1DDKA

Crystal structure of imp-1 metallo beta-lactamase from pseudomonas aeruginosa
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
220
structure length
220
Chain Sequence
b'ESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMP-1 METALLO BETA-LACTAMASE
publication title Crystal structure of the IMP-1 metallo beta-lactamase from Pseudomonas aeruginosa and its complex with a mercaptocarboxylate inhibitor: binding determinants of a potent, broad-spectrum inhibitor.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 67
structure length 220
sequence length 220
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1999-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1ddkA00
4EXYA 4BZ3A 4PVOA 3X2XA 3T9MA 1X8GA 1KR3A 1JJTA 5ACTA 4NQ6A 5DPXA 5HIOA 4RL2A 3VPEA 3WXCA 5LCFA 1QH3A 5EHTA 2AIOA 3ZQ4A 2BFZA 3RKKA 4NQ5A 5K0WA 2GFJA 1JJEA 4RAMA 5HIQA 3DH8A 2GFKA 4YSKA 4XWTA 2ZWRA 4WD6A 4ZEJA 3SPUA 4J5HA 5K4KA 3BK2A 2DOOA 4PVTA 5EVBA 4RL0A 5A0VA 2P97A 4HKYA 4UWPB 5HISA 4D1TA 4KEPA 4AX0B 3IELA 2NZEA 4C09A 1HLKA 2R2DA 4Z6XA 4D1WA 4TZBA 2E7YA 3IOFA 5A5ZA 4TYFA 3TP9A 2GCUA 4DIKA 2BFZB 5LMCA 3IDZA 4FR7A 2WYMC 4C1EA 2FHXA 3AJ3A 5K4NA 5LM6A 2UYXA 1YCHA 2FU7A 3X2YA 4UWOB 2BG8A 3IOGA 2YNTA 5AXRA 3X2ZA 1VJNA 4AWYB 1K07A 4TYTA 1WUOA 3PY5A 2QDSA 2I7TA 3PY6A 1M2XA 4UA4A 5KIKA 3P2UA 3VQZA 4FSBA 5KILA 4RBSA 4CHLA 2Q9UA 2BFKA 2FHXB 2NXAA 4EYLA 3I15A 4B87A 1YCFA 5FQBA 4UWRB 4RAWA 2M5CA 2A7MA 3IE0A 3KNSA 4UBQA 3S0ZA 3BK1A 2XF4A 3KNRA 3A4YA 4TZFA 4ZO2A 4C1CA 4EYFA 2YNTB 3RKJA 1DD6A 5B15A 1BMCA 1E5DA 4LE6A 4C1DA 2QEDA 2QDTA 2BFLA 3FCZA 1XTOA 4AX1B 4UWSB 5AHOA 3ZWFA 2FM6A 2I7XA 3BV6A 2Y87A 3IEKA 2FU8A 1QH5A 3T3OA 3I0VA 3RPCA 5EV8A 4KEQA 2GKLA 4AD9A 1A7TA 2I7VA 2BGAA 4EY2A 2DKFA 2BG6A 4YSLA 1P9EA 4GCWA 5LE1A 5A0TA 4Z7RA 3PG4A 4XUKA 4V0HA 5HH5A 2OHJA 3KL7A 1YCGA 2GMNA 4JO0A 2BG2A 1X8HA 3SFPA 4BP0A 2BR6A 2FU9A 1VMEA 3SRXA 1X8IA 5HIPA 2Q0IA 2AZ4A 3R2UA 3IE2A 1BC2A 5EWAA 4F6HA 2ZO4A 2OHIA 3SD9A 2Y8AA 2BIBA 4H0DA 4GYUA 3L6NA 5ACXA 3F9OA 5AEBA 5B1UA 2ZNBA 3AF6A 4U4LA 5LCAA 3DHBA 2WHGA 4O98A 2BC2A 4TZ9A 5LCHA 2P4ZA 3I11A 2YNVA 2HB9A 2BMIA 2NYPA 2QJSA 3ADRA 2Q0JA 1A8TA 3FAIA 1VGNA 5HH4A 4C1FA 2BG8B 2CBNA 5B3RA 1ZNBA 4EYBA 2WYMA 2M5DA 5AHRA 4Z5ZA 4D02A 2XR1A 5A87A 5IQKA 4F6ZA 2Y8BA 5ACUA 3AF5A 3ZNBA 4C1GA 5K4MA 1WW1A 2P1EA 2YCBA 2OHHA 1BVTA 3Q6VA 4D1VA 4C1HA 5EVDA 1Y44A 3SW3A 1WRAA 4Z67A 2YNVB 1XM8A 4TZEA 3DHAA 4HL2A 2WYLA 2VW8A 3SBLA 3JXPA 1WUPA 4J5FA 1L9YA 5AYAA 5LLDA 4AWZA 2H6AA 1DDKA 1SMLA 5ACWA 1MQOA 4Z60A 5EH9A 3ESHA 2Q42A 3DHCA 3MD7A 4XWWA 5AXOA 5ACQA 3X30A 4UAMA 2NZFA 4P62A 2WRSA 3IEMA 5ACPA 1KO2A 4EFZA 2BTNA 4D1UA 3T3NA 4Z5YA 5LS3A 1DXKA 1ZKPA 4DILA 5HH6A 3IE1A 2YZ3A 4HL1A 1ZTCA 4EXSA 2P18A 5EVKA 5ACSA 1JT1A 3I13A 4ZNBA 5ACRA 2QINA 3G1PA 3I14A 4ZO3A 4NQ2A 3H3EA 2ZZIA 2YNUA 2FK6A 3BC2A 4RM5A 4YSBA 5ACVA 3ZR9A 2YNWA 4FEKA 5EV6A 2FU6A 5EW0A 4NQ4A 1KO3A 2BG7A 5FQAA 3QH8A 4GYQA 3LVZA 5LSCA 5FQCA
chains in the Genus database with same CATH superfamily
4EXYA 4BZ3A 4PVOA 3X2XA 3T9MA 1X8GA 1KR3A 1JJTA 5ACTA 4NQ6A 5DPXA 5HIOA 4RL2A 3VPEA 3WXCA 5LCFA 1QH3A 5EHTA 2AIOA 3ZQ4A 2BFZA 3RKKA 4NQ5A 5K0WA 2GFJA 1JJEA 4RAMA 5HIQA 3DH8A 2GFKA 4YSKA 4XWTA 2ZWRA 4WD6A 5A23A 4ZEJA 3SPUA 4J5HA 5K4KA 3BK2A 2DOOA 4PVTA 5EVBA 4RL0A 5A0VA 2P97A 4HKYA 4UWPB 5HISA 4AV7A 4D1TA 4KEPA 4AX0B 3IELA 2NZEA 4C09A 1HLKA 2R2DA 4Z6XA 4D1WA 4TZBA 2E7YA 3IOFA 5A5ZA 4TYFA 3TP9A 2GCUA 4DIKA 2BFZB 5LMCA 3IDZA 4FR7A 5AJLA 2WYMC 4C1EA 2FHXA 3AJ3A 5K4NA 5LM6A 2UYXA 1YCHA 2FU7A 3X2YA 4UWOB 2BG8A 3IOGA 2YNTA 5AXRA 3X2ZA 1VJNA 4AWYB 1K07A 4TYTA 1WUOA 2CG2A 3PY5A 2QDSA 2I7TA 3PY6A 1M2XA 4UA4A 5KIKA 3P2UA 3VQZA 4FSBA 5KILA 4RBSA 4CHLA 2Q9UA 2BFKA 2FHXB 2NXAA 4EYLA 3I15A 4B87A 1YCFA 5FQBA 4UWRB 4RAWA 2M5CA 2A7MA 3IE0A 2CG3A 3KNSA 4UBQA 3S0ZA 3BK1A 5AIJA 2XF4A 3KNRA 3A4YA 4TZFA 4ZO2A 4C1CA 4EYFA 2YNTB 3RKJA 1DD6A 5B15A 1BMCA 1E5DA 4LE6A 4C1DA 2QEDA 2QDTA 2BFLA 3FCZA 1XTOA 4AX1B 4UWSB 5AHOA 3ZWFA 2FM6A 2I7XA 3BV6A 2Y87A 3IEKA 2FU8A 1QH5A 3T3OA 3I0VA 3RPCA 5EV8A 4KEQA 2GKLA 4AD9A 1A7TA 2I7VA 2BGAA 4EY2A 2DKFA 2BG6A 4YSLA 1P9EA 4GCWA 5LE1A 5A0TA 4Z7RA 2CFUA 3PG4A 4XUKA 4V0HA 5HH5A 2OHJA 3KL7A 1YCGA 2GMNA 4JO0A 2BG2A 1X8HA 3SFPA 4BP0A 2BR6A 2FU9A 1VMEA 3SRXA 1X8IA 5HIPA 2Q0IA 2AZ4A 3R2UA 3IE2A 1BC2A 5EWAA 4F6HA 2ZO4A 2OHIA 3SD9A 2Y8AA 2BIBA 4H0DA 4GYUA 3L6NA 5ACXA 3F9OA 5AEBA 5B1UA 2ZNBA 3AF6A 4U4LA 5LCAA 3DHBA 2WHGA 4O98A 2BC2A 4TZ9A 5LCHA 2P4ZA 3I11A 2YNVA 2HB9A 2BMIA 2NYPA 2QJSA 3ADRA 2Q0JA 1A8TA 3FAIA 1VGNA 5HH4A 4C1FA 2BG8B 2CBNA 5B3RA 1ZNBA 4EYBA 2WYMA 2M5DA 5AHRA 4Z5ZA 4D02A 2XR1A 5A87A 5IQKA 4F6ZA 2Y8BA 5ACUA 3AF5A 4PDXA 3ZNBA 4C1GA 5K4MA 1WW1A 2P1EA 2YCBA 2OHHA 1BVTA 3Q6VA 4D1VA 4C1HA 2CFZA 5EVDA 1Y44A 3SW3A 1WRAA 4Z67A 2YNVB 1XM8A 4TZEA 3DHAA 4HL2A 2WYLA 2VW8A 3SBLA 3JXPA 1WUPA 4J5FA 1L9YA 5AYAA 5LLDA 4AWZA 2H6AA 1DDKA 1SMLA 5ACWA 1MQOA 4Z60A 5EH9A 3ESHA 2Q42A 3DHCA 3MD7A 4XWWA 5AXOA 5ACQA 3X30A 4UAMA 2NZFA 4P62A 2WRSA 3IEMA 5ACPA 1KO2A 4EFZA 2BTNA 4D1UA 3T3NA 4Z5YA 5LS3A 1DXKA 1ZKPA 4DILA 2YHEA 5HH6A 3IE1A 2YZ3A 4HL1A 1ZTCA 4EXSA 2P18A 5EVKA 4NURA 5ACSA 1JT1A 3I13A 4AXHA 4ZNBA 5ACRA 2QINA 3G1PA 3I14A 4ZO3A 4NQ2A 3H3EA 2ZZIA 2YNUA 2FK6A 3BC2A 4RM5A 4YSBA 5ACVA 3ZR9A 2YNWA 4FEKA 5EV6A 2FU6A 5EW0A 4NQ4A 1KO3A 2BG7A 5FQAA 3QH8A 4GYQA 3LVZA 5LSCA 5FQCA
chains in the Genus database with same CATH topology
4EXYA 4BZ3A 4PVOA 3X2XA 3T9MA 1X8GA 1KR3A 1JJTA 5ACTA 4NQ6A 5DPXA 5HIOA 4RL2A 3VPEA 3WXCA 5LCFA 1QH3A 5EHTA 2AIOA 3ZQ4A 2BFZA 3RKKA 4NQ5A 5K0WA 2GFJA 1JJEA 4RAMA 5HIQA 3DH8A 2GFKA 4YSKA 4XWTA 2ZWRA 4WD6A 4ZEJA 3SPUA 4J5HA 5K4KA 3BK2A 2DOOA 4PVTA 5EVBA 4RL0A 5A0VA 2P97A 4HKYA 4UWPB 5HISA 4D1TA 4KEPA 4AX0B 3IELA 2NZEA 4C09A 1HLKA 2R2DA 4Z6XA 4D1WA 4TZBA 2E7YA 3IOFA 5A5ZA 4TYFA 3TP9A 2GCUA 4DIKA 2BFZB 5LMCA 3IDZA 4FR7A 2WYMC 4C1EA 2FHXA 3AJ3A 5K4NA 5LM6A 2UYXA 1YCHA 2FU7A 3X2YA 4UWOB 2BG8A 3IOGA 2YNTA 5AXRA 3X2ZA 1VJNA 4AWYB 1K07A 4TYTA 1WUOA 3PY5A 2QDSA 2I7TA 3PY6A 1M2XA 4UA4A 5KIKA 3P2UA 3VQZA 4FSBA 5KILA 4RBSA 4CHLA 2Q9UA 2BFKA 2FHXB 2NXAA 4EYLA 3I15A 4B87A 1YCFA 5FQBA 4UWRB 4RAWA 2M5CA 2A7MA 3IE0A 3KNSA 4UBQA 3S0ZA 3BK1A 2XF4A 3KNRA 3A4YA 4TZFA 4ZO2A 4C1CA 4EYFA 2YNTB 3RKJA 1DD6A 5B15A 1BMCA 1E5DA 4LE6A 4C1DA 2QEDA 2QDTA 2BFLA 3FCZA 1XTOA 4AX1B 4UWSB 5AHOA 3ZWFA 2FM6A 2I7XA 3BV6A 2Y87A 3IEKA 2FU8A 1QH5A 3T3OA 3I0VA 3RPCA 5EV8A 4KEQA 2GKLA 4AD9A 1A7TA 2I7VA 2BGAA 4EY2A 2DKFA 2BG6A 4YSLA 1P9EA 4GCWA 5LE1A 5A0TA 4Z7RA 3PG4A 4XUKA 4V0HA 5HH5A 2OHJA 3KL7A 1YCGA 2GMNA 4JO0A 2BG2A 1X8HA 3SFPA 4BP0A 2BR6A 2FU9A 1VMEA 3SRXA 1X8IA 5HIPA 2Q0IA 2AZ4A 3R2UA 3IE2A 1BC2A 5EWAA 4F6HA 2ZO4A 2OHIA 3SD9A 2Y8AA 2BIBA 4H0DA 4GYUA 3L6NA 5ACXA 3F9OA 5AEBA 5B1UA 2ZNBA 3AF6A 4U4LA 5LCAA 3DHBA 2WHGA 4O98A 2BC2A 4TZ9A 5LCHA 2P4ZA 3I11A 2YNVA 2HB9A 2BMIA 2NYPA 2QJSA 3ADRA 2Q0JA 1A8TA 3FAIA 1VGNA 5HH4A 4C1FA 2BG8B 2CBNA 5B3RA 1ZNBA 4EYBA 2WYMA 2M5DA 5AHRA 4Z5ZA 4D02A 2XR1A 5A87A 5IQKA 4F6ZA 2Y8BA 5ACUA 3AF5A 3ZNBA 4C1GA 5K4MA 1WW1A 2P1EA 2YCBA 2OHHA 1BVTA 3Q6VA 4D1VA 4C1HA 5EVDA 1Y44A 3SW3A 1WRAA 4Z67A 2YNVB 1XM8A 4TZEA 3DHAA 4HL2A 2WYLA 2VW8A 3SBLA 3JXPA 1WUPA 4J5FA 1L9YA 5AYAA 5LLDA 4AWZA 2H6AA 1DDKA 1SMLA 5ACWA 1MQOA 4Z60A 5EH9A 3ESHA 2Q42A 3DHCA 3MD7A 4XWWA 5AXOA 5ACQA 3X30A 4UAMA 2NZFA 4P62A 2WRSA 3IEMA 5ACPA 1KO2A 4EFZA 2BTNA 4D1UA 3T3NA 4Z5YA 5LS3A 1DXKA 1ZKPA 4DILA 5HH6A 3IE1A 2YZ3A 4HL1A 1ZTCA 4EXSA 2P18A 5EVKA 5ACSA 1JT1A 3I13A 4ZNBA 5ACRA 2QINA 3G1PA 3I14A 4ZO3A 4NQ2A 3H3EA 2ZZIA 2YNUA 2FK6A 3BC2A 4RM5A 4YSBA 5ACVA 3ZR9A 2YNWA 4FEKA 5EV6A 2FU6A 5EW0A 4NQ4A 1KO3A 2BG7A 5FQAA 3QH8A 4GYQA 3LVZA 5LSCA 5FQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EXY A;  4BZ3 A;  4PVO A;  3X2X A;  3T9M A;  1X8G A;  1KR3 A;  1JJT A;  5ACT A;  4NQ6 A;  5DPX A;  5HIO A;  4RL2 A;  3VPE A;  3WXC A;  5LCF A;  1QH3 A;  5EHT A;  2AIO A;  3ZQ4 A;  2BFZ A;  3RKK A;  4NQ5 A;  5K0W A;  2GFJ A;  1JJE A;  4RAM A;  5HIQ A;  3DH8 A;  2GFK A;  4YSK A;  4XWT A;  2ZWR A;  4WD6 A;  4ZEJ A;  3SPU A;  4J5H A;  5K4K A;  3BK2 A;  2DOO A;  4PVT A;  5EVB A;  4RL0 A;  5A0V A;  2P97 A;  4HKY A;  4UWP B;  5HIS A;  4D1T A;  4KEP A;  4AX0 B;  3IEL A;  2NZE A;  4C09 A;  1HLK A;  2R2D A;  4Z6X A;  4D1W A;  4TZB A;  2E7Y A;  3IOF A;  5A5Z A;  4TYF A;  3TP9 A;  2GCU A;  4DIK A;  2BFZ B;  5LMC A;  3IDZ A;  4FR7 A;  2WYM C;  4C1E A;  2FHX A;  3AJ3 A;  5K4N A;  5LM6 A;  2UYX A;  1YCH A;  2FU7 A;  3X2Y A;  4UWO B;  2BG8 A;  3IOG A;  2YNT A;  5AXR A;  3X2Z A;  1VJN A;  4AWY B;  1K07 A;  4TYT A;  1WUO A;  3PY5 A;  2QDS A;  2I7T A;  3PY6 A;  1M2X A;  4UA4 A;  5KIK A;  3P2U A;  3VQZ A;  4FSB A;  5KIL A;  4RBS A;  4CHL A;  2Q9U A;  2BFK A;  2FHX B;  2NXA A;  4EYL A;  3I15 A;  4B87 A;  1YCF A;  5FQB A;  4UWR B;  4RAW A;  2M5C A;  2A7M A;  3IE0 A;  3KNS A;  4UBQ A;  3S0Z A;  3BK1 A;  2XF4 A;  3KNR A;  3A4Y A;  4TZF A;  4ZO2 A;  4C1C A;  4EYF A;  2YNT B;  3RKJ A;  1DD6 A;  5B15 A;  1BMC A;  1E5D A;  4LE6 A;  4C1D A;  2QED A;  2QDT A;  2BFL A;  3FCZ A;  1XTO A;  4AX1 B;  4UWS B;  5AHO A;  3ZWF A;  2FM6 A;  2I7X A;  3BV6 A;  2Y87 A;  3IEK A;  2FU8 A;  1QH5 A;  3T3O A;  3I0V A;  3RPC A;  5EV8 A;  4KEQ A;  2GKL A;  4AD9 A;  1A7T A;  2I7V A;  2BGA A;  4EY2 A;  2DKF A;  2BG6 A;  4YSL A;  1P9E A;  4GCW A;  5LE1 A;  5A0T A;  4Z7R A;  3PG4 A;  4XUK A;  4V0H A;  5HH5 A;  2OHJ A;  3KL7 A;  1YCG A;  2GMN A;  4JO0 A;  2BG2 A;  1X8H A;  3SFP A;  4BP0 A;  2BR6 A;  2FU9 A;  1VME A;  3SRX A;  1X8I A;  5HIP A;  2Q0I A;  2AZ4 A;  3R2U A;  3IE2 A;  1BC2 A;  5EWA A;  4F6H A;  2ZO4 A;  2OHI A;  3SD9 A;  2Y8A A;  2BIB A;  4H0D A;  4GYU A;  3L6N A;  5ACX A;  3F9O A;  5AEB A;  5B1U A;  2ZNB A;  3AF6 A;  4U4L A;  5LCA A;  3DHB A;  2WHG A;  4O98 A;  2BC2 A;  4TZ9 A;  5LCH A;  2P4Z A;  3I11 A;  2YNV A;  2HB9 A;  2BMI A;  2NYP A;  2QJS A;  3ADR A;  2Q0J A;  1A8T A;  3FAI A;  1VGN A;  5HH4 A;  4C1F A;  2BG8 B;  2CBN A;  5B3R A;  1ZNB A;  4EYB A;  2WYM A;  2M5D A;  5AHR A;  4Z5Z A;  4D02 A;  2XR1 A;  5A87 A;  5IQK A;  4F6Z A;  2Y8B A;  5ACU A;  3AF5 A;  3ZNB A;  4C1G A;  5K4M A;  1WW1 A;  2P1E A;  2YCB A;  2OHH A;  1BVT A;  3Q6V A;  4D1V A;  4C1H A;  5EVD A;  1Y44 A;  3SW3 A;  1WRA A;  4Z67 A;  2YNV B;  1XM8 A;  4TZE A;  3DHA A;  4HL2 A;  2WYL A;  2VW8 A;  3SBL A;  3JXP A;  1WUP A;  4J5F A;  1L9Y A;  5AYA A;  5LLD A;  4AWZ A;  2H6A A;  1DDK A;  1SML A;  5ACW A;  1MQO A;  4Z60 A;  5EH9 A;  3ESH A;  2Q42 A;  3DHC A;  3MD7 A;  4XWW A;  5AXO A;  5ACQ A;  3X30 A;  4UAM A;  2NZF A;  4P62 A;  2WRS A;  3IEM A;  5ACP A;  1KO2 A;  4EFZ A;  2BTN A;  4D1U A;  3T3N A;  4Z5Y A;  5LS3 A;  1DXK A;  1ZKP A;  4DIL A;  5HH6 A;  3IE1 A;  2YZ3 A;  4HL1 A;  1ZTC A;  4EXS A;  2P18 A;  5EVK A;  5ACS A;  1JT1 A;  3I13 A;  4ZNB A;  5ACR A;  2QIN A;  3G1P A;  3I14 A;  4ZO3 A;  4NQ2 A;  3H3E A;  2ZZI A;  2YNU A;  2FK6 A;  3BC2 A;  4RM5 A;  4YSB A;  5ACV A;  3ZR9 A;  2YNW A;  4FEK A;  5EV6 A;  2FU6 A;  5EW0 A;  4NQ4 A;  1KO3 A;  2BG7 A;  5FQA A;  3QH8 A;  4GYQ A;  3LVZ A;  5LSC A;  5FQC A; 
#chains in the Genus database with same CATH topology
 4EXY A;  4BZ3 A;  4PVO A;  3X2X A;  3T9M A;  1X8G A;  1KR3 A;  1JJT A;  5ACT A;  4NQ6 A;  5DPX A;  5HIO A;  4RL2 A;  3VPE A;  3WXC A;  5LCF A;  1QH3 A;  5EHT A;  2AIO A;  3ZQ4 A;  2BFZ A;  3RKK A;  4NQ5 A;  5K0W A;  2GFJ A;  1JJE A;  4RAM A;  5HIQ A;  3DH8 A;  2GFK A;  4YSK A;  4XWT A;  2ZWR A;  4WD6 A;  5A23 A;  4ZEJ A;  3SPU A;  4J5H A;  5K4K A;  3BK2 A;  2DOO A;  4PVT A;  5EVB A;  4RL0 A;  5A0V A;  2P97 A;  4HKY A;  4UWP B;  5HIS A;  4AV7 A;  4D1T A;  4KEP A;  4AX0 B;  3IEL A;  2NZE A;  4C09 A;  1HLK A;  2R2D A;  4Z6X A;  4D1W A;  4TZB A;  2E7Y A;  3IOF A;  5A5Z A;  4TYF A;  3TP9 A;  2GCU A;  4DIK A;  2BFZ B;  5LMC A;  3IDZ A;  4FR7 A;  5AJL A;  2WYM C;  4C1E A;  2FHX A;  3AJ3 A;  5K4N A;  5LM6 A;  2UYX A;  1YCH A;  2FU7 A;  3X2Y A;  4UWO B;  2BG8 A;  3IOG A;  2YNT A;  5AXR A;  3X2Z A;  1VJN A;  4AWY B;  1K07 A;  4TYT A;  1WUO A;  2CG2 A;  3PY5 A;  2QDS A;  2I7T A;  3PY6 A;  1M2X A;  4UA4 A;  5KIK A;  3P2U A;  3VQZ A;  4FSB A;  5KIL A;  4RBS A;  4CHL A;  2Q9U A;  2BFK A;  2FHX B;  2NXA A;  4EYL A;  3I15 A;  4B87 A;  1YCF A;  5FQB A;  4UWR B;  4RAW A;  2M5C A;  2A7M A;  3IE0 A;  2CG3 A;  3KNS A;  4UBQ A;  3S0Z A;  3BK1 A;  5AIJ A;  2XF4 A;  3KNR A;  3A4Y A;  4TZF A;  4ZO2 A;  4C1C A;  4EYF A;  2YNT B;  3RKJ A;  1DD6 A;  5B15 A;  1BMC A;  1E5D A;  4LE6 A;  4C1D A;  2QED A;  2QDT A;  2BFL A;  3FCZ A;  1XTO A;  4AX1 B;  4UWS B;  5AHO A;  3ZWF A;  2FM6 A;  2I7X A;  3BV6 A;  2Y87 A;  3IEK A;  2FU8 A;  1QH5 A;  3T3O A;  3I0V A;  3RPC A;  5EV8 A;  4KEQ A;  2GKL A;  4AD9 A;  1A7T A;  2I7V A;  2BGA A;  4EY2 A;  2DKF A;  2BG6 A;  4YSL A;  1P9E A;  4GCW A;  5LE1 A;  5A0T A;  4Z7R A;  2CFU A;  3PG4 A;  4XUK A;  4V0H A;  5HH5 A;  2OHJ A;  3KL7 A;  1YCG A;  2GMN A;  4JO0 A;  2BG2 A;  1X8H A;  3SFP A;  4BP0 A;  2BR6 A;  2FU9 A;  1VME A;  3SRX A;  1X8I A;  5HIP A;  2Q0I A;  2AZ4 A;  3R2U A;  3IE2 A;  1BC2 A;  5EWA A;  4F6H A;  2ZO4 A;  2OHI A;  3SD9 A;  2Y8A A;  2BIB A;  4H0D A;  4GYU A;  3L6N A;  5ACX A;  3F9O A;  5AEB A;  5B1U A;  2ZNB A;  3AF6 A;  4U4L A;  5LCA A;  3DHB A;  2WHG A;  4O98 A;  2BC2 A;  4TZ9 A;  5LCH A;  2P4Z A;  3I11 A;  2YNV A;  2HB9 A;  2BMI A;  2NYP A;  2QJS A;  3ADR A;  2Q0J A;  1A8T A;  3FAI A;  1VGN A;  5HH4 A;  4C1F A;  2BG8 B;  2CBN A;  5B3R A;  1ZNB A;  4EYB A;  2WYM A;  2M5D A;  5AHR A;  4Z5Z A;  4D02 A;  2XR1 A;  5A87 A;  5IQK A;  4F6Z A;  2Y8B A;  5ACU A;  3AF5 A;  4PDX A;  3ZNB A;  4C1G A;  5K4M A;  1WW1 A;  2P1E A;  2YCB A;  2OHH A;  1BVT A;  3Q6V A;  4D1V A;  4C1H A;  2CFZ A;  5EVD A;  1Y44 A;  3SW3 A;  1WRA A;  4Z67 A;  2YNV B;  1XM8 A;  4TZE A;  3DHA A;  4HL2 A;  2WYL A;  2VW8 A;  3SBL A;  3JXP A;  1WUP A;  4J5F A;  1L9Y A;  5AYA A;  5LLD A;  4AWZ A;  2H6A A;  1DDK A;  1SML A;  5ACW A;  1MQO A;  4Z60 A;  5EH9 A;  3ESH A;  2Q42 A;  3DHC A;  3MD7 A;  4XWW A;  5AXO A;  5ACQ A;  3X30 A;  4UAM A;  2NZF A;  4P62 A;  2WRS A;  3IEM A;  5ACP A;  1KO2 A;  4EFZ A;  2BTN A;  4D1U A;  3T3N A;  4Z5Y A;  5LS3 A;  1DXK A;  1ZKP A;  4DIL A;  2YHE A;  5HH6 A;  3IE1 A;  2YZ3 A;  4HL1 A;  1ZTC A;  4EXS A;  2P18 A;  5EVK A;  4NUR A;  5ACS A;  1JT1 A;  3I13 A;  4AXH A;  4ZNB A;  5ACR A;  2QIN A;  3G1P A;  3I14 A;  4ZO3 A;  4NQ2 A;  3H3E A;  2ZZI A;  2YNU A;  2FK6 A;  3BC2 A;  4RM5 A;  4YSB A;  5ACV A;  3ZR9 A;  2YNW A;  4FEK A;  5EV6 A;  2FU6 A;  5EW0 A;  4NQ4 A;  1KO3 A;  2BG7 A;  5FQA A;  3QH8 A;  4GYQ A;  3LVZ A;  5LSC A;  5FQC A; 
#chains in the Genus database with same CATH homology
 4EXY A;  4BZ3 A;  4PVO A;  3X2X A;  3T9M A;  1X8G A;  1KR3 A;  1JJT A;  5ACT A;  4NQ6 A;  5DPX A;  5HIO A;  4RL2 A;  3VPE A;  3WXC A;  5LCF A;  1QH3 A;  5EHT A;  2AIO A;  3ZQ4 A;  2BFZ A;  3RKK A;  4NQ5 A;  5K0W A;  2GFJ A;  1JJE A;  4RAM A;  5HIQ A;  3DH8 A;  2GFK A;  4YSK A;  4XWT A;  2ZWR A;  4WD6 A;  4ZEJ A;  3SPU A;  4J5H A;  5K4K A;  3BK2 A;  2DOO A;  4PVT A;  5EVB A;  4RL0 A;  5A0V A;  2P97 A;  4HKY A;  4UWP B;  5HIS A;  4D1T A;  4KEP A;  4AX0 B;  3IEL A;  2NZE A;  4C09 A;  1HLK A;  2R2D A;  4Z6X A;  4D1W A;  4TZB A;  2E7Y A;  3IOF A;  5A5Z A;  4TYF A;  3TP9 A;  2GCU A;  4DIK A;  2BFZ B;  5LMC A;  3IDZ A;  4FR7 A;  2WYM C;  4C1E A;  2FHX A;  3AJ3 A;  5K4N A;  5LM6 A;  2UYX A;  1YCH A;  2FU7 A;  3X2Y A;  4UWO B;  2BG8 A;  3IOG A;  2YNT A;  5AXR A;  3X2Z A;  1VJN A;  4AWY B;  1K07 A;  4TYT A;  1WUO A;  3PY5 A;  2QDS A;  2I7T A;  3PY6 A;  1M2X A;  4UA4 A;  5KIK A;  3P2U A;  3VQZ A;  4FSB A;  5KIL A;  4RBS A;  4CHL A;  2Q9U A;  2BFK A;  2FHX B;  2NXA A;  4EYL A;  3I15 A;  4B87 A;  1YCF A;  5FQB A;  4UWR B;  4RAW A;  2M5C A;  2A7M A;  3IE0 A;  3KNS A;  4UBQ A;  3S0Z A;  3BK1 A;  2XF4 A;  3KNR A;  3A4Y A;  4TZF A;  4ZO2 A;  4C1C A;  4EYF A;  2YNT B;  3RKJ A;  1DD6 A;  5B15 A;  1BMC A;  1E5D A;  4LE6 A;  4C1D A;  2QED A;  2QDT A;  2BFL A;  3FCZ A;  1XTO A;  4AX1 B;  4UWS B;  5AHO A;  3ZWF A;  2FM6 A;  2I7X A;  3BV6 A;  2Y87 A;  3IEK A;  2FU8 A;  1QH5 A;  3T3O A;  3I0V A;  3RPC A;  5EV8 A;  4KEQ A;  2GKL A;  4AD9 A;  1A7T A;  2I7V A;  2BGA A;  4EY2 A;  2DKF A;  2BG6 A;  4YSL A;  1P9E A;  4GCW A;  5LE1 A;  5A0T A;  4Z7R A;  3PG4 A;  4XUK A;  4V0H A;  5HH5 A;  2OHJ A;  3KL7 A;  1YCG A;  2GMN A;  4JO0 A;  2BG2 A;  1X8H A;  3SFP A;  4BP0 A;  2BR6 A;  2FU9 A;  1VME A;  3SRX A;  1X8I A;  5HIP A;  2Q0I A;  2AZ4 A;  3R2U A;  3IE2 A;  1BC2 A;  5EWA A;  4F6H A;  2ZO4 A;  2OHI A;  3SD9 A;  2Y8A A;  2BIB A;  4H0D A;  4GYU A;  3L6N A;  5ACX A;  3F9O A;  5AEB A;  5B1U A;  2ZNB A;  3AF6 A;  4U4L A;  5LCA A;  3DHB A;  2WHG A;  4O98 A;  2BC2 A;  4TZ9 A;  5LCH A;  2P4Z A;  3I11 A;  2YNV A;  2HB9 A;  2BMI A;  2NYP A;  2QJS A;  3ADR A;  2Q0J A;  1A8T A;  3FAI A;  1VGN A;  5HH4 A;  4C1F A;  2BG8 B;  2CBN A;  5B3R A;  1ZNB A;  4EYB A;  2WYM A;  2M5D A;  5AHR A;  4Z5Z A;  4D02 A;  2XR1 A;  5A87 A;  5IQK A;  4F6Z A;  2Y8B A;  5ACU A;  3AF5 A;  3ZNB A;  4C1G A;  5K4M A;  1WW1 A;  2P1E A;  2YCB A;  2OHH A;  1BVT A;  3Q6V A;  4D1V A;  4C1H A;  5EVD A;  1Y44 A;  3SW3 A;  1WRA A;  4Z67 A;  2YNV B;  1XM8 A;  4TZE A;  3DHA A;  4HL2 A;  2WYL A;  2VW8 A;  3SBL A;  3JXP A;  1WUP A;  4J5F A;  1L9Y A;  5AYA A;  5LLD A;  4AWZ A;  2H6A A;  1DDK A;  1SML A;  5ACW A;  1MQO A;  4Z60 A;  5EH9 A;  3ESH A;  2Q42 A;  3DHC A;  3MD7 A;  4XWW A;  5AXO A;  5ACQ A;  3X30 A;  4UAM A;  2NZF A;  4P62 A;  2WRS A;  3IEM A;  5ACP A;  1KO2 A;  4EFZ A;  2BTN A;  4D1U A;  3T3N A;  4Z5Y A;  5LS3 A;  1DXK A;  1ZKP A;  4DIL A;  5HH6 A;  3IE1 A;  2YZ3 A;  4HL1 A;  1ZTC A;  4EXS A;  2P18 A;  5EVK A;  5ACS A;  1JT1 A;  3I13 A;  4ZNB A;  5ACR A;  2QIN A;  3G1P A;  3I14 A;  4ZO3 A;  4NQ2 A;  3H3E A;  2ZZI A;  2YNU A;  2FK6 A;  3BC2 A;  4RM5 A;  4YSB A;  5ACV A;  3ZR9 A;  2YNW A;  4FEK A;  5EV6 A;  2FU6 A;  5EW0 A;  4NQ4 A;  1KO3 A;  2BG7 A;  5FQA A;  3QH8 A;  4GYQ A;  3LVZ A;  5LSC A;  5FQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...