1DDKA

Crystal structure of imp-1 metallo beta-lactamase from pseudomonas aeruginosa
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
220
structure length
220
Chain Sequence
ESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMP-1 METALLO BETA-LACTAMASE
publication title Crystal structure of the IMP-1 metallo beta-lactamase from Pseudomonas aeruginosa and its complex with a mercaptocarboxylate inhibitor: binding determinants of a potent, broad-spectrum inhibitor.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 67
structure length 220
sequence length 220
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1999-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1ddkA00
3IE1A 4HKYA 2XR1A 4NQ2A 5K4NA 3S0ZA 4AX0B 4UWOB 1A7TA 1X8GA 2UYXA 5EVBA 5K4KA 5AEBA 3VQZA 4TZFA 2NZEA 4RL2A 4NQ6A 3WXCA 1YCHA 5EVDA 2FU7A 2GKLA 2BFZB 1A8TA 4J5HA 1KO3A 2GMNA 4EYFA 2ZWRA 2CBNA 3H3EA 4V0HA 2BFKA 2ZZIA 1HLKA 4FEKA 2YCBA 1YCFA 5K0WA 4RAWA 2BMIA 5K4MA 5ACVA 2GFKA 2BG8B 4GYQA 4D1WA 5KILA 3IEMA 3X2XA 5A87A 4C1DA 2FHXA 2DKFA 2GCUA 4TZBA 5ACRA 1DD6A 2NXAA 4C1EA 2WRSA 4ZO3A 5EWAA 2ZO4A 2M5DA 4Z67A 3FAIA 1XTOA 2FHXB 2GFJA 1ZTCA 4D1UA 3IOGA 5IQKA 3PY6A 4B87A 2R2DA 1ZKPA 5B15A 4D1VA 4C1GA 4EYLA 2YZ3A 1VMEA 3TP9A 2I7VA 2YNVB 5LM6A 2WYMC 3DHCA 2BGAA 2A7MA 2BIBA 4F6ZA 4U4LA 2XF4A 5ACTA 1DDKA 4EXYA 4YSKA 5FQCA 3P2UA 4AWYB 4C1HA 2VW8A 3ADRA 3AF5A 1WW1A 5LCFA 4Z5ZA 3F9OA 3I14A 5ACPA 2BFLA 3IE0A 3DH8A 4CHLA 2Y8BA 4Z5YA 5HH5A 5A5ZA 5HIPA 4ZO2A 4BP0A 2P18A 4P62A 3PY5A 3BC2A 4YSBA 3SD9A 2BG2A 5LCAA 4NQ4A 4PVTA 3IELA 4JO0A 3X2YA 2QDSA 4UWPB 5AXOA 2YNUA 2BG6A 1BVTA 2M5CA 5A0TA 5AHOA 5LS3A 1KO2A 5EH9A 4NQ5A 5AXRA 1M2XA 3SPUA 3MD7A 3ZWFA 3LVZA 4D1TA 3BK2A 1XM8A 2P4ZA 4J5FA 3FCZA 4TYFA 3IE2A 1Y44A 4FSBA 1X8IA 2YNWA 4KEQA 5B1UA 2NYPA 5DPXA 3SRXA 3KNSA 4C1CA 4EFZA 4F6HA 5KIKA 2OHIA 5ACUA 3SW3A 1JJEA 2Q0JA 1P9EA 2BG7A 2FU9A 4PVOA 2FK6A 5HH4A 4XWTA 3QH8A 3R2UA 4UBQA 4C1FA 3A4YA 3RPCA 4Z6XA 3I15A 4EY2A 3BV6A 4O98A 5AHRA 5HIQA 2E7YA 2Q42A 4BZ3A 1YCGA 4EXSA 1ZNBA 3G1PA 2AZ4A 4AX1B 3IDZA 3ZNBA 1MQOA 3ZQ4A 2QEDA 4FR7A 5FQAA 2OHJA 3VPEA 4AWZA 4Z7RA 5EV6A 2HB9A 3T3OA 4D02A 3SBLA 3RKJA 3PG4A 5EVKA 4HL1A 4EYBA 5ACSA 5ACWA 3KNRA 1KR3A 4ZEJA 4RAMA 4RL0A 4WD6A 4TZ9A 5HISA 2NZFA 1DXKA 4XWWA 1K07A 2Y87A 4GCWA 2QJSA 4Z60A 3RKKA 4DILA 2YNTA 2BFZA 5LE1A 4UWRB 4YSLA 4TZEA 5ACQA 2WYMA 2Q0IA 1VJNA 3X30A 1QH3A 1BC2A 5AYAA 2YNTB 4UA4A 1BMCA 1WUOA 2BG8A 5EW0A 3X2ZA 5EHTA 2Q9UA 4TYTA 1QH5A 3T3NA 2BC2A 1L9YA 4UWSB 5LLDA 1E5DA 4H0DA 2WHGA 5B3RA 4GYUA 3I0VA 1WRAA 3ESHA 2OHHA 2I7TA 3BK1A 3Q6VA 4UAMA 3L6NA 2QDTA 2QINA 3IEKA 3DHAA 2FM6A 2WYLA 1X8HA 5LCHA 3I13A 1JJTA 2ZNBA 3I11A 1JT1A 5HIOA 3SFPA 2YNVA 1VGNA 4LE6A 2DOOA 3KL7A 5ACXA 2H6AA 4RBSA 4RM5A 3AJ3A 1WUPA 4XUKA 2AIOA 4KEPA 5LSCA 4AD9A 2BTNA 1SMLA 4HL2A 2P1EA 5HH6A 3JXPA 3ZR9A 2BR6A 2I7XA 5EV8A 2Y8AA 5LMCA 3T9MA 4C09A 2FU8A 2FU6A 2P97A 3IOFA 4DIKA 3DHBA 5A0VA 5FQBA 3AF6A 4ZNBA
chains in the Genus database with same CATH superfamily
3IE1A 4HKYA 2XR1A 4NQ2A 5K4NA 3S0ZA 4AX0B 4UWOB 1A7TA 1X8GA 2UYXA 5EVBA 5K4KA 5AEBA 3VQZA 4TZFA 2NZEA 4RL2A 4NQ6A 3WXCA 1YCHA 5EVDA 2FU7A 2GKLA 2BFZB 1A8TA 4J5HA 1KO3A 2GMNA 4EYFA 2ZWRA 2CBNA 3H3EA 4V0HA 2BFKA 2ZZIA 1HLKA 4FEKA 2YCBA 1YCFA 5K0WA 4RAWA 2BMIA 5K4MA 5ACVA 2GFKA 2BG8B 4GYQA 4D1WA 5KILA 3IEMA 3X2XA 5A87A 4C1DA 2FHXA 2DKFA 2GCUA 4TZBA 5ACRA 1DD6A 2NXAA 4C1EA 2WRSA 4PDXA 4ZO3A 5EWAA 2ZO4A 2M5DA 4Z67A 3FAIA 1XTOA 2FHXB 2GFJA 1ZTCA 4D1UA 3IOGA 5IQKA 3PY6A 4B87A 2R2DA 1ZKPA 5B15A 4D1VA 4C1GA 4EYLA 2YZ3A 2CFZA 1VMEA 3TP9A 2I7VA 2YNVB 5LM6A 2WYMC 3DHCA 2BGAA 2A7MA 5AJLA 2BIBA 4F6ZA 4U4LA 2XF4A 5ACTA 1DDKA 4AXHA 4EXYA 4YSKA 5FQCA 3P2UA 4AWYB 4C1HA 2VW8A 3ADRA 3AF5A 1WW1A 5LCFA 4Z5ZA 3F9OA 3I14A 5ACPA 2BFLA 3IE0A 3DH8A 4CHLA 2Y8BA 4Z5YA 5HH5A 5A5ZA 5HIPA 4ZO2A 4BP0A 2P18A 4P62A 3PY5A 3BC2A 4YSBA 3SD9A 2BG2A 5LCAA 4NQ4A 4PVTA 3IELA 4JO0A 3X2YA 2QDSA 4UWPB 5AXOA 2YNUA 2BG6A 1BVTA 2M5CA 5A0TA 5AHOA 5LS3A 1KO2A 5EH9A 4NQ5A 5AXRA 1M2XA 3SPUA 2CG2A 3MD7A 3ZWFA 3LVZA 4D1TA 3BK2A 1XM8A 2P4ZA 4J5FA 3FCZA 4TYFA 3IE2A 1Y44A 4FSBA 1X8IA 2YNWA 4KEQA 5B1UA 2NYPA 5DPXA 3SRXA 3KNSA 4C1CA 4EFZA 4F6HA 5KIKA 2OHIA 5ACUA 3SW3A 1JJEA 2Q0JA 5AIJA 1P9EA 2BG7A 2FU9A 4PVOA 2FK6A 5HH4A 4XWTA 3QH8A 3R2UA 4UBQA 4C1FA 3A4YA 3RPCA 2YHEA 4Z6XA 3I15A 4EY2A 3BV6A 4O98A 5AHRA 5HIQA 2E7YA 2Q42A 4BZ3A 1YCGA 4EXSA 1ZNBA 3G1PA 2AZ4A 4AX1B 3IDZA 3ZNBA 1MQOA 3ZQ4A 2QEDA 4FR7A 5FQAA 2OHJA 3VPEA 4AWZA 4Z7RA 5EV6A 2HB9A 3T3OA 4D02A 3SBLA 3RKJA 3PG4A 5EVKA 4HL1A 4EYBA 5ACSA 5ACWA 3KNRA 1KR3A 4ZEJA 4RAMA 4RL0A 4WD6A 4TZ9A 5HISA 2NZFA 1DXKA 4XWWA 1K07A 2Y87A 4GCWA 2QJSA 4Z60A 3RKKA 4DILA 2YNTA 2BFZA 5LE1A 4UWRB 4YSLA 4TZEA 5ACQA 2WYMA 2Q0IA 1VJNA 3X30A 1QH3A 1BC2A 5AYAA 2YNTB 4UA4A 1BMCA 1WUOA 2BG8A 5EW0A 3X2ZA 5EHTA 2Q9UA 4TYTA 1QH5A 3T3NA 2BC2A 1L9YA 4UWSB 5LLDA 1E5DA 4H0DA 2WHGA 5B3RA 4GYUA 3I0VA 1WRAA 3ESHA 2OHHA 4AV7A 2I7TA 3BK1A 3Q6VA 4NURA 4UAMA 3L6NA 2QDTA 2QINA 3IEKA 2CG3A 3DHAA 2FM6A 2WYLA 1X8HA 5LCHA 3I13A 1JJTA 2ZNBA 3I11A 1JT1A 5HIOA 3SFPA 2YNVA 1VGNA 4LE6A 2DOOA 3KL7A 5ACXA 2H6AA 4RBSA 4RM5A 3AJ3A 1WUPA 4XUKA 2AIOA 4KEPA 5LSCA 4AD9A 2BTNA 1SMLA 2CFUA 4HL2A 5A23A 2P1EA 5HH6A 3JXPA 3ZR9A 2BR6A 2I7XA 5EV8A 2Y8AA 5LMCA 3T9MA 4C09A 2FU8A 2FU6A 2P97A 3IOFA 4DIKA 3DHBA 5A0VA 5FQBA 3AF6A 4ZNBA
chains in the Genus database with same CATH topology
3IE1A 4HKYA 2XR1A 4NQ2A 5K4NA 3S0ZA 4AX0B 4UWOB 1A7TA 1X8GA 2UYXA 5EVBA 5K4KA 5AEBA 3VQZA 4TZFA 2NZEA 4RL2A 4NQ6A 3WXCA 1YCHA 5EVDA 2FU7A 2GKLA 2BFZB 1A8TA 4J5HA 1KO3A 2GMNA 4EYFA 2ZWRA 2CBNA 3H3EA 4V0HA 2BFKA 2ZZIA 1HLKA 4FEKA 2YCBA 1YCFA 5K0WA 4RAWA 2BMIA 5K4MA 5ACVA 2GFKA 2BG8B 4GYQA 4D1WA 5KILA 3IEMA 3X2XA 5A87A 4C1DA 2FHXA 2DKFA 2GCUA 4TZBA 5ACRA 1DD6A 2NXAA 4C1EA 2WRSA 4ZO3A 5EWAA 2ZO4A 2M5DA 4Z67A 3FAIA 1XTOA 2FHXB 2GFJA 1ZTCA 4D1UA 3IOGA 5IQKA 3PY6A 4B87A 2R2DA 1ZKPA 5B15A 4D1VA 4C1GA 4EYLA 2YZ3A 1VMEA 3TP9A 2I7VA 2YNVB 5LM6A 2WYMC 3DHCA 2BGAA 2A7MA 2BIBA 4F6ZA 4U4LA 2XF4A 5ACTA 1DDKA 4EXYA 4YSKA 5FQCA 3P2UA 4AWYB 4C1HA 2VW8A 3ADRA 3AF5A 1WW1A 5LCFA 4Z5ZA 3F9OA 3I14A 5ACPA 2BFLA 3IE0A 3DH8A 4CHLA 2Y8BA 4Z5YA 5HH5A 5A5ZA 5HIPA 4ZO2A 4BP0A 2P18A 4P62A 3PY5A 3BC2A 4YSBA 3SD9A 2BG2A 5LCAA 4NQ4A 4PVTA 3IELA 4JO0A 3X2YA 2QDSA 4UWPB 5AXOA 2YNUA 2BG6A 1BVTA 2M5CA 5A0TA 5AHOA 5LS3A 1KO2A 5EH9A 4NQ5A 5AXRA 1M2XA 3SPUA 3MD7A 3ZWFA 3LVZA 4D1TA 3BK2A 1XM8A 2P4ZA 4J5FA 3FCZA 4TYFA 3IE2A 1Y44A 4FSBA 1X8IA 2YNWA 4KEQA 5B1UA 2NYPA 5DPXA 3SRXA 3KNSA 4C1CA 4EFZA 4F6HA 5KIKA 2OHIA 5ACUA 3SW3A 1JJEA 2Q0JA 1P9EA 2BG7A 2FU9A 4PVOA 2FK6A 5HH4A 4XWTA 3QH8A 3R2UA 4UBQA 4C1FA 3A4YA 3RPCA 4Z6XA 3I15A 4EY2A 3BV6A 4O98A 5AHRA 5HIQA 2E7YA 2Q42A 4BZ3A 1YCGA 4EXSA 1ZNBA 3G1PA 2AZ4A 4AX1B 3IDZA 3ZNBA 1MQOA 3ZQ4A 2QEDA 4FR7A 5FQAA 2OHJA 3VPEA 4AWZA 4Z7RA 5EV6A 2HB9A 3T3OA 4D02A 3SBLA 3RKJA 3PG4A 5EVKA 4HL1A 4EYBA 5ACSA 5ACWA 3KNRA 1KR3A 4ZEJA 4RAMA 4RL0A 4WD6A 4TZ9A 5HISA 2NZFA 1DXKA 4XWWA 1K07A 2Y87A 4GCWA 2QJSA 4Z60A 3RKKA 4DILA 2YNTA 2BFZA 5LE1A 4UWRB 4YSLA 4TZEA 5ACQA 2WYMA 2Q0IA 1VJNA 3X30A 1QH3A 1BC2A 5AYAA 2YNTB 4UA4A 1BMCA 1WUOA 2BG8A 5EW0A 3X2ZA 5EHTA 2Q9UA 4TYTA 1QH5A 3T3NA 2BC2A 1L9YA 4UWSB 5LLDA 1E5DA 4H0DA 2WHGA 5B3RA 4GYUA 3I0VA 1WRAA 3ESHA 2OHHA 2I7TA 3BK1A 3Q6VA 4UAMA 3L6NA 2QDTA 2QINA 3IEKA 3DHAA 2FM6A 2WYLA 1X8HA 5LCHA 3I13A 1JJTA 2ZNBA 3I11A 1JT1A 5HIOA 3SFPA 2YNVA 1VGNA 4LE6A 2DOOA 3KL7A 5ACXA 2H6AA 4RBSA 4RM5A 3AJ3A 1WUPA 4XUKA 2AIOA 4KEPA 5LSCA 4AD9A 2BTNA 1SMLA 4HL2A 2P1EA 5HH6A 3JXPA 3ZR9A 2BR6A 2I7XA 5EV8A 2Y8AA 5LMCA 3T9MA 4C09A 2FU8A 2FU6A 2P97A 3IOFA 4DIKA 3DHBA 5A0VA 5FQBA 3AF6A 4ZNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IE1 A;  4HKY A;  2XR1 A;  4NQ2 A;  5K4N A;  3S0Z A;  4AX0 B;  4UWO B;  1A7T A;  1X8G A;  2UYX A;  5EVB A;  5K4K A;  5AEB A;  3VQZ A;  4TZF A;  2NZE A;  4RL2 A;  4NQ6 A;  3WXC A;  1YCH A;  5EVD A;  2FU7 A;  2GKL A;  2BFZ B;  1A8T A;  4J5H A;  1KO3 A;  2GMN A;  4EYF A;  2ZWR A;  2CBN A;  3H3E A;  4V0H A;  2BFK A;  2ZZI A;  1HLK A;  4FEK A;  2YCB A;  1YCF A;  5K0W A;  4RAW A;  2BMI A;  5K4M A;  5ACV A;  2GFK A;  2BG8 B;  4GYQ A;  4D1W A;  5KIL A;  3IEM A;  3X2X A;  5A87 A;  4C1D A;  2FHX A;  2DKF A;  2GCU A;  4TZB A;  5ACR A;  1DD6 A;  2NXA A;  4C1E A;  2WRS A;  4ZO3 A;  5EWA A;  2ZO4 A;  2M5D A;  4Z67 A;  3FAI A;  1XTO A;  2FHX B;  2GFJ A;  1ZTC A;  4D1U A;  3IOG A;  5IQK A;  3PY6 A;  4B87 A;  2R2D A;  1ZKP A;  5B15 A;  4D1V A;  4C1G A;  4EYL A;  2YZ3 A;  1VME A;  3TP9 A;  2I7V A;  2YNV B;  5LM6 A;  2WYM C;  3DHC A;  2BGA A;  2A7M A;  2BIB A;  4F6Z A;  4U4L A;  2XF4 A;  5ACT A;  1DDK A;  4EXY A;  4YSK A;  5FQC A;  3P2U A;  4AWY B;  4C1H A;  2VW8 A;  3ADR A;  3AF5 A;  1WW1 A;  5LCF A;  4Z5Z A;  3F9O A;  3I14 A;  5ACP A;  2BFL A;  3IE0 A;  3DH8 A;  4CHL A;  2Y8B A;  4Z5Y A;  5HH5 A;  5A5Z A;  5HIP A;  4ZO2 A;  4BP0 A;  2P18 A;  4P62 A;  3PY5 A;  3BC2 A;  4YSB A;  3SD9 A;  2BG2 A;  5LCA A;  4NQ4 A;  4PVT A;  3IEL A;  4JO0 A;  3X2Y A;  2QDS A;  4UWP B;  5AXO A;  2YNU A;  2BG6 A;  1BVT A;  2M5C A;  5A0T A;  5AHO A;  5LS3 A;  1KO2 A;  5EH9 A;  4NQ5 A;  5AXR A;  1M2X A;  3SPU A;  3MD7 A;  3ZWF A;  3LVZ A;  4D1T A;  3BK2 A;  1XM8 A;  2P4Z A;  4J5F A;  3FCZ A;  4TYF A;  3IE2 A;  1Y44 A;  4FSB A;  1X8I A;  2YNW A;  4KEQ A;  5B1U A;  2NYP A;  5DPX A;  3SRX A;  3KNS A;  4C1C A;  4EFZ A;  4F6H A;  5KIK A;  2OHI A;  5ACU A;  3SW3 A;  1JJE A;  2Q0J A;  1P9E A;  2BG7 A;  2FU9 A;  4PVO A;  2FK6 A;  5HH4 A;  4XWT A;  3QH8 A;  3R2U A;  4UBQ A;  4C1F A;  3A4Y A;  3RPC A;  4Z6X A;  3I15 A;  4EY2 A;  3BV6 A;  4O98 A;  5AHR A;  5HIQ A;  2E7Y A;  2Q42 A;  4BZ3 A;  1YCG A;  4EXS A;  1ZNB A;  3G1P A;  2AZ4 A;  4AX1 B;  3IDZ A;  3ZNB A;  1MQO A;  3ZQ4 A;  2QED A;  4FR7 A;  5FQA A;  2OHJ A;  3VPE A;  4AWZ A;  4Z7R A;  5EV6 A;  2HB9 A;  3T3O A;  4D02 A;  3SBL A;  3RKJ A;  3PG4 A;  5EVK A;  4HL1 A;  4EYB A;  5ACS A;  5ACW A;  3KNR A;  1KR3 A;  4ZEJ A;  4RAM A;  4RL0 A;  4WD6 A;  4TZ9 A;  5HIS A;  2NZF A;  1DXK A;  4XWW A;  1K07 A;  2Y87 A;  4GCW A;  2QJS A;  4Z60 A;  3RKK A;  4DIL A;  2YNT A;  2BFZ A;  5LE1 A;  4UWR B;  4YSL A;  4TZE A;  5ACQ A;  2WYM A;  2Q0I A;  1VJN A;  3X30 A;  1QH3 A;  1BC2 A;  5AYA A;  2YNT B;  4UA4 A;  1BMC A;  1WUO A;  2BG8 A;  5EW0 A;  3X2Z A;  5EHT A;  2Q9U A;  4TYT A;  1QH5 A;  3T3N A;  2BC2 A;  1L9Y A;  4UWS B;  5LLD A;  1E5D A;  4H0D A;  2WHG A;  5B3R A;  4GYU A;  3I0V A;  1WRA A;  3ESH A;  2OHH A;  2I7T A;  3BK1 A;  3Q6V A;  4UAM A;  3L6N A;  2QDT A;  2QIN A;  3IEK A;  3DHA A;  2FM6 A;  2WYL A;  1X8H A;  5LCH A;  3I13 A;  1JJT A;  2ZNB A;  3I11 A;  1JT1 A;  5HIO A;  3SFP A;  2YNV A;  1VGN A;  4LE6 A;  2DOO A;  3KL7 A;  5ACX A;  2H6A A;  4RBS A;  4RM5 A;  3AJ3 A;  1WUP A;  4XUK A;  2AIO A;  4KEP A;  5LSC A;  4AD9 A;  2BTN A;  1SML A;  4HL2 A;  2P1E A;  5HH6 A;  3JXP A;  3ZR9 A;  2BR6 A;  2I7X A;  5EV8 A;  2Y8A A;  5LMC A;  3T9M A;  4C09 A;  2FU8 A;  2FU6 A;  2P97 A;  3IOF A;  4DIK A;  3DHB A;  5A0V A;  5FQB A;  3AF6 A;  4ZNB A; 
#chains in the Genus database with same CATH topology
 3IE1 A;  4HKY A;  2XR1 A;  4NQ2 A;  5K4N A;  3S0Z A;  4AX0 B;  4UWO B;  1A7T A;  1X8G A;  2UYX A;  5EVB A;  5K4K A;  5AEB A;  3VQZ A;  4TZF A;  2NZE A;  4RL2 A;  4NQ6 A;  3WXC A;  1YCH A;  5EVD A;  2FU7 A;  2GKL A;  2BFZ B;  1A8T A;  4J5H A;  1KO3 A;  2GMN A;  4EYF A;  2ZWR A;  2CBN A;  3H3E A;  4V0H A;  2BFK A;  2ZZI A;  1HLK A;  4FEK A;  2YCB A;  1YCF A;  5K0W A;  4RAW A;  2BMI A;  5K4M A;  5ACV A;  2GFK A;  2BG8 B;  4GYQ A;  4D1W A;  5KIL A;  3IEM A;  3X2X A;  5A87 A;  4C1D A;  2FHX A;  2DKF A;  2GCU A;  4TZB A;  5ACR A;  1DD6 A;  2NXA A;  4C1E A;  2WRS A;  4PDX A;  4ZO3 A;  5EWA A;  2ZO4 A;  2M5D A;  4Z67 A;  3FAI A;  1XTO A;  2FHX B;  2GFJ A;  1ZTC A;  4D1U A;  3IOG A;  5IQK A;  3PY6 A;  4B87 A;  2R2D A;  1ZKP A;  5B15 A;  4D1V A;  4C1G A;  4EYL A;  2YZ3 A;  2CFZ A;  1VME A;  3TP9 A;  2I7V A;  2YNV B;  5LM6 A;  2WYM C;  3DHC A;  2BGA A;  2A7M A;  5AJL A;  2BIB A;  4F6Z A;  4U4L A;  2XF4 A;  5ACT A;  1DDK A;  4AXH A;  4EXY A;  4YSK A;  5FQC A;  3P2U A;  4AWY B;  4C1H A;  2VW8 A;  3ADR A;  3AF5 A;  1WW1 A;  5LCF A;  4Z5Z A;  3F9O A;  3I14 A;  5ACP A;  2BFL A;  3IE0 A;  3DH8 A;  4CHL A;  2Y8B A;  4Z5Y A;  5HH5 A;  5A5Z A;  5HIP A;  4ZO2 A;  4BP0 A;  2P18 A;  4P62 A;  3PY5 A;  3BC2 A;  4YSB A;  3SD9 A;  2BG2 A;  5LCA A;  4NQ4 A;  4PVT A;  3IEL A;  4JO0 A;  3X2Y A;  2QDS A;  4UWP B;  5AXO A;  2YNU A;  2BG6 A;  1BVT A;  2M5C A;  5A0T A;  5AHO A;  5LS3 A;  1KO2 A;  5EH9 A;  4NQ5 A;  5AXR A;  1M2X A;  3SPU A;  2CG2 A;  3MD7 A;  3ZWF A;  3LVZ A;  4D1T A;  3BK2 A;  1XM8 A;  2P4Z A;  4J5F A;  3FCZ A;  4TYF A;  3IE2 A;  1Y44 A;  4FSB A;  1X8I A;  2YNW A;  4KEQ A;  5B1U A;  2NYP A;  5DPX A;  3SRX A;  3KNS A;  4C1C A;  4EFZ A;  4F6H A;  5KIK A;  2OHI A;  5ACU A;  3SW3 A;  1JJE A;  2Q0J A;  5AIJ A;  1P9E A;  2BG7 A;  2FU9 A;  4PVO A;  2FK6 A;  5HH4 A;  4XWT A;  3QH8 A;  3R2U A;  4UBQ A;  4C1F A;  3A4Y A;  3RPC A;  2YHE A;  4Z6X A;  3I15 A;  4EY2 A;  3BV6 A;  4O98 A;  5AHR A;  5HIQ A;  2E7Y A;  2Q42 A;  4BZ3 A;  1YCG A;  4EXS A;  1ZNB A;  3G1P A;  2AZ4 A;  4AX1 B;  3IDZ A;  3ZNB A;  1MQO A;  3ZQ4 A;  2QED A;  4FR7 A;  5FQA A;  2OHJ A;  3VPE A;  4AWZ A;  4Z7R A;  5EV6 A;  2HB9 A;  3T3O A;  4D02 A;  3SBL A;  3RKJ A;  3PG4 A;  5EVK A;  4HL1 A;  4EYB A;  5ACS A;  5ACW A;  3KNR A;  1KR3 A;  4ZEJ A;  4RAM A;  4RL0 A;  4WD6 A;  4TZ9 A;  5HIS A;  2NZF A;  1DXK A;  4XWW A;  1K07 A;  2Y87 A;  4GCW A;  2QJS A;  4Z60 A;  3RKK A;  4DIL A;  2YNT A;  2BFZ A;  5LE1 A;  4UWR B;  4YSL A;  4TZE A;  5ACQ A;  2WYM A;  2Q0I A;  1VJN A;  3X30 A;  1QH3 A;  1BC2 A;  5AYA A;  2YNT B;  4UA4 A;  1BMC A;  1WUO A;  2BG8 A;  5EW0 A;  3X2Z A;  5EHT A;  2Q9U A;  4TYT A;  1QH5 A;  3T3N A;  2BC2 A;  1L9Y A;  4UWS B;  5LLD A;  1E5D A;  4H0D A;  2WHG A;  5B3R A;  4GYU A;  3I0V A;  1WRA A;  3ESH A;  2OHH A;  4AV7 A;  2I7T A;  3BK1 A;  3Q6V A;  4NUR A;  4UAM A;  3L6N A;  2QDT A;  2QIN A;  3IEK A;  2CG3 A;  3DHA A;  2FM6 A;  2WYL A;  1X8H A;  5LCH A;  3I13 A;  1JJT A;  2ZNB A;  3I11 A;  1JT1 A;  5HIO A;  3SFP A;  2YNV A;  1VGN A;  4LE6 A;  2DOO A;  3KL7 A;  5ACX A;  2H6A A;  4RBS A;  4RM5 A;  3AJ3 A;  1WUP A;  4XUK A;  2AIO A;  4KEP A;  5LSC A;  4AD9 A;  2BTN A;  1SML A;  2CFU A;  4HL2 A;  5A23 A;  2P1E A;  5HH6 A;  3JXP A;  3ZR9 A;  2BR6 A;  2I7X A;  5EV8 A;  2Y8A A;  5LMC A;  3T9M A;  4C09 A;  2FU8 A;  2FU6 A;  2P97 A;  3IOF A;  4DIK A;  3DHB A;  5A0V A;  5FQB A;  3AF6 A;  4ZNB A; 
#chains in the Genus database with same CATH homology
 3IE1 A;  4HKY A;  2XR1 A;  4NQ2 A;  5K4N A;  3S0Z A;  4AX0 B;  4UWO B;  1A7T A;  1X8G A;  2UYX A;  5EVB A;  5K4K A;  5AEB A;  3VQZ A;  4TZF A;  2NZE A;  4RL2 A;  4NQ6 A;  3WXC A;  1YCH A;  5EVD A;  2FU7 A;  2GKL A;  2BFZ B;  1A8T A;  4J5H A;  1KO3 A;  2GMN A;  4EYF A;  2ZWR A;  2CBN A;  3H3E A;  4V0H A;  2BFK A;  2ZZI A;  1HLK A;  4FEK A;  2YCB A;  1YCF A;  5K0W A;  4RAW A;  2BMI A;  5K4M A;  5ACV A;  2GFK A;  2BG8 B;  4GYQ A;  4D1W A;  5KIL A;  3IEM A;  3X2X A;  5A87 A;  4C1D A;  2FHX A;  2DKF A;  2GCU A;  4TZB A;  5ACR A;  1DD6 A;  2NXA A;  4C1E A;  2WRS A;  4ZO3 A;  5EWA A;  2ZO4 A;  2M5D A;  4Z67 A;  3FAI A;  1XTO A;  2FHX B;  2GFJ A;  1ZTC A;  4D1U A;  3IOG A;  5IQK A;  3PY6 A;  4B87 A;  2R2D A;  1ZKP A;  5B15 A;  4D1V A;  4C1G A;  4EYL A;  2YZ3 A;  1VME A;  3TP9 A;  2I7V A;  2YNV B;  5LM6 A;  2WYM C;  3DHC A;  2BGA A;  2A7M A;  2BIB A;  4F6Z A;  4U4L A;  2XF4 A;  5ACT A;  1DDK A;  4EXY A;  4YSK A;  5FQC A;  3P2U A;  4AWY B;  4C1H A;  2VW8 A;  3ADR A;  3AF5 A;  1WW1 A;  5LCF A;  4Z5Z A;  3F9O A;  3I14 A;  5ACP A;  2BFL A;  3IE0 A;  3DH8 A;  4CHL A;  2Y8B A;  4Z5Y A;  5HH5 A;  5A5Z A;  5HIP A;  4ZO2 A;  4BP0 A;  2P18 A;  4P62 A;  3PY5 A;  3BC2 A;  4YSB A;  3SD9 A;  2BG2 A;  5LCA A;  4NQ4 A;  4PVT A;  3IEL A;  4JO0 A;  3X2Y A;  2QDS A;  4UWP B;  5AXO A;  2YNU A;  2BG6 A;  1BVT A;  2M5C A;  5A0T A;  5AHO A;  5LS3 A;  1KO2 A;  5EH9 A;  4NQ5 A;  5AXR A;  1M2X A;  3SPU A;  3MD7 A;  3ZWF A;  3LVZ A;  4D1T A;  3BK2 A;  1XM8 A;  2P4Z A;  4J5F A;  3FCZ A;  4TYF A;  3IE2 A;  1Y44 A;  4FSB A;  1X8I A;  2YNW A;  4KEQ A;  5B1U A;  2NYP A;  5DPX A;  3SRX A;  3KNS A;  4C1C A;  4EFZ A;  4F6H A;  5KIK A;  2OHI A;  5ACU A;  3SW3 A;  1JJE A;  2Q0J A;  1P9E A;  2BG7 A;  2FU9 A;  4PVO A;  2FK6 A;  5HH4 A;  4XWT A;  3QH8 A;  3R2U A;  4UBQ A;  4C1F A;  3A4Y A;  3RPC A;  4Z6X A;  3I15 A;  4EY2 A;  3BV6 A;  4O98 A;  5AHR A;  5HIQ A;  2E7Y A;  2Q42 A;  4BZ3 A;  1YCG A;  4EXS A;  1ZNB A;  3G1P A;  2AZ4 A;  4AX1 B;  3IDZ A;  3ZNB A;  1MQO A;  3ZQ4 A;  2QED A;  4FR7 A;  5FQA A;  2OHJ A;  3VPE A;  4AWZ A;  4Z7R A;  5EV6 A;  2HB9 A;  3T3O A;  4D02 A;  3SBL A;  3RKJ A;  3PG4 A;  5EVK A;  4HL1 A;  4EYB A;  5ACS A;  5ACW A;  3KNR A;  1KR3 A;  4ZEJ A;  4RAM A;  4RL0 A;  4WD6 A;  4TZ9 A;  5HIS A;  2NZF A;  1DXK A;  4XWW A;  1K07 A;  2Y87 A;  4GCW A;  2QJS A;  4Z60 A;  3RKK A;  4DIL A;  2YNT A;  2BFZ A;  5LE1 A;  4UWR B;  4YSL A;  4TZE A;  5ACQ A;  2WYM A;  2Q0I A;  1VJN A;  3X30 A;  1QH3 A;  1BC2 A;  5AYA A;  2YNT B;  4UA4 A;  1BMC A;  1WUO A;  2BG8 A;  5EW0 A;  3X2Z A;  5EHT A;  2Q9U A;  4TYT A;  1QH5 A;  3T3N A;  2BC2 A;  1L9Y A;  4UWS B;  5LLD A;  1E5D A;  4H0D A;  2WHG A;  5B3R A;  4GYU A;  3I0V A;  1WRA A;  3ESH A;  2OHH A;  2I7T A;  3BK1 A;  3Q6V A;  4UAM A;  3L6N A;  2QDT A;  2QIN A;  3IEK A;  3DHA A;  2FM6 A;  2WYL A;  1X8H A;  5LCH A;  3I13 A;  1JJT A;  2ZNB A;  3I11 A;  1JT1 A;  5HIO A;  3SFP A;  2YNV A;  1VGN A;  4LE6 A;  2DOO A;  3KL7 A;  5ACX A;  2H6A A;  4RBS A;  4RM5 A;  3AJ3 A;  1WUP A;  4XUK A;  2AIO A;  4KEP A;  5LSC A;  4AD9 A;  2BTN A;  1SML A;  4HL2 A;  2P1E A;  5HH6 A;  3JXP A;  3ZR9 A;  2BR6 A;  2I7X A;  5EV8 A;  2Y8A A;  5LMC A;  3T9M A;  4C09 A;  2FU8 A;  2FU6 A;  2P97 A;  3IOF A;  4DIK A;  3DHB A;  5A0V A;  5FQB A;  3AF6 A;  4ZNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...