1DDKA

Crystal structure of imp-1 metallo beta-lactamase from pseudomonas aeruginosa
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
220
structure length
220
Chain Sequence
ESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords IMP-1 METALLO BETA-LACTAMASE
publication title Crystal structure of the IMP-1 metallo beta-lactamase from Pseudomonas aeruginosa and its complex with a mercaptocarboxylate inhibitor: binding determinants of a potent, broad-spectrum inhibitor.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 67
structure length 220
sequence length 220
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1999-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1ddkA00
2XR1A 3R2UA 4Z5ZA 1X8HA 4RAMA 1QH5A 3WXCA 3RKJA 1P9EA 2BFZA 2WYLA 2DOOA 3SPUA 3ZWFA 2NXAA 3I15A 3X2XA 4XWTA 2BG8A 3IELA 3L6NA 2WRSA 5K4MA 5ACPA 5ACUA 1BC2A 1QH3A 4ZEJA 4TYFA 3P2UA 5EVDA 2BIBA 1K07A 2E7YA 5EVKA 4TZ9A 4JO0A 4RL2A 5LSCA 4FEKA 3BC2A 3FAIA 3VPEA 1ZTCA 5DPXA 1A7TA 5B1UA 2ZZIA 2OHJA 2WHGA 4UWOB 2BFZB 2QDSA 4D1UA 5IQKA 4TYTA 5FQCA 2BTNA 4F6HA 2NZFA 2R2DA 1BVTA 2QEDA 4YSLA 2Q42A 3Q6VA 5EV6A 4DIKA 2BG8B 5HISA 1A8TA 2UYXA 3X2ZA 5HIPA 4EXYA 4P62A 1SMLA 4C1CA 1DDKA 4AX1B 5LCAA 3SFPA 4EFZA 4FR7A 2I7TA 4NQ5A 4YSBA 1KR3A 2P1EA 2OHHA 5HH5A 4B87A 4ZO2A 1DXKA 2QINA 2HB9A 5LS3A 2ZWRA 5ACTA 2WYMA 3QH8A 4DILA 1VGNA 1WUOA 4PVOA 3S0ZA 4EY2A 3IDZA 1KO2A 4Z6XA 2YNWA 4UAMA 1VMEA 4UWRB 5LE1A 4U4LA 3KNSA 4NQ2A 4XUKA 2GFKA 5EV8A 2WYMC 3A4YA 3IOGA 5HIQA 4AWZA 3F9OA 5LCFA 2FK6A 4BP0A 4Z60A 4WD6A 4PVTA 4D1VA 4D1TA 5EW0A 2FHXA 5EVBA 2YZ3A 3VQZA 2P4ZA 5LCHA 4UWPB 5ACRA 1YCFA 3AF5A 3I13A 2BR6A 4Z67A 3ZQ4A 3DH8A 3DHBA 5A87A 2Y8BA 5EWAA 4UA4A 2YCBA 3ESHA 5ACXA 2BFKA 1XM8A 2FU9A 2CBNA 1X8GA 2H6AA 3IEMA 5LMCA 2ZO4A 4FSBA 2NZEA 5AYAA 5AHRA 1JJTA 5B3RA 2GCUA 4GYUA 2AIOA 3ADRA 2GKLA 4TZBA 2I7VA 3LVZA 1E5DA 4C1GA 3I0VA 3SBLA 2Q0JA 5AXRA 5FQAA 5A5ZA 5KIKA 2FU7A 2FHXB 3PY6A 3X30A 3IE2A 2XF4A 3DHCA 2P97A 4D1WA 4GCWA 1WW1A 3X2YA 4J5HA 4Z5YA 4F6ZA 4C1DA 3IE0A 4EYBA 1ZKPA 3ZNBA 4D02A 3RKKA 4KEPA 4J5FA 4EYLA 3KNRA 5AEBA 2BG7A 1JJEA 5K4NA 3PY5A 4H0DA 3H3EA 3G1PA 5HH4A 5AXOA 4UBQA 3IOFA 5ACSA 3T9MA 5ACQA 2YNTA 3IEKA 1JT1A 3BV6A 5A0VA 5K4KA 1Y44A 5FQBA 3BK2A 5ACVA 2Q9UA 3DHAA 4HL1A 4RBSA 4BZ3A 3KL7A 3RPCA 3T3NA 2BMIA 2BG2A 2Q0IA 2YNVA 1MQOA 4RAWA 2FU6A 1KO3A 5HIOA 4AD9A 5K0WA 1HLKA 3JXPA 1XTOA 4YSKA 4GYQA 4TZEA 1M2XA 1YCGA 4CHLA 4V0HA 5KILA 1BMCA 4AX0B 5LM6A 3SW3A 1X8IA 2FM6A 2ZNBA 5B15A 4TZFA 2I7XA 4ZNBA 2YNTB 3PG4A 2P18A 2QJSA 2Y8AA 4HL2A 2BC2A 2BGAA 4XWWA 4NQ6A 4Z7RA 4ZO3A 3T3OA 1WUPA 3MD7A 3AJ3A 1WRAA 5AHOA 2GFJA 3SRXA 4C1FA 5A0TA 2YNVB 4C1EA 3FCZA 4RM5A 2BG6A 5EHTA 4EXSA 2Y87A 4EYFA 1L9YA 1VJNA 5EH9A 2QDTA 4HKYA 4AWYB 3TP9A 2FU8A 2DKFA 1YCHA 3I14A 3AF6A 4C09A 1DD6A 2YNUA 5ACWA 4UWSB 5LLDA 3BK1A 2GMNA 2NYPA 4KEQA 2BFLA 2M5DA 2AZ4A 4RL0A 3SD9A 2VW8A 3ZR9A 2M5CA 4C1HA 2OHIA 2A7MA 5HH6A 1ZNBA 4NQ4A 3IE1A 3I11A 4LE6A 4O98A
chains in the Genus database with same CATH superfamily
2XR1A 3R2UA 4Z5ZA 1X8HA 4RAMA 1QH5A 3WXCA 3RKJA 1P9EA 2BFZA 2WYLA 2DOOA 3SPUA 3ZWFA 2NXAA 3I15A 4NURA 3X2XA 4XWTA 2BG8A 3IELA 3L6NA 2WRSA 5K4MA 5ACPA 5ACUA 1BC2A 1QH3A 4ZEJA 4TYFA 3P2UA 5EVDA 2BIBA 1K07A 2E7YA 5EVKA 4TZ9A 4JO0A 4RL2A 4AV7A 5LSCA 4FEKA 3BC2A 3FAIA 3VPEA 1ZTCA 5DPXA 1A7TA 5B1UA 2ZZIA 2OHJA 2WHGA 4UWOB 2BFZB 2QDSA 4D1UA 5IQKA 4TYTA 5FQCA 2BTNA 4F6HA 2NZFA 2R2DA 1BVTA 2QEDA 4YSLA 2Q42A 3Q6VA 5EV6A 4DIKA 2BG8B 5HISA 1A8TA 2UYXA 3X2ZA 5HIPA 4EXYA 4P62A 1SMLA 4C1CA 1DDKA 4AX1B 5LCAA 3SFPA 4EFZA 4FR7A 2I7TA 4NQ5A 4YSBA 1KR3A 2P1EA 5AIJA 2OHHA 5HH5A 4B87A 4ZO2A 1DXKA 2QINA 2HB9A 5LS3A 2ZWRA 5ACTA 2WYMA 3QH8A 4DILA 1VGNA 1WUOA 4PVOA 3S0ZA 4EY2A 3IDZA 1KO2A 4Z6XA 2YNWA 4UAMA 1VMEA 4UWRB 5LE1A 4U4LA 3KNSA 4NQ2A 4XUKA 2GFKA 5EV8A 2WYMC 3A4YA 3IOGA 5HIQA 4AWZA 3F9OA 5LCFA 2FK6A 4BP0A 4Z60A 4WD6A 4PVTA 4D1VA 4D1TA 5EW0A 2FHXA 5EVBA 2YZ3A 3VQZA 2P4ZA 5LCHA 4UWPB 5ACRA 1YCFA 3AF5A 3I13A 2BR6A 4Z67A 3ZQ4A 3DH8A 3DHBA 5A87A 2Y8BA 5EWAA 4UA4A 2YCBA 3ESHA 5ACXA 2BFKA 1XM8A 2FU9A 2CBNA 1X8GA 2H6AA 3IEMA 5LMCA 2ZO4A 4FSBA 2NZEA 5AYAA 5AHRA 1JJTA 5B3RA 2GCUA 4GYUA 2AIOA 3ADRA 2GKLA 4TZBA 2I7VA 3LVZA 1E5DA 4C1GA 3I0VA 3SBLA 2Q0JA 5AXRA 5FQAA 5A5ZA 5KIKA 2FU7A 2FHXB 3PY6A 3X30A 3IE2A 2XF4A 3DHCA 2P97A 4D1WA 2YHEA 4GCWA 1WW1A 3X2YA 4J5HA 4Z5YA 4F6ZA 4C1DA 3IE0A 4EYBA 1ZKPA 3ZNBA 4D02A 3RKKA 4KEPA 4J5FA 4EYLA 3KNRA 5AEBA 2BG7A 1JJEA 5K4NA 3PY5A 4H0DA 2CFZA 3H3EA 3G1PA 5HH4A 5AXOA 4UBQA 3IOFA 5ACSA 3T9MA 5ACQA 2YNTA 4PDXA 3IEKA 1JT1A 3BV6A 5A0VA 5K4KA 1Y44A 5FQBA 3BK2A 5ACVA 2Q9UA 3DHAA 4HL1A 4RBSA 4BZ3A 3KL7A 3RPCA 3T3NA 2BMIA 2BG2A 2Q0IA 2YNVA 1MQOA 4RAWA 2FU6A 1KO3A 5HIOA 4AD9A 5K0WA 1HLKA 3JXPA 1XTOA 4YSKA 4GYQA 4TZEA 1M2XA 1YCGA 4CHLA 4V0HA 5KILA 1BMCA 4AX0B 5LM6A 3SW3A 2CFUA 1X8IA 2FM6A 2ZNBA 5B15A 4TZFA 2I7XA 4ZNBA 2YNTB 3PG4A 2P18A 2QJSA 2Y8AA 4HL2A 2BC2A 2BGAA 4XWWA 4NQ6A 4Z7RA 4ZO3A 3T3OA 1WUPA 3MD7A 2CG2A 3AJ3A 1WRAA 5AHOA 2GFJA 2CG3A 3SRXA 4C1FA 5A0TA 2YNVB 5A23A 4C1EA 3FCZA 4RM5A 2BG6A 5EHTA 4EXSA 2Y87A 4EYFA 1L9YA 1VJNA 5EH9A 2QDTA 4HKYA 4AWYB 3TP9A 2FU8A 4AXHA 2DKFA 1YCHA 3I14A 3AF6A 4C09A 1DD6A 2YNUA 5ACWA 4UWSB 5LLDA 3BK1A 2GMNA 2NYPA 4KEQA 2BFLA 2M5DA 2AZ4A 4RL0A 3SD9A 2VW8A 3ZR9A 5AJLA 2M5CA 4C1HA 2OHIA 2A7MA 5HH6A 1ZNBA 4NQ4A 3IE1A 3I11A 4LE6A 4O98A
chains in the Genus database with same CATH topology
2XR1A 3R2UA 4Z5ZA 1X8HA 4RAMA 1QH5A 3WXCA 3RKJA 1P9EA 2BFZA 2WYLA 2DOOA 3SPUA 3ZWFA 2NXAA 3I15A 3X2XA 4XWTA 2BG8A 3IELA 3L6NA 2WRSA 5K4MA 5ACPA 5ACUA 1BC2A 1QH3A 4ZEJA 4TYFA 3P2UA 5EVDA 2BIBA 1K07A 2E7YA 5EVKA 4TZ9A 4JO0A 4RL2A 5LSCA 4FEKA 3BC2A 3FAIA 3VPEA 1ZTCA 5DPXA 1A7TA 5B1UA 2ZZIA 2OHJA 2WHGA 4UWOB 2BFZB 2QDSA 4D1UA 5IQKA 4TYTA 5FQCA 2BTNA 4F6HA 2NZFA 2R2DA 1BVTA 2QEDA 4YSLA 2Q42A 3Q6VA 5EV6A 4DIKA 2BG8B 5HISA 1A8TA 2UYXA 3X2ZA 5HIPA 4EXYA 4P62A 1SMLA 4C1CA 1DDKA 4AX1B 5LCAA 3SFPA 4EFZA 4FR7A 2I7TA 4NQ5A 4YSBA 1KR3A 2P1EA 2OHHA 5HH5A 4B87A 4ZO2A 1DXKA 2QINA 2HB9A 5LS3A 2ZWRA 5ACTA 2WYMA 3QH8A 4DILA 1VGNA 1WUOA 4PVOA 3S0ZA 4EY2A 3IDZA 1KO2A 4Z6XA 2YNWA 4UAMA 1VMEA 4UWRB 5LE1A 4U4LA 3KNSA 4NQ2A 4XUKA 2GFKA 5EV8A 2WYMC 3A4YA 3IOGA 5HIQA 4AWZA 3F9OA 5LCFA 2FK6A 4BP0A 4Z60A 4WD6A 4PVTA 4D1VA 4D1TA 5EW0A 2FHXA 5EVBA 2YZ3A 3VQZA 2P4ZA 5LCHA 4UWPB 5ACRA 1YCFA 3AF5A 3I13A 2BR6A 4Z67A 3ZQ4A 3DH8A 3DHBA 5A87A 2Y8BA 5EWAA 4UA4A 2YCBA 3ESHA 5ACXA 2BFKA 1XM8A 2FU9A 2CBNA 1X8GA 2H6AA 3IEMA 5LMCA 2ZO4A 4FSBA 2NZEA 5AYAA 5AHRA 1JJTA 5B3RA 2GCUA 4GYUA 2AIOA 3ADRA 2GKLA 4TZBA 2I7VA 3LVZA 1E5DA 4C1GA 3I0VA 3SBLA 2Q0JA 5AXRA 5FQAA 5A5ZA 5KIKA 2FU7A 2FHXB 3PY6A 3X30A 3IE2A 2XF4A 3DHCA 2P97A 4D1WA 4GCWA 1WW1A 3X2YA 4J5HA 4Z5YA 4F6ZA 4C1DA 3IE0A 4EYBA 1ZKPA 3ZNBA 4D02A 3RKKA 4KEPA 4J5FA 4EYLA 3KNRA 5AEBA 2BG7A 1JJEA 5K4NA 3PY5A 4H0DA 3H3EA 3G1PA 5HH4A 5AXOA 4UBQA 3IOFA 5ACSA 3T9MA 5ACQA 2YNTA 3IEKA 1JT1A 3BV6A 5A0VA 5K4KA 1Y44A 5FQBA 3BK2A 5ACVA 2Q9UA 3DHAA 4HL1A 4RBSA 4BZ3A 3KL7A 3RPCA 3T3NA 2BMIA 2BG2A 2Q0IA 2YNVA 1MQOA 4RAWA 2FU6A 1KO3A 5HIOA 4AD9A 5K0WA 1HLKA 3JXPA 1XTOA 4YSKA 4GYQA 4TZEA 1M2XA 1YCGA 4CHLA 4V0HA 5KILA 1BMCA 4AX0B 5LM6A 3SW3A 1X8IA 2FM6A 2ZNBA 5B15A 4TZFA 2I7XA 4ZNBA 2YNTB 3PG4A 2P18A 2QJSA 2Y8AA 4HL2A 2BC2A 2BGAA 4XWWA 4NQ6A 4Z7RA 4ZO3A 3T3OA 1WUPA 3MD7A 3AJ3A 1WRAA 5AHOA 2GFJA 3SRXA 4C1FA 5A0TA 2YNVB 4C1EA 3FCZA 4RM5A 2BG6A 5EHTA 4EXSA 2Y87A 4EYFA 1L9YA 1VJNA 5EH9A 2QDTA 4HKYA 4AWYB 3TP9A 2FU8A 2DKFA 1YCHA 3I14A 3AF6A 4C09A 1DD6A 2YNUA 5ACWA 4UWSB 5LLDA 3BK1A 2GMNA 2NYPA 4KEQA 2BFLA 2M5DA 2AZ4A 4RL0A 3SD9A 2VW8A 3ZR9A 2M5CA 4C1HA 2OHIA 2A7MA 5HH6A 1ZNBA 4NQ4A 3IE1A 3I11A 4LE6A 4O98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XR1 A;  3R2U A;  4Z5Z A;  1X8H A;  4RAM A;  1QH5 A;  3WXC A;  3RKJ A;  1P9E A;  2BFZ A;  2WYL A;  2DOO A;  3SPU A;  3ZWF A;  2NXA A;  3I15 A;  3X2X A;  4XWT A;  2BG8 A;  3IEL A;  3L6N A;  2WRS A;  5K4M A;  5ACP A;  5ACU A;  1BC2 A;  1QH3 A;  4ZEJ A;  4TYF A;  3P2U A;  5EVD A;  2BIB A;  1K07 A;  2E7Y A;  5EVK A;  4TZ9 A;  4JO0 A;  4RL2 A;  5LSC A;  4FEK A;  3BC2 A;  3FAI A;  3VPE A;  1ZTC A;  5DPX A;  1A7T A;  5B1U A;  2ZZI A;  2OHJ A;  2WHG A;  4UWO B;  2BFZ B;  2QDS A;  4D1U A;  5IQK A;  4TYT A;  5FQC A;  2BTN A;  4F6H A;  2NZF A;  2R2D A;  1BVT A;  2QED A;  4YSL A;  2Q42 A;  3Q6V A;  5EV6 A;  4DIK A;  2BG8 B;  5HIS A;  1A8T A;  2UYX A;  3X2Z A;  5HIP A;  4EXY A;  4P62 A;  1SML A;  4C1C A;  1DDK A;  4AX1 B;  5LCA A;  3SFP A;  4EFZ A;  4FR7 A;  2I7T A;  4NQ5 A;  4YSB A;  1KR3 A;  2P1E A;  2OHH A;  5HH5 A;  4B87 A;  4ZO2 A;  1DXK A;  2QIN A;  2HB9 A;  5LS3 A;  2ZWR A;  5ACT A;  2WYM A;  3QH8 A;  4DIL A;  1VGN A;  1WUO A;  4PVO A;  3S0Z A;  4EY2 A;  3IDZ A;  1KO2 A;  4Z6X A;  2YNW A;  4UAM A;  1VME A;  4UWR B;  5LE1 A;  4U4L A;  3KNS A;  4NQ2 A;  4XUK A;  2GFK A;  5EV8 A;  2WYM C;  3A4Y A;  3IOG A;  5HIQ A;  4AWZ A;  3F9O A;  5LCF A;  2FK6 A;  4BP0 A;  4Z60 A;  4WD6 A;  4PVT A;  4D1V A;  4D1T A;  5EW0 A;  2FHX A;  5EVB A;  2YZ3 A;  3VQZ A;  2P4Z A;  5LCH A;  4UWP B;  5ACR A;  1YCF A;  3AF5 A;  3I13 A;  2BR6 A;  4Z67 A;  3ZQ4 A;  3DH8 A;  3DHB A;  5A87 A;  2Y8B A;  5EWA A;  4UA4 A;  2YCB A;  3ESH A;  5ACX A;  2BFK A;  1XM8 A;  2FU9 A;  2CBN A;  1X8G A;  2H6A A;  3IEM A;  5LMC A;  2ZO4 A;  4FSB A;  2NZE A;  5AYA A;  5AHR A;  1JJT A;  5B3R A;  2GCU A;  4GYU A;  2AIO A;  3ADR A;  2GKL A;  4TZB A;  2I7V A;  3LVZ A;  1E5D A;  4C1G A;  3I0V A;  3SBL A;  2Q0J A;  5AXR A;  5FQA A;  5A5Z A;  5KIK A;  2FU7 A;  2FHX B;  3PY6 A;  3X30 A;  3IE2 A;  2XF4 A;  3DHC A;  2P97 A;  4D1W A;  4GCW A;  1WW1 A;  3X2Y A;  4J5H A;  4Z5Y A;  4F6Z A;  4C1D A;  3IE0 A;  4EYB A;  1ZKP A;  3ZNB A;  4D02 A;  3RKK A;  4KEP A;  4J5F A;  4EYL A;  3KNR A;  5AEB A;  2BG7 A;  1JJE A;  5K4N A;  3PY5 A;  4H0D A;  3H3E A;  3G1P A;  5HH4 A;  5AXO A;  4UBQ A;  3IOF A;  5ACS A;  3T9M A;  5ACQ A;  2YNT A;  3IEK A;  1JT1 A;  3BV6 A;  5A0V A;  5K4K A;  1Y44 A;  5FQB A;  3BK2 A;  5ACV A;  2Q9U A;  3DHA A;  4HL1 A;  4RBS A;  4BZ3 A;  3KL7 A;  3RPC A;  3T3N A;  2BMI A;  2BG2 A;  2Q0I A;  2YNV A;  1MQO A;  4RAW A;  2FU6 A;  1KO3 A;  5HIO A;  4AD9 A;  5K0W A;  1HLK A;  3JXP A;  1XTO A;  4YSK A;  4GYQ A;  4TZE A;  1M2X A;  1YCG A;  4CHL A;  4V0H A;  5KIL A;  1BMC A;  4AX0 B;  5LM6 A;  3SW3 A;  1X8I A;  2FM6 A;  2ZNB A;  5B15 A;  4TZF A;  2I7X A;  4ZNB A;  2YNT B;  3PG4 A;  2P18 A;  2QJS A;  2Y8A A;  4HL2 A;  2BC2 A;  2BGA A;  4XWW A;  4NQ6 A;  4Z7R A;  4ZO3 A;  3T3O A;  1WUP A;  3MD7 A;  3AJ3 A;  1WRA A;  5AHO A;  2GFJ A;  3SRX A;  4C1F A;  5A0T A;  2YNV B;  4C1E A;  3FCZ A;  4RM5 A;  2BG6 A;  5EHT A;  4EXS A;  2Y87 A;  4EYF A;  1L9Y A;  1VJN A;  5EH9 A;  2QDT A;  4HKY A;  4AWY B;  3TP9 A;  2FU8 A;  2DKF A;  1YCH A;  3I14 A;  3AF6 A;  4C09 A;  1DD6 A;  2YNU A;  5ACW A;  4UWS B;  5LLD A;  3BK1 A;  2GMN A;  2NYP A;  4KEQ A;  2BFL A;  2M5D A;  2AZ4 A;  4RL0 A;  3SD9 A;  2VW8 A;  3ZR9 A;  2M5C A;  4C1H A;  2OHI A;  2A7M A;  5HH6 A;  1ZNB A;  4NQ4 A;  3IE1 A;  3I11 A;  4LE6 A;  4O98 A; 
#chains in the Genus database with same CATH topology
 2XR1 A;  3R2U A;  4Z5Z A;  1X8H A;  4RAM A;  1QH5 A;  3WXC A;  3RKJ A;  1P9E A;  2BFZ A;  2WYL A;  2DOO A;  3SPU A;  3ZWF A;  2NXA A;  3I15 A;  4NUR A;  3X2X A;  4XWT A;  2BG8 A;  3IEL A;  3L6N A;  2WRS A;  5K4M A;  5ACP A;  5ACU A;  1BC2 A;  1QH3 A;  4ZEJ A;  4TYF A;  3P2U A;  5EVD A;  2BIB A;  1K07 A;  2E7Y A;  5EVK A;  4TZ9 A;  4JO0 A;  4RL2 A;  4AV7 A;  5LSC A;  4FEK A;  3BC2 A;  3FAI A;  3VPE A;  1ZTC A;  5DPX A;  1A7T A;  5B1U A;  2ZZI A;  2OHJ A;  2WHG A;  4UWO B;  2BFZ B;  2QDS A;  4D1U A;  5IQK A;  4TYT A;  5FQC A;  2BTN A;  4F6H A;  2NZF A;  2R2D A;  1BVT A;  2QED A;  4YSL A;  2Q42 A;  3Q6V A;  5EV6 A;  4DIK A;  2BG8 B;  5HIS A;  1A8T A;  2UYX A;  3X2Z A;  5HIP A;  4EXY A;  4P62 A;  1SML A;  4C1C A;  1DDK A;  4AX1 B;  5LCA A;  3SFP A;  4EFZ A;  4FR7 A;  2I7T A;  4NQ5 A;  4YSB A;  1KR3 A;  2P1E A;  5AIJ A;  2OHH A;  5HH5 A;  4B87 A;  4ZO2 A;  1DXK A;  2QIN A;  2HB9 A;  5LS3 A;  2ZWR A;  5ACT A;  2WYM A;  3QH8 A;  4DIL A;  1VGN A;  1WUO A;  4PVO A;  3S0Z A;  4EY2 A;  3IDZ A;  1KO2 A;  4Z6X A;  2YNW A;  4UAM A;  1VME A;  4UWR B;  5LE1 A;  4U4L A;  3KNS A;  4NQ2 A;  4XUK A;  2GFK A;  5EV8 A;  2WYM C;  3A4Y A;  3IOG A;  5HIQ A;  4AWZ A;  3F9O A;  5LCF A;  2FK6 A;  4BP0 A;  4Z60 A;  4WD6 A;  4PVT A;  4D1V A;  4D1T A;  5EW0 A;  2FHX A;  5EVB A;  2YZ3 A;  3VQZ A;  2P4Z A;  5LCH A;  4UWP B;  5ACR A;  1YCF A;  3AF5 A;  3I13 A;  2BR6 A;  4Z67 A;  3ZQ4 A;  3DH8 A;  3DHB A;  5A87 A;  2Y8B A;  5EWA A;  4UA4 A;  2YCB A;  3ESH A;  5ACX A;  2BFK A;  1XM8 A;  2FU9 A;  2CBN A;  1X8G A;  2H6A A;  3IEM A;  5LMC A;  2ZO4 A;  4FSB A;  2NZE A;  5AYA A;  5AHR A;  1JJT A;  5B3R A;  2GCU A;  4GYU A;  2AIO A;  3ADR A;  2GKL A;  4TZB A;  2I7V A;  3LVZ A;  1E5D A;  4C1G A;  3I0V A;  3SBL A;  2Q0J A;  5AXR A;  5FQA A;  5A5Z A;  5KIK A;  2FU7 A;  2FHX B;  3PY6 A;  3X30 A;  3IE2 A;  2XF4 A;  3DHC A;  2P97 A;  4D1W A;  2YHE A;  4GCW A;  1WW1 A;  3X2Y A;  4J5H A;  4Z5Y A;  4F6Z A;  4C1D A;  3IE0 A;  4EYB A;  1ZKP A;  3ZNB A;  4D02 A;  3RKK A;  4KEP A;  4J5F A;  4EYL A;  3KNR A;  5AEB A;  2BG7 A;  1JJE A;  5K4N A;  3PY5 A;  4H0D A;  2CFZ A;  3H3E A;  3G1P A;  5HH4 A;  5AXO A;  4UBQ A;  3IOF A;  5ACS A;  3T9M A;  5ACQ A;  2YNT A;  4PDX A;  3IEK A;  1JT1 A;  3BV6 A;  5A0V A;  5K4K A;  1Y44 A;  5FQB A;  3BK2 A;  5ACV A;  2Q9U A;  3DHA A;  4HL1 A;  4RBS A;  4BZ3 A;  3KL7 A;  3RPC A;  3T3N A;  2BMI A;  2BG2 A;  2Q0I A;  2YNV A;  1MQO A;  4RAW A;  2FU6 A;  1KO3 A;  5HIO A;  4AD9 A;  5K0W A;  1HLK A;  3JXP A;  1XTO A;  4YSK A;  4GYQ A;  4TZE A;  1M2X A;  1YCG A;  4CHL A;  4V0H A;  5KIL A;  1BMC A;  4AX0 B;  5LM6 A;  3SW3 A;  2CFU A;  1X8I A;  2FM6 A;  2ZNB A;  5B15 A;  4TZF A;  2I7X A;  4ZNB A;  2YNT B;  3PG4 A;  2P18 A;  2QJS A;  2Y8A A;  4HL2 A;  2BC2 A;  2BGA A;  4XWW A;  4NQ6 A;  4Z7R A;  4ZO3 A;  3T3O A;  1WUP A;  3MD7 A;  2CG2 A;  3AJ3 A;  1WRA A;  5AHO A;  2GFJ A;  2CG3 A;  3SRX A;  4C1F A;  5A0T A;  2YNV B;  5A23 A;  4C1E A;  3FCZ A;  4RM5 A;  2BG6 A;  5EHT A;  4EXS A;  2Y87 A;  4EYF A;  1L9Y A;  1VJN A;  5EH9 A;  2QDT A;  4HKY A;  4AWY B;  3TP9 A;  2FU8 A;  4AXH A;  2DKF A;  1YCH A;  3I14 A;  3AF6 A;  4C09 A;  1DD6 A;  2YNU A;  5ACW A;  4UWS B;  5LLD A;  3BK1 A;  2GMN A;  2NYP A;  4KEQ A;  2BFL A;  2M5D A;  2AZ4 A;  4RL0 A;  3SD9 A;  2VW8 A;  3ZR9 A;  5AJL A;  2M5C A;  4C1H A;  2OHI A;  2A7M A;  5HH6 A;  1ZNB A;  4NQ4 A;  3IE1 A;  3I11 A;  4LE6 A;  4O98 A; 
#chains in the Genus database with same CATH homology
 2XR1 A;  3R2U A;  4Z5Z A;  1X8H A;  4RAM A;  1QH5 A;  3WXC A;  3RKJ A;  1P9E A;  2BFZ A;  2WYL A;  2DOO A;  3SPU A;  3ZWF A;  2NXA A;  3I15 A;  3X2X A;  4XWT A;  2BG8 A;  3IEL A;  3L6N A;  2WRS A;  5K4M A;  5ACP A;  5ACU A;  1BC2 A;  1QH3 A;  4ZEJ A;  4TYF A;  3P2U A;  5EVD A;  2BIB A;  1K07 A;  2E7Y A;  5EVK A;  4TZ9 A;  4JO0 A;  4RL2 A;  5LSC A;  4FEK A;  3BC2 A;  3FAI A;  3VPE A;  1ZTC A;  5DPX A;  1A7T A;  5B1U A;  2ZZI A;  2OHJ A;  2WHG A;  4UWO B;  2BFZ B;  2QDS A;  4D1U A;  5IQK A;  4TYT A;  5FQC A;  2BTN A;  4F6H A;  2NZF A;  2R2D A;  1BVT A;  2QED A;  4YSL A;  2Q42 A;  3Q6V A;  5EV6 A;  4DIK A;  2BG8 B;  5HIS A;  1A8T A;  2UYX A;  3X2Z A;  5HIP A;  4EXY A;  4P62 A;  1SML A;  4C1C A;  1DDK A;  4AX1 B;  5LCA A;  3SFP A;  4EFZ A;  4FR7 A;  2I7T A;  4NQ5 A;  4YSB A;  1KR3 A;  2P1E A;  2OHH A;  5HH5 A;  4B87 A;  4ZO2 A;  1DXK A;  2QIN A;  2HB9 A;  5LS3 A;  2ZWR A;  5ACT A;  2WYM A;  3QH8 A;  4DIL A;  1VGN A;  1WUO A;  4PVO A;  3S0Z A;  4EY2 A;  3IDZ A;  1KO2 A;  4Z6X A;  2YNW A;  4UAM A;  1VME A;  4UWR B;  5LE1 A;  4U4L A;  3KNS A;  4NQ2 A;  4XUK A;  2GFK A;  5EV8 A;  2WYM C;  3A4Y A;  3IOG A;  5HIQ A;  4AWZ A;  3F9O A;  5LCF A;  2FK6 A;  4BP0 A;  4Z60 A;  4WD6 A;  4PVT A;  4D1V A;  4D1T A;  5EW0 A;  2FHX A;  5EVB A;  2YZ3 A;  3VQZ A;  2P4Z A;  5LCH A;  4UWP B;  5ACR A;  1YCF A;  3AF5 A;  3I13 A;  2BR6 A;  4Z67 A;  3ZQ4 A;  3DH8 A;  3DHB A;  5A87 A;  2Y8B A;  5EWA A;  4UA4 A;  2YCB A;  3ESH A;  5ACX A;  2BFK A;  1XM8 A;  2FU9 A;  2CBN A;  1X8G A;  2H6A A;  3IEM A;  5LMC A;  2ZO4 A;  4FSB A;  2NZE A;  5AYA A;  5AHR A;  1JJT A;  5B3R A;  2GCU A;  4GYU A;  2AIO A;  3ADR A;  2GKL A;  4TZB A;  2I7V A;  3LVZ A;  1E5D A;  4C1G A;  3I0V A;  3SBL A;  2Q0J A;  5AXR A;  5FQA A;  5A5Z A;  5KIK A;  2FU7 A;  2FHX B;  3PY6 A;  3X30 A;  3IE2 A;  2XF4 A;  3DHC A;  2P97 A;  4D1W A;  4GCW A;  1WW1 A;  3X2Y A;  4J5H A;  4Z5Y A;  4F6Z A;  4C1D A;  3IE0 A;  4EYB A;  1ZKP A;  3ZNB A;  4D02 A;  3RKK A;  4KEP A;  4J5F A;  4EYL A;  3KNR A;  5AEB A;  2BG7 A;  1JJE A;  5K4N A;  3PY5 A;  4H0D A;  3H3E A;  3G1P A;  5HH4 A;  5AXO A;  4UBQ A;  3IOF A;  5ACS A;  3T9M A;  5ACQ A;  2YNT A;  3IEK A;  1JT1 A;  3BV6 A;  5A0V A;  5K4K A;  1Y44 A;  5FQB A;  3BK2 A;  5ACV A;  2Q9U A;  3DHA A;  4HL1 A;  4RBS A;  4BZ3 A;  3KL7 A;  3RPC A;  3T3N A;  2BMI A;  2BG2 A;  2Q0I A;  2YNV A;  1MQO A;  4RAW A;  2FU6 A;  1KO3 A;  5HIO A;  4AD9 A;  5K0W A;  1HLK A;  3JXP A;  1XTO A;  4YSK A;  4GYQ A;  4TZE A;  1M2X A;  1YCG A;  4CHL A;  4V0H A;  5KIL A;  1BMC A;  4AX0 B;  5LM6 A;  3SW3 A;  1X8I A;  2FM6 A;  2ZNB A;  5B15 A;  4TZF A;  2I7X A;  4ZNB A;  2YNT B;  3PG4 A;  2P18 A;  2QJS A;  2Y8A A;  4HL2 A;  2BC2 A;  2BGA A;  4XWW A;  4NQ6 A;  4Z7R A;  4ZO3 A;  3T3O A;  1WUP A;  3MD7 A;  3AJ3 A;  1WRA A;  5AHO A;  2GFJ A;  3SRX A;  4C1F A;  5A0T A;  2YNV B;  4C1E A;  3FCZ A;  4RM5 A;  2BG6 A;  5EHT A;  4EXS A;  2Y87 A;  4EYF A;  1L9Y A;  1VJN A;  5EH9 A;  2QDT A;  4HKY A;  4AWY B;  3TP9 A;  2FU8 A;  2DKF A;  1YCH A;  3I14 A;  3AF6 A;  4C09 A;  1DD6 A;  2YNU A;  5ACW A;  4UWS B;  5LLD A;  3BK1 A;  2GMN A;  2NYP A;  4KEQ A;  2BFL A;  2M5D A;  2AZ4 A;  4RL0 A;  3SD9 A;  2VW8 A;  3ZR9 A;  2M5C A;  4C1H A;  2OHI A;  2A7M A;  5HH6 A;  1ZNB A;  4NQ4 A;  3IE1 A;  3I11 A;  4LE6 A;  4O98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...