6A 2ARKA 4TZ6A 3TG2A 4UWOB 4KWHA 5LP6C 4UA4A 3K9FC 2C2WA 1G5FA 3UVEA 2O8BA 5FL3A 4NMWA 5AXRA 1TYEB 2YNMC 4KC0A 4J5FA 1EWVA 3KYJB 5LVAA 1T0IA 4DMRA 5K45A 2BGIA 1SD1A 3FOWA 3VNQA 3RJZA 4IFEA 4LS3A 2R1TB 4NICA 4O6VA 1MJGA 4A92A 1U7ZA 1Y8RA 3ICCA 3LYAA 1WXQA 4HDNA 1G38A 2WTUA 3I2FA 3R0QA 3WWYA 3V4OA 2VKQA 4E5MA 2HSJA 2X4IA 3HUUA 3N07A 1YR2A 1L4BA 2EWWA 2FI1A 2NV6A 3SF8B 4OTZA 5IT4A 1E3MA 1SVMA 1AK1A 1YDHA 5HF8A 3O9MA 4UMFA 1QM5A 5KILA 3KOZA 3RW9A 4I8DA 4UPVA 1E63A 2YZ7A 4H7EA 2H7YA 3G9TA 1UKEA 2P35A 3Q5DA 1IG0A 1KTVA 1K4KA 1PTJC 2FN8A 4AG6A 2DF8A 1M83A 5EYPB 4FD2A 3BFKA 5B2ZA 1KMCA 2GYWA 4GWGA 2WMDA 4MQMA 1FUKA 4IICA 4Q02A 1T9ZA 2DTXA 1X86B 5IZ4A 3U7RA 4EW3A 3GN1A 3BTSA 3PC3A 4RADA 4D4JA 1R10A 1GYQA 4ZEMA 4ZHSA 1O94C 3WLSA 2I7VA 2VJYA 3WBJA 4N65A 2EFHB 3UB4A 4CEJB 4LDNA 1FTSA 1LRKA 1SVWA 1E3SA 2BZ1A 4LXQA 2VLIA 1L5HA 3ZWBA 4ZRMA 3K0EA 2ECFA 4CM4B 2R87A 1VGNA 2Q7DA 1KJNA 1C1DA 1NYLA 4NLLA 3DA8A 4LWPA 2WQ7A 1Z0IA 1XTKA 5JE8A 3U17A 1R00A 2GLUA 1FX0A 1SC1A 2V7PA 2VNSA 1GKKA 5EJ8A 3EA0A 3VR6A 3NATA 4AD9A 3GYGA 2UV8A 3W9SA 4CVNA 1V8PA 1TVMA 1PQYA 4HAZA 3BJIC 5DM70 2Q0IA 2CNKA 1IWOA 3EDQA 2LCIA 2I3BA 2ODWA 4G2TA 5DCWA 1L4NA 4L0MA 4KBGA 1ZGZA 2HSZA 1FQJA 3MOSA 4U2GA 1ISPA 2V5AA 2ZNBA 3AY7A 3VYUB 3QX3A 1Y9EA 3IS3A 3ZNOA 4RTMA 3TS1A 3W6OA 2C8VA 4FFDA 1PJCA 4OHYA 5A9RA 5T41A 3E1KA 2P9ZA 1T5TA 1CJCA 2P6OA 4E03A 1IWPB 2G9RA 3QFFA 4WY8A 2WHPA 2A5GA 1WKCA 3DDWA 5FDFA 3A28A 2HRBA 1Z7GA 3UFXB 4YR9A 2MU1A 3OM1A 1XFDA 2XT0A 5C8YF 4L57A 3LA6A 4P35A 2FZVA 3ND6A 1SKMA 1NJ8A 1OZGA 2IPMA 3JS5A 3JR7A 4JJAA 2JFPA 4L5BA 2OECA 4PF1A 3R7WB 3DBOB 3MXTA 5F2NA 1HFKA 5HX7A 2W6NA 1M76A 2REQB 5CXXA 1E2HA 2XZLA 1R0CA 3SZ3A 4MRSA 2PUDA 3WRYC 2AD5A 1GSAA 4XDHA 3ED5A 2DLNA 1WCYA 4DMKA 4PLGA 5LZ2A 3EUEA 4PE5B 1KNXA 3U61B 1GZ6A 4UM8B 4MTLA 4N12A 1G2PA 3P4UA 2OO5A 4AP9A 1EK5A 1WHSA 3FUTA 5CVDA 3LQRA 4B75A 3AKEA 5DU2A 4TTIA 3MA0A 3WL8A 3VR4H 4DBZA 1P4JA 1XRPA 2CL7X 2XKBA 3AM4A 4IV8A 3WWOA 3ORRA 1T8PA 5KDLA 4A2PA 3LCVB 2QTFA 4G5XA 1S3GA 1NYRA 4UE3S 3HM9A 1RAEA 4WI1A 2QL5A 3ZZMA 3TOVA 3LQKA 5HS4A 1M1ZA 4KCGA 5IWAB 2W2OA 2HD4A 4IEEA 1Z0AA 2QPTA 2XMZA 3ZW9A 4NXMB 1IOWA 2YS6A 1VGRA 3H3EA 3QKSB 2MYUA 1WV0A 5J1TB 3FYDA 3G2QA 1ORWA 1R9JA 5FD8A 3OA2A 4GGMX 3BULA 1TCVA 5I4BA 1AH2A 4NCXA 1BVHA 3UJPA 3D02A 4S1OA 4LMPA 2JIZD 4KR7A 3AR4A 4NAVA 4IKEA 3TTVA 1G18A 2G1PA 4B7UA 1Z6PA 2VJNA 1PCXA 1V48A 1PK9A 2VDQB 3ZHRA 2A9QA 5AUPB 1MC8A 4S3MA 4JWKA 1I3CA 1UXGA 1WZUA 1X1SA 4UPDA 5JIBA 1G1AA 4P86A 2NTVA 5E1MA 1U0LA 2DC1A 2YCLA 2J5XA 3GFBA 1WUYA 4D99A 3Q9NA 5GIPE 3RV4A 1Q19A 4KYTA 2NO7A 2EW8A 4KQKA 1X8IA 5FI5A 3E9MA 1VCNA 1KK2A 1P18A 3K16A 5JV5A 5TARA 4MHSA 1KU6A 1TYBE 1B0ZA 2XOKD 3L7JA 3CWQA 4RORA 1XVLA 3BMOB 4HYTA 2EXXA 5AOVA 4ZZ1A 1Z18A 3N74A 1QZTA 3DZKA 2PSSA 1K6XA 1XZDA 2K87A 1T4CA 1CP3A 2LNDA 3HZRA 3FDIA 2AEEA 3QUCA 5FUYA 3REQB 3V5NA 4WBNA 1JB9A 2PK3A 1WSBA 1YZYA 3P0EA 1VECA 2G1UA 2IA5A 1BDIA 4W5RA 3DDCA 3HR8A 4DA8A 3EVZA 2JLZA 3W3AH 5F7ZA 2KM1A 2I3GA 2BFZB 1D2HA 2ZJ3A 4FZ3A 2N3ZA 3ZWCA 4JI7B 3VQZA 1GPLA 1QHEA 4PCVA 5BUQA 2YW9A 4TZEA 2Q5FA 4AX1B 1YI8A 3D8HA 1DX6A 4PSVA 4Q7JB 1K3TA 3B7PA 1T8RA 4I55A 1B8PA 3Q6MA 4F12A 3LXXA 1H5NA 1BNCA 2W6JD 1FYVA 1ORVA 4EAQA 4XH9B 2BKAA 1CULC 3QELA 2FTKE 2P3SA 4FGSA 1G3QA 4J6EA 4V2IA 5JAUA 5TLSA 3V8RA 2C0CA 4Q3LA 2OGZA 2RSLA 3KEFA 4G63A 2Q4OA 1NN1A 5CCXA 4C3OB 4LV8B 1DAPA 1PG2A 3PXAA 2FRXA 3AXSA 2O1EA 1D5CA 3FVRA 3IQWA 3BB3A 4F2HA 2GZAA 5FFMA 3Q0IA 2IY7A 5D3MB 2XQJA 3MN1A 1R6DA 4IZIA 4LHXA 4MAAA 4UCQA 4O2AA 4DV3B 2XGJA 4LYHA 4PS0A 3KLBA 1CJBA 3NBQA 3GFRA 1JBEA 3OX3A 4KH1A 5ER6A 1FSGA 3LVZA 1E1YA 3OPNA 4ZKDA 4RVFA 4HDRA 1XD2B 2CVFA 3IEVA 1XTRA 1TZKA 2WWGA 4MUNA 2NG1A 3LW8A 5EVBA 3PIRA 2IPAB 4WJKB 1PR3A 2ILTA 5BV1A 3ONEA 2UUOA 4JN6B 4F3RA 2N75A 5LQJA 1N0WA 1BDBA 1C9DB 5CW2A 3UF0A 3Q5EA 5AW4A 3LRTA 4DQDA 1QF6A 4H6XA 1YASA 3OUUA 4YP0A 4UTXA 1YD7A 2AYYA 2VBCA 3CH6A 3ZGLA 3DMNA 1WPRA 3REGA 3TQQA 1BXGA 2GAIA 4PNPA 1E6WA 2QZJA 3EZ6A 4J7UA 1J1ZA 2AIOA 2YVLA 3GG9A 2PT6A 2O2YA 2XWJI 3O7MA 4Y2VA 4LF5B 3N76A 3ILHA 2WV9A 1X80A 5G1OA 4A9AA 3F7MA 4AF6A 1TM1E 3AUKA 2OKGA 3A0UA 3T5DA 1OH7A 4M3NA 3GROA 1LZKA 5HJEA 3UH0A 1XKTA 3TZLA 3K0FA 4GMGA 5H81A 1ISIA 4QDZA 1W0KA 3BHIA 3OOHA 3RRYA 1U3GA 4GXQA 4LQ4A 4QAQA 2WQ6A 2QAGB 3ANXA 1U2GC 1DADA 1VLQA 1RYYA 2EG9A 2ZDQA 3JWGA 5G2OA 3BRWA 5KVVA 2YKGA 1M0WA 2WHXA 4IX1A 4MKZA 2CSXA 1BVTA 3C5CA 4UQPA 1ZITA 2M5CA 1OWNA 2C2MA 3B9QA 3KPUA 1ZD4A 4XIIA 3ODGA 4B7ZA 2IY8A 1ULUA 3TMYA 1U0JA 5KAMA 2ZKLA 1X7YB 4ER0A 3CRNA 1NN3A 1I9CA 3OSUA 3QEAZ 4L5AA 1LXCA 1D1TA 1NYQA 1WCIA 2I99A 1M6VB 3Q7IA 4J4BA 4PHHA 1UCFA 3ESZA 4BNIA 3ZHUA 1RD4A 2HCFA 4U9UA 3KYBA 3T7AA 5AUNB 3R23A 4L6CA 2BR6A 2HA6A 2YHBA 1PO7A 4ITVA 3K0BA 4O2BF 5EZQA 1GTVA 3KZNA 2FNAA 4RZ3A 1H4TA 3WNQA 2CDCA 2FW9A 4LJLA 4CODB 3ZJUA 3WO1A 3E35A 2ZZNA 1ENZA 2JKYA 2YN2A 3E03A 4PAQA 3BT7A 1U1GA 2PZAA 3CKMA 1LH0A 5LE1A 4QXAA 2P4EA 3WK9A 2GD0A 2SBTA 1FJXA 3HXMA 3THWB 2Q7OE 3KKKA 1W0CA 3B60A 4N8SA 1SBIA 3DF9A 4OXYA 1X2EA 1OR8A 2E82A 3R6DA 3Q7RA 1FQOA 2JJQA 3EY4A 3HU3A 3ME5A 4MKRA 5A6SB 3COVA 2KBFA 1FNNA 4WHMA 3FFTA 1ESMA 1Y1TA 3H42B 2DFPA 1T2EA 5IVKA 3CLVA 3DMTA 2IDMA 1EBFA 1QF7A 2FPOA 1AF7A 4BO8A 1EM6A 2B8EA 1G1MA 1NVEA 1TZMA 3AB8A 3ZWMA 3DZ8A 1C0LA 4D56A 1ORRA 5HQTA 5L8VA 2C4NA 1ESDA 4H7JA 3I0VA 4FMDB 4YRSA 1PYGA 4YQYA 3STXA 1E3WA 3L0BA 4NOLA 2PBRA 5LQDA 2G9UA 2RGNA 1IZ0A 3B1ZA 5E6SB 3DL4A 4F96A 5KOJB 1ORDA 3H1PA 2XD4A 5H3CA 4BMCA 1JDBB 4ZYWA 5EJ9A 5ITZB 5JAQA 3UA4A 3BD8A 1W4LA 1F4LA 5K1ZA 4QZVA 3O94A 2VWGA 1J8VA 1XLUA 5K7SA 2OXCA 3L7DA 5A3QA 3CN7A 2PL3A 2O2EA 3WLRA 1YRBA 1EZ4A 3PNBA 4TROA 2IYRA 2V6BA 2W70A 3WLQA 3SPUA 2F1HA 4KYUA 2OD2A 4F9EA 5FPTA 5CDYA 3SXUB 4PQGA 1FDRA 2PN1A 3LHSA 1L5VA 4F4FA 1P45A 4ZANA 1GQFA 3KXDA 1EGHA 3UGQA 1USVA 2J5QA 3NEAA 4DAEA 1UQRA 4HXFB 2JBAA 3C6KA 3K4HA 5KREA 2QLJA 3PXBA 3VDNB 4BX8A 1YJ5A 3HB0A 2WIAA 1YZFA 3VC3A 5K6RA 2MR5A 4Q9AA 3I5MA 2ZYTX 2H9YA 4FOSA 1NE7A 3GG2A 4FU0A 5HH5A 1NMQA 5KKCA 1U1DA 2HC9A 3M83A 1E9AA 1T34A 3LF1A 3PD1A 1YCHA 3SSOA 4HGYA 4MVJH 5IRCD 3PGVA 1JKJA 3ZGVA 3FPKA 3DBHA 2V6IA 4FCTA 4M9SA 1O6FA 1ZDMA 2EX1A 4C6TB 4P7KA 2D59A 3ONFA 1VJ0A 1HF3A 4HLQB 2AA3A 1APBA 1GOTA 4LOJA 3R3HA 2XTZA 4MKIA 5JG7A 3OFJA 4XVHA 3BWDD 1PGPA 4UQOA 3BTOA 4MQUA 4Q3BA 5EXPA 4BQFA 2Z98A 2WIJA 4AK9A 1V8ZA 2J5BA 4MV4A 4NJEA 1TJNA 1Z35A 2Q8NA 3K0SA 4MA4A 2EF1A 1FU8A 4I7EA 1FP6A 4OHZA 3O1HB 3IO5A 1R5OA 2I3DA 4G0VA 3I1JA 4KDEA 1DKNA 1RU3A 2D62A 5JH7B 2AW5A 1MW9X 4PVOA 3MK31 3JAWA 1V4VA 1F3LA 4YC7A 3DGFC 4LZZA 1C1XB 2C59A 2C4WA 1QE3A 1JKMA 1L5HB 2ZDHA 3CWZA 4Y6QA 1AOXA 4OLBA 2SKCA 1PZNA 5EVDA 2NNLD 2G08A 4WCVA 1RWNA 3E7WA 2FF5A 3RVOA 2C03A 3B2NA 3FCUB 1YZQA 1F06A 1R64A 3Q6NA 1FX0B 4BO5A 1WW1A 4F1JA 4LPSA 4B44A 4C3VA 1PFWA 4UDNA 2IXDA 2W6ID 3L1KA 4I9NA 2PUCA 1JL3A 4D41A 1S5PA 1QG2A 2AC4A 2Q3FA 4P98A 4JXKA 5D5HA 3TD9A 4RAQA 4RDCA 3QPUA 4Q21A 5G4LA 2OOSA 5FL7A 2H2HA 4W7HA 5EUQB 3SSMA 3T4XA 1EFVA 3WKBA 5IJ0B 5J58A 2VUHB 4YJDA 3RYCA 1QO0D 3B53X 5FBWB 2WP8J 1OXUA 4AQDA 5TQ0A 3K1JA 3FYHA 5EE3A 1OROA 1FFEA 1S2MA 1P2GA 2ZSAA 3A3OA 3NHKA 1XCMA 4E5DA 3K9WA 1V95A 3HBNA 1IY8A 1D2CA 3CO0S 3OX4A 1O0SA 3TAXA 3UJ8A 3T06B 5L45A 1UBJS 3LQYA 3HZHA 2BJWA 1Z8DA 3WOHA 2AHRA 2R79A 4UZEA 1ZSYA 1VSTA 3O4GA 2D0DA 4E15A 5AW3A 2D2IA 2QZPA 5I48A 1JSXA 3OE5A 2Z5VA 3GLHA 3TXYA 1JPUA 2NSDA 4HQOA 4E2FA 1DO0A 1MN6A 5H5JA 4MYTA 3JZMA 4RKRA 4ZVLA 1P1BA 4WPGA 2WWHA 2ZLBA 4CLEA 4EABA 2H8KA 4TQGA 3PZRA 1RZUA 2NO1A 4GQIA 2VT3A 4ZMBA 5AHRA 1CS4C 2NZXA 4I3FA 1AQLA 4MWOA 1L2TA 2H29A 2WZQA 4YRTA 3W1WA 5BSGA 1CRLA 1TCCA 3TW8A 1XTPA 3KOXA 5JEDA 4JX8A 1MOQA 3FGNA 3M1LA 4YRRA 4DL9A 2QD4A 5FTMA 5KCZA 2PGJA 2W7TA 1IHPA 2C9BA 4G4SO 2FQYA 2FR8A 4KLAA 4Q24A 5F3WB 4C7XA 4LOHA 1RPNA 4FYYA 4AWZA 2OWEA 9ATCA 4P3OA 3NBFA 3MYYA 1TF7A 1RAFA 4DSOA 4AKSA 3CW2A 5I9BA 2BMDA 2J0SA 4EBFA 2ZVJA 3AFHA 3CB2A 2PWAA 3GZTB 2GXQA 3VH2A 4BMZA 3ADBA 4FDTA 2IS1A 2FETA 3UOAB 5G1NA 3RIYA 4D7AA 5IHXA 1DUSA 4V0KA 5CFRA 4D8TA 5JXJA 4LA4A 3LHIA 1XQWA 2A9KA 3KNZA 5JNVA 4OAOA 5LCXA 3SDSA 2FHXA 1I2ZA 1NW7A 2GBGA 1Z07A 2WSYB 5J4LA 1S2LA 4REOA 2BZ0A 5TPZD 2YBEA 4TYPA 1MAWA 4KQ1A 1R66A 3R5KA 1LC3A 3BDIA 5TVKA 2IYAA 2VJMB 4HNSA 1L3IA 1ZCJA 3IJRA 1H3FA 2WM2A 2A7QA 5T5QA 2OYRA 3HJGA 5ACUA 1GZHB 2W6PA 3NAQA 4X84A 3UWOA 2Z09A 1J7KA 1DRUA 2WRZA 3P2UA 3GO4A 4ZD6A 3AVYA 2VG8A 4KAFA 1EE2A 2ZYSA 4YJHB 2JCVA 1IZ9A 3D4LA 1LI4A 2X3YA 4TN1A 3DZHA 2ZUVA 2ZTLA 3PNVA 4FOPA 4FUTA 2CEAA 4JLOA 8ADHA 1QHFA 3FF1A 4JBNA 4REQA 1JLRA 4EPVA 4KQJA 2I55A 3C3DA 2CSUA 4GXRA 1EA5A 4DUGA 2WT4A 4JA2A 4NMHA 1UZMA 4AJHA 3E1GA 1HDGO 4N7MA 3V48A 5IAOA 1UK6A 3U0BA 3CUWA 2J3LA 4PLZA 1X8KA 2OBXA 1DE0A 1EIZA 1FDOA 3MQFA 4UHKA 1QV9A 3WJAA 1FFDA 4DT1B 5F9FA 3ZYZA 2FEAA 1M10A 2IS6A 1GA1A 1V45E 2JIOA 3ETEA 3MSXA 2DUUA 4BKQA 2CNOA 3DZFA 1SKQA 5JSKA 4I55B 1A9YA 4GNKA 4GM0A 4Q66C 4TZTA 1ZQ1A 4G89A 3SF0A 4A03A 2IHBA 3CIFA 4QGFA 4G9EA 2VQ3A 2XDWA 2P2DA 3QELB 2Q0HA 3E0QA 5IHPA 2ORYA 3LA8A 3FDJA 1IATA 1D6JA 4AF7A 2BKLA 1D5WA 2ETVA 1FX1A 2WAXA 1SN7A 3U3MA 4GNRA 3QU4A 5EIHA 1IDOA 1YFZA 3ZJ4A 2Y05A 2PMWB 4CMAA 4Z4EA 2BG8B 3FMGA 2IHJA 2YCBA 1Z5VA 3BF7A 4C5CA 1JT2A 1DXQA 3GLUA 1H85A 4BNXA 3O8BA 2H0QA 1XXHE 3OI7A 4J0QA 3MPUA 5GVSA 3RU2A 5JYBA 4PQFA 4LTNA 2QRLA 5CT6A 3VMFA 3BZUA 4B7AA 4BBZA 5JDIA 3I5AA 1ZRMA 4H3KB 3ZHTA 4LK2A 1KK3A 2QLLA 2Z8ZA 4HDRB 3LQFA 1CZLA 3UQZA 1YR1A 4N76A 2F2TA 5HIJA 5HXAA 4LZLA 2ATCA 2YV4A 3DDNA 1C3XA 2A59A 3UHOA 4BWYA 3TDNA 3AETA 5J63A 1P72A 2AI3A 3TNDA 3UK2A 3I13A 5DHTA 5G3ZA 2PO7A 5FWAA 5JZ9A 4Z67A 4OP1A 3D3WB 4LOIA 3RS5A 4XGNA 3R5XA 2OV4A 1I1NA 3M4YA 4QXPA 3P32A 3BERA 1E2BA 2YFYA 4B3IA 3UXHA 3CU5A 2PAAA 4EY8A 5CBKA 4EGCB 1BXGB 2PT9A 2SKEA 1WZIA 3INNA 5EUCA 3RGWS 4X60A 1WW3A 5SZHB 5E6RA 4H6WA 4AZVA 3PDCA 2RJ3A 1T4MA 3TQRA 3UIEA 2DZDA 4G25A 5DTEA 1SHJA 1T1GA 2F8LA 1YIAA 3C0KA 4QQFA 4PTYA 1PFGA 3V1NA 1Q14A 3ACBA 2HQSA 3HYCA 1DGQA 1NGSA 1CG6A 1ECBA 3H1EA 4UVGA 3SW3A 5JATA 4G23A 2FU5C 2PO5A 1Y34E 2IDKA 2X6TA 2ZSDA 4LSZA 4C6HA 2YQ4A 1QCYA 4ZVRA 5JY6A 2YYSA 3OPVA 4N7RA 1XMJA 3K0FB 4JLPA 3S2ZA 1OTXA 3O4RA 4R9VA 3SZGA 2E4AA 1FDIA 2JLXA 4MLPA 4GAEA 3GDGA 4HL2A 4FBLA 1EK6A 2OYCA 3TQHA 1NRJB 1HE1C 5FH9A 4KI7A 4P3PA 5GMOA 2AYZA 1Y89A 1CUAA 1PDWA 2Q4RA 4IDAA 4QFDA 1RHKA 5HKBA 4JUDX 2PKQO 1C8LA 1RYNA 3TXAA 1X1RA 3E58A 4L8FA 2W43A 3AUYA 3H84A 3HVJA 4DV1B 4YT4A 4F6LA 1T3TA 2V7VA 1O89A 2Q2WA 2I6SA 4PW0A 2UYGA 5C53B 1ZI9A 1WCIB 5HQJA 4U7DA 1X7WA 3GJQA 3A1TA 3RSZA 1UJNA 4GGOA 3Q98A 1NNUA 5JCPA 3MJDA 4WNYA 3UJNA 1MU0A 1DP4A 4DC0A 3QWFA 5L3SB 4ZDKA 2W8BA 4BV8A 1RFLA 3TPFA 3O8DA 3DTVB 1ML3A 2ASEA 1O95D 2ZE8A 3WQRA 3HKBB 3ZQUA 2EHDA 3DTTA 4FC7A 1N2OA 3BWCA 2RK4A 3MJ4A 1JR4A 3MCVA 4UU0A 4HLNA 5ES3A 2YZGA 3HCWA 3IEUA 1CUIA 2P78A 1Q1NA 3RS4A 4B8YA 4DC1A 4C87A 1CUHA 3LYHA 3PDUA 1OB2A 4CEIB 3JQFA 4EX6A 4AV7A 1XOIA 1G5PA 1AKTA 1N3LA 3G8AA 3KEOA 5IPFA 1CQIB 3UGTA 5IKMA 2VPQA 4BMSA 4M9CA 1QAQA 1XTSA 2K4MA 3ACDA 1XCBA 4YJFB 3GWGA 2WWWA 1BMQA 1ATIA 4HI0E 3HVKA 4ZEVA 1J7JA 4IMPA 1DX9A 4IXNA 5AVZA 3EEOA 3L05A 3WL5A 2VRCD 4HDMB 3NWBA 2W71A 3B5JA 4M76B 3P97A 2YVAA 2XVZA 4IDHA 4A5OA 3QFRA 2E5WA 3L7BA 1KY3A 2OCLA 1Q7BA 1O6GA 1WUHS 4INAA 3EDCA 4IEIA 5I7EA 2NUAA 4C3ZA 1QGDA 4RIEA 5A62A 2C2BA 3C8UA 3ENZA 4DR7B 4FYWA 3KEMA 3PEFA 3GVIA 4V1CI 4WK2B 1R16A 2X76A 3OZCA 5GVRA 1ZOSA 4ZEJA 3JQRA 4LXUA 2YWXA 3EG5A 5P21A 2V7UA 1DBWA 1ZU4A 4HYYA 4IMRA 1MIHA 5DLYA 2C3PA 5HCIA 1U9IC 3ZJVA 4DTIA 2K2WA 5D1NA 5K0NA 1J8QA 2OCXA 5EIEA 3L5KA 1T8UA 2VJLA 3KKQA 2IODA 2WILA 3A37A 3MTIA 4WBSA 4X8HA 2R6FA 5J40A 3RUDA 3VZQA 1ULSA 1Z7YA 3PC2A 4OBWA 1WVGA 2IZ5A 2ZJ4A 1IHDA 2HNKA 4WFQA 4J43A 2H65A 2HK9A 4GYKA 1NU8A 5FPHA 4WLOA 5JASA 2W2VA 1M8PA 4ER5A 3FZQA 1Z68A 3U7GA 1E3DA 1OY1A 4BATA 5KI6A 3GLSA 3TEMA 4RVUA 1HMPA 2AGVA 3GEHA 4FWBA 4BNTA 3FH0A 4F97A 4UTRA 2Z58A 1Y1KE 3ID6C 4RV4A 1YWGO 1KI7A 4K0KB 1T9DA 1QBGA 2P40A 1TKCA 3D5QA 4GLOA 5IT0A 4CEHA 2FWIA 1FVFA 3DBHB 4E2ZA 2JEYA 3RD5A 2M6KA 4ZQHA 3GCZA 4EEXA 1DIOB 2PBFA 5I01A 4PCUA 2HGSA 5ILQA 2F4NA 1M1UA 1OBOA 2MSDB 2QR2A 3GRUA 3A1UA 2OV3A 3FTDA 5EZYA 4F4UA 3PB3A 2QTZA 2ZVQX 3U3KA 1K9VF 2X0NA 3WLKX 2GWHA 4CEIA 2JKVA 2AKEA 4NJEB 1Z33A 2M2IA 3I04M 5B1EA 2L0XA 2L2QA 3FI0A 3QVXA 5FR2A 3TI7A 1TT7A 4IWNA 1GO2A 2ZIEA 3HPQA 3OAAD 4LBYA 2XHZA 2E6KA 3AP3A 1RNLA 4EOGA 1VHJA 2IYYA 3AZOA 2HJGA 3DZBA 3T3DA 3AWIA 2ZUFA 3VO9A 4I1YA 4Q1DA 1XHLA 3EAGA 4Q3DA 1PWEA 1X9HA 2QUHA 2RH9B 4JVOA 4YROA 2B3DA 2CG3A 2TECE 2F9MA 1QZ3A 1NQTA 2W4MA 1VBMA 3S0ZA 1PL6A 5A7HA 1EM8A 3BXPA 1YMUA 1QOPB 1SU6A 2LW7A 3HABA 2QVXX 3G6WA 2G88A 1KJYA 1W48A 1JYSA 1YUBA 3AR5A 3IHTA 3LM8A 4QQRA 3TTWA 3NVAA 1KY4A 2YHIA 4EI8A 1T5SA 2A94A 2GFIA 2WICA 4GYUA 3EH2A 1G9SA 3TM4A 2PCLA 1RRKA 2ICAA 4GPD1 4EDFA 4I9HA 2G67A 3VX4A 2I4LA 4BVJA 4JELA 1MO6A 3R6WA 4MB6A 4PFJA 4BMNA 4PC1A 2C95A 5TQ0B 1NN0A 2Q29A 2A9OA 1ODFA 5AXDA 4ARUA 1VCMA 1T9KA 1WM1A 2IHVA 4XSVA 3HXTA 2BGKA 2YASA 1R7RA 4A2WA 2BFKA 4G0QA 1IJKA 4OO3A 4CUKA 2YNWA 5LP6A 1PR9A 1B7GO 1NXPA 4K9SA 3AEQA 4CG0A 5I4CA 2YNMA 5HF6A 2WZBA 1HFEL 1DTWA 1L7NA 3EMDA 4B6SA 3ZTYA 2PH3A 3D1JA 3G2IA 4YMVA 3N2EA 1E9RA 1PT5A 5JXWA 2CXQA 2AMLA 1MJFA 2PSHA 1II8A 1RYBA 4YRAA 3C3PA 4RH3A 5A4JA 3HCNA 4Z5ZA 3GEGA 1JU3A 3GLHB 4XTCS 2AUMA 2IV3A 3TBHA 5FX2A 4X95A 1ABFA 2A0WA 1QE5A 1YMVA 2D2EA 2E4VA 3LUGA 3UNXA 1EZ1A 2WUFA 4URFA 5FNVF 1ZR2A 3QHQA 4L4XA 4QU5A 2ZJAA 3L7IA 4HTFA 4BZXA 1VTKA 2RDMA 3FZEA 3C6YA 3B6IA 4R0VA 4F71A 3ZTWA 2WHGA 3DOCA 3TW8B 1N6LA 3ODPA 5A4FS 4UUBA 1ZRSA 1R4AA 1GITA 1XZAA 3HWX1 2X3UA 3B3GA 3IAXA 1MF7A 5A6VA 1Z4MA 5JSZA 1UFOA 4LWOA 3WIOA 5GONA 6Q21A 3FUCA 2CBNA 3PF9A 4NVRA 5DHUA 2OP0A 4KE6A 2HLHA 2HXGA 3URMA 1HOTA 1R15A 3VYRB 1O94A 3EMVA 4E13A 5CB8A 5J1SB 4IJMA 1ZUD1 4XOIA 1YS4A 2A9VA 2C3YA 2FEKA 2WIGA 2YHUA 3O8NA 3P9KA 1PEYA 2FVYA 3ETLA 4F7DA 5LIPA 3RKJA 1KSJA 5AXBA 2AQ8A 5LCHA 1Q44A 4M22A 3JQ8A 2PQ2A 4Q1VA 2QYTA 3UBMA 3WZLA 2PRJA 3D3KA 4YQFA 2ID8A 1L1FA 4YCLA 2KQUA 2ZREA 1FSFA 5ITSA 3TECE 4EHLA 4RQUA 3LH5A 3WKCA 1WZNA 4WJZA 3N0WA 5FP0A 1YR8A 3ZDCA 2GEJA 1SQ6A 5ALTA 1KFBB 4GQBA 3SICE 4DCUA 1GPNA 4RWEA 4M9QA 4J3NA 3RT9A 3PNLA 2AZTA 3LLSA 4A16A 4BKRA 4ZHQB 1FXUA 2H6AA 4ZJUA 2QMZA 5CK5A 3E05A 5JZMA 1WR8A 3GBVA 4L15A 5CB0A 2B83A 3H75A 5CU7A 5DN9A 1E0DA 4WEOA 4M0KA 5EN4A 3H2YA 1Q7RA 1HO3A 1K1EA 1Z34A 2J9FA 1XZGA 1EWYA 3FR7A 3L8YA 3LYLA 2YBDA 3B6ZA 3LPNA 4JLJA 4OXRA 4RPIA 4C29A 5HGXA 3IUNA 3KVNA 4AO7A 5JNUA 1E98A 3GLQA 4OB6A 1J25A 3TEJA 2CXTA 3NO4A 3VBEA 2JAQA 2H07A 3PI7A 3TTTA 1JH8A 2A7MA 2FE1A 4REQB 1F51E 1IHYA 5LZ4A 3HXLA 4B2YA 2I7XA 1NW4A 1QQBA 4BU0A 4CV1A 3CUKA 3NDPA 2QOEA 4AZ3A 3HJHA 1TYDE 2K7ZA 2VQFB 2XXAB 3C7DB 3LT2A 2QX4A 2QJFA 3DHCA 5DISB 1U3CA 4B1FA 3NHMA 4J0CA 4EI7A 4GMKA 3AQ4A