4ZO2A

Aidc, a dizinc quorum-quenching lactonase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
293
structure length
293
Chain Sequence
DLSGFKKIKLGELELFILTDGYIHEENLISFAPRGNVAELKTILKDNFRADHYIDMAINILLVKTKEKLILMDTGMGIFADERTGFLLKSLQKAGFSAHDITDIFLSHAHPDHIGGVVDKQNKLVFPNASIFISKIEHDFWINASIKDFNNSALKAHPERLNQIIPALQNILKAIQPKLKFYDLNKTLYSHFNFQLAPGHTPGLTVTTISSGNEKLMYVADLIHSDVILFPHPDWGFSGDTDLDIATASRKKFLKQLADTKARAFTSHLPWPGLGFTKVKAPGFEWIPESFMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acylhomoserine lactonase
publication title Structural and Biochemical Characterization of AidC, a Quorum-Quenching Lactonase with Atypical Selectivity.
pubmed doi rcsb
source organism Chryseobacterium sp. strb126
molecule tags Hydrolase
total genus 87
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4zo2A00
3ZR9A 3WXCA 3IELA 2QEDA 4FEKA 3IOFA 3DHBA 4Z67A 2FU9A 5AHOA 4YSLA 4UWPB 1Y44A 3I13A 4TZFA 4J5HA 5LCFA 2OHJA 4GCWA 1BC2A 4TZEA 2DKFA 2XF4A 4BZ3A 4UA4A 2E7YA 4PVTA 2GFKA 1XTOA 5AXOA 5HIOA 4EY2A 4TYFA 3IDZA 2BFZA 3T9MA 4C09A 4EXYA 4GYQA 4Z5YA 1XM8A 2P18A 4EYBA 5A87A 4C1HA 3IOGA 2Q0IA 4J5FA 5A0VA 4F6ZA 3X30A 3BK1A 2XR1A 2YZ3A 4P62A 2NYPA 2NXAA 4EYLA 1A7TA 5FQAA 3SBLA 2WYMA 2BIBA 3BK2A 3MD7A 2Y8BA 5FQCA 3VPEA 1WRAA 2FK6A 4AWYB 4C1FA 4TYTA 5ACVA 5K4MA 5AYAA 4HL2A 4EFZA 2ZNBA 5LCHA 1ZKPA 2Y87A 2FM6A 3AJ3A 2Y8AA 4RL0A 5LSCA 3KL7A 4KEQA 5K4KA 3PG4A 1M2XA 1KO2A 4Z5ZA 2DOOA 2P4ZA 4NQ6A 4RAMA 3IE1A 4D1VA 4UWRB 3RKKA 5AXRA 3I0VA 1E5DA 4NQ5A 3SFPA 1YCHA 2BC2A 1X8GA 3PY6A 2FU6A 2FU7A 3IEKA 5ACXA 3H3EA 4UWOB 5EH9A 4ZO2A 4AX0B 1VJNA 2I7XA 2QDSA 1ZTCA 5EVKA 2BGAA 5LE1A 1BMCA 3BV6A 3R2UA 2BG2A 5B3RA 2BFZB 1WUPA 4JO0A 2OHHA 2BTNA 4TZBA 3ZWFA 5HIQA 3IE0A 2ZO4A 4D1TA 2WYMC 2FU8A 1BVTA 2P97A 3KNSA 3TP9A 2YNVA 5EV6A 3PY5A 2WYLA 3SRXA 2WRSA 2Q0JA 5LCAA 5A5ZA 3X2XA 2QINA 3X2YA 1WW1A 3DHCA 1QH5A 3I15A 5ACWA 4AWZA 4YSBA 5K0WA 1JT1A 4O98A 2R2DA 1VGNA 4AD9A 3X2ZA 4WD6A 3AF5A 3ZQ4A 4UAMA 4Z7RA 4BP0A 2ZZIA 4LE6A 4C1GA 2A7MA 3QH8A 3P2UA 4ZEJA 4YSKA 5HH4A 5ACQA 5LMCA 1ZNBA 1WUOA 2H6AA 1DDKA 2BG7A 3T3NA 2UYXA 5KILA 5EHTA 4DIKA 4EYFA 2HB9A 4RAWA 3BC2A 2WHGA 4C1CA 4TZ9A 5ACSA 2NZFA 5FQBA 2BR6A 4CHLA 1DXKA 1X8IA 2GCUA 1MQOA 4PVOA 5EVDA 4H0DA 3FCZA 5HISA 3KNRA 5EVBA 4RM5A 2GKLA 1DD6A 4UWSB 4D02A 2QDTA 3IEMA 5DPXA 3ESHA 3SPUA 4NQ2A 2YNTA 5IQKA 5LS3A 3AF6A 5LM6A 2BG8A 5HH6A 3Q6VA 1YCFA 2GFJA 1QH3A 1SMLA 1YCGA 2BMIA 3F9OA 3ADRA 2YNVB 4Z60A 4NQ4A 2QJSA 4KEPA 4RL2A 4UBQA 1HLKA 5B1UA 3FAIA 4GYUA 1JJEA 2YNWA 4F6HA 5EW0A 1A8TA 4DILA 2M5CA 3DH8A 2CBNA 4RBSA 4D1WA 1K07A 4FR7A 2NZEA 2P1EA 4D1UA 5KIKA 4B87A 3JXPA 3DHAA 3VQZA 2YCBA 1KR3A 3I11A 2AIOA 4FSBA 3RKJA 3L6NA 2YNUA 3G1PA 1P9EA 5AEBA 4U4LA 5K4NA 3RPCA 2BG6A 2OHIA 2VW8A 3I14A 5ACRA 3T3OA 5HIPA 3A4YA 5EWAA 5ACPA 3LVZA 4XWTA 4ZO3A 2BFLA 5ACTA 3SW3A 3SD9A 5EV8A 1KO3A 1L9YA 2I7VA 4V0HA 4HKYA 1JJTA 2ZWRA 2BFKA 2GMNA 2YNTB 4XUKA 2BG8B 2I7TA 4C1DA 3ZNBA 5AHRA 2M5DA 2Q9UA 4XWWA 4AX1B 2FHXB 4HL1A 4EXSA 3S0ZA 2AZ4A 5LLDA 5B15A 1X8HA 5ACUA 3IE2A 4C1EA 4ZNBA 5A0TA 2FHXA 2Q42A 4Z6XA 5HH5A 1VMEA
chains in the Genus database with same CATH superfamily
3ZR9A 3WXCA 3IELA 2QEDA 4FEKA 3IOFA 3DHBA 4Z67A 2FU9A 5AHOA 4YSLA 4UWPB 1Y44A 3I13A 4NURA 4J5HA 4TZFA 5LCFA 2OHJA 4GCWA 5AIJA 1BC2A 4TZEA 2DKFA 2XF4A 4BZ3A 4UA4A 2E7YA 4PVTA 2GFKA 1XTOA 5AXOA 5HIOA 4EY2A 4TYFA 3IDZA 2BFZA 3T9MA 4C09A 4EXYA 4GYQA 4Z5YA 1XM8A 2P18A 4EYBA 5A87A 4C1HA 3IOGA 2Q0IA 4J5FA 5A0VA 4F6ZA 3X30A 3BK1A 2XR1A 2YZ3A 4P62A 2NYPA 2NXAA 4EYLA 1A7TA 5FQAA 3SBLA 2CFZA 2WYMA 2BIBA 3BK2A 3MD7A 2Y8BA 5FQCA 3VPEA 1WRAA 2FK6A 4AWYB 4C1FA 4TYTA 5ACVA 5K4MA 5AYAA 4HL2A 4EFZA 2ZNBA 2CG3A 5LCHA 1ZKPA 2Y87A 2FM6A 3AJ3A 2Y8AA 4RL0A 5LSCA 3KL7A 4KEQA 5K4KA 3PG4A 1M2XA 1KO2A 4Z5ZA 2DOOA 2P4ZA 4NQ6A 4RAMA 3IE1A 4D1VA 4UWRB 3RKKA 5AXRA 3I0VA 4AV7A 1E5DA 4NQ5A 3SFPA 1YCHA 2BC2A 1X8GA 3PY6A 2FU6A 2FU7A 3IEKA 5ACXA 3H3EA 4UWOB 5EH9A 4ZO2A 4AX0B 1VJNA 4PDXA 2I7XA 2QDSA 1ZTCA 5EVKA 2BGAA 5LE1A 1BMCA 3BV6A 3R2UA 2BG2A 5B3RA 2BFZB 1WUPA 4JO0A 2OHHA 2BTNA 4TZBA 3ZWFA 5HIQA 3IE0A 2ZO4A 4D1TA 2WYMC 2FU8A 1BVTA 2P97A 3KNSA 3TP9A 2YNVA 5EV6A 3PY5A 2WYLA 3SRXA 2WRSA 2Q0JA 5LCAA 5A5ZA 3X2XA 2QINA 3X2YA 1WW1A 3DHCA 1QH5A 3I15A 5ACWA 4AWZA 4YSBA 5K0WA 1JT1A 4O98A 2R2DA 1VGNA 4AD9A 3X2ZA 4WD6A 3AF5A 3ZQ4A 4UAMA 4Z7RA 4BP0A 2ZZIA 4LE6A 4C1GA 2A7MA 3QH8A 3P2UA 4ZEJA 4YSKA 5HH4A 5ACQA 5LMCA 1ZNBA 1WUOA 2H6AA 1DDKA 2BG7A 3T3NA 2UYXA 5KILA 5A23A 5EHTA 4DIKA 4EYFA 2HB9A 4RAWA 3BC2A 2WHGA 4C1CA 4TZ9A 5ACSA 2NZFA 5FQBA 2BR6A 4CHLA 1DXKA 1X8IA 2GCUA 2YHEA 1MQOA 4PVOA 5EVDA 4H0DA 3FCZA 5HISA 3KNRA 5AJLA 5EVBA 4RM5A 2GKLA 1DD6A 4UWSB 4D02A 2QDTA 3IEMA 5DPXA 3ESHA 3SPUA 4NQ2A 2YNTA 5IQKA 5LS3A 3AF6A 5LM6A 2BG8A 5HH6A 3Q6VA 1YCFA 2GFJA 1QH3A 1SMLA 1YCGA 2BMIA 3F9OA 3ADRA 2YNVB 4Z60A 4NQ4A 2QJSA 4KEPA 4RL2A 4UBQA 1HLKA 5B1UA 3FAIA 4GYUA 1JJEA 2YNWA 4F6HA 5EW0A 1A8TA 4DILA 2M5CA 3DH8A 2CBNA 4RBSA 4D1WA 1K07A 4FR7A 2NZEA 2P1EA 4D1UA 5KIKA 4B87A 3JXPA 3DHAA 3VQZA 2YCBA 1KR3A 3I11A 2AIOA 4FSBA 3RKJA 3L6NA 2YNUA 3G1PA 1P9EA 5AEBA 4U4LA 5K4NA 3RPCA 2BG6A 2OHIA 2VW8A 3I14A 5ACRA 3T3OA 5HIPA 3A4YA 5EWAA 5ACPA 3LVZA 4XWTA 4ZO3A 2BFLA 5ACTA 3SW3A 3SD9A 5EV8A 1KO3A 1L9YA 2I7VA 4V0HA 4HKYA 1JJTA 2ZWRA 2BFKA 2GMNA 2CG2A 2YNTB 4XUKA 2BG8B 2I7TA 4C1DA 3ZNBA 5AHRA 2M5DA 2Q9UA 4XWWA 4AX1B 2FHXB 4HL1A 4EXSA 3S0ZA 2AZ4A 4AXHA 5LLDA 5B15A 1X8HA 5ACUA 2CFUA 3IE2A 4C1EA 4ZNBA 5A0TA 2FHXA 2Q42A 4Z6XA 5HH5A 1VMEA
chains in the Genus database with same CATH topology
3ZR9A 3WXCA 3IELA 2QEDA 4FEKA 3IOFA 3DHBA 4Z67A 2FU9A 5AHOA 4YSLA 4UWPB 1Y44A 3I13A 4TZFA 4J5HA 5LCFA 2OHJA 4GCWA 1BC2A 4TZEA 2DKFA 2XF4A 4BZ3A 4UA4A 2E7YA 4PVTA 2GFKA 1XTOA 5AXOA 5HIOA 4EY2A 4TYFA 3IDZA 2BFZA 3T9MA 4C09A 4EXYA 4GYQA 4Z5YA 1XM8A 2P18A 4EYBA 5A87A 4C1HA 3IOGA 2Q0IA 4J5FA 5A0VA 4F6ZA 3X30A 3BK1A 2XR1A 2YZ3A 4P62A 2NYPA 2NXAA 4EYLA 1A7TA 5FQAA 3SBLA 2WYMA 2BIBA 3BK2A 3MD7A 2Y8BA 5FQCA 3VPEA 1WRAA 2FK6A 4AWYB 4C1FA 4TYTA 5ACVA 5K4MA 5AYAA 4HL2A 4EFZA 2ZNBA 5LCHA 1ZKPA 2Y87A 2FM6A 3AJ3A 2Y8AA 4RL0A 5LSCA 3KL7A 4KEQA 5K4KA 3PG4A 1M2XA 1KO2A 4Z5ZA 2DOOA 2P4ZA 4NQ6A 4RAMA 3IE1A 4D1VA 4UWRB 3RKKA 5AXRA 3I0VA 1E5DA 4NQ5A 3SFPA 1YCHA 2BC2A 1X8GA 3PY6A 2FU6A 2FU7A 3IEKA 5ACXA 3H3EA 4UWOB 5EH9A 4ZO2A 4AX0B 1VJNA 2I7XA 2QDSA 1ZTCA 5EVKA 2BGAA 5LE1A 1BMCA 3BV6A 3R2UA 2BG2A 5B3RA 2BFZB 1WUPA 4JO0A 2OHHA 2BTNA 4TZBA 3ZWFA 5HIQA 3IE0A 2ZO4A 4D1TA 2WYMC 2FU8A 1BVTA 2P97A 3KNSA 3TP9A 2YNVA 5EV6A 3PY5A 2WYLA 3SRXA 2WRSA 2Q0JA 5LCAA 5A5ZA 3X2XA 2QINA 3X2YA 1WW1A 3DHCA 1QH5A 3I15A 5ACWA 4AWZA 4YSBA 5K0WA 1JT1A 4O98A 2R2DA 1VGNA 4AD9A 3X2ZA 4WD6A 3AF5A 3ZQ4A 4UAMA 4Z7RA 4BP0A 2ZZIA 4LE6A 4C1GA 2A7MA 3QH8A 3P2UA 4ZEJA 4YSKA 5HH4A 5ACQA 5LMCA 1ZNBA 1WUOA 2H6AA 1DDKA 2BG7A 3T3NA 2UYXA 5KILA 5EHTA 4DIKA 4EYFA 2HB9A 4RAWA 3BC2A 2WHGA 4C1CA 4TZ9A 5ACSA 2NZFA 5FQBA 2BR6A 4CHLA 1DXKA 1X8IA 2GCUA 1MQOA 4PVOA 5EVDA 4H0DA 3FCZA 5HISA 3KNRA 5EVBA 4RM5A 2GKLA 1DD6A 4UWSB 4D02A 2QDTA 3IEMA 5DPXA 3ESHA 3SPUA 4NQ2A 2YNTA 5IQKA 5LS3A 3AF6A 5LM6A 2BG8A 5HH6A 3Q6VA 1YCFA 2GFJA 1QH3A 1SMLA 1YCGA 2BMIA 3F9OA 3ADRA 2YNVB 4Z60A 4NQ4A 2QJSA 4KEPA 4RL2A 4UBQA 1HLKA 5B1UA 3FAIA 4GYUA 1JJEA 2YNWA 4F6HA 5EW0A 1A8TA 4DILA 2M5CA 3DH8A 2CBNA 4RBSA 4D1WA 1K07A 4FR7A 2NZEA 2P1EA 4D1UA 5KIKA 4B87A 3JXPA 3DHAA 3VQZA 2YCBA 1KR3A 3I11A 2AIOA 4FSBA 3RKJA 3L6NA 2YNUA 3G1PA 1P9EA 5AEBA 4U4LA 5K4NA 3RPCA 2BG6A 2OHIA 2VW8A 3I14A 5ACRA 3T3OA 5HIPA 3A4YA 5EWAA 5ACPA 3LVZA 4XWTA 4ZO3A 2BFLA 5ACTA 3SW3A 3SD9A 5EV8A 1KO3A 1L9YA 2I7VA 4V0HA 4HKYA 1JJTA 2ZWRA 2BFKA 2GMNA 2YNTB 4XUKA 2BG8B 2I7TA 4C1DA 3ZNBA 5AHRA 2M5DA 2Q9UA 4XWWA 4AX1B 2FHXB 4HL1A 4EXSA 3S0ZA 2AZ4A 5LLDA 5B15A 1X8HA 5ACUA 3IE2A 4C1EA 4ZNBA 5A0TA 2FHXA 2Q42A 4Z6XA 5HH5A 1VMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZR9 A;  3WXC A;  3IEL A;  2QED A;  4FEK A;  3IOF A;  3DHB A;  4Z67 A;  2FU9 A;  5AHO A;  4YSL A;  4UWP B;  1Y44 A;  3I13 A;  4TZF A;  4J5H A;  5LCF A;  2OHJ A;  4GCW A;  1BC2 A;  4TZE A;  2DKF A;  2XF4 A;  4BZ3 A;  4UA4 A;  2E7Y A;  4PVT A;  2GFK A;  1XTO A;  5AXO A;  5HIO A;  4EY2 A;  4TYF A;  3IDZ A;  2BFZ A;  3T9M A;  4C09 A;  4EXY A;  4GYQ A;  4Z5Y A;  1XM8 A;  2P18 A;  4EYB A;  5A87 A;  4C1H A;  3IOG A;  2Q0I A;  4J5F A;  5A0V A;  4F6Z A;  3X30 A;  3BK1 A;  2XR1 A;  2YZ3 A;  4P62 A;  2NYP A;  2NXA A;  4EYL A;  1A7T A;  5FQA A;  3SBL A;  2WYM A;  2BIB A;  3BK2 A;  3MD7 A;  2Y8B A;  5FQC A;  3VPE A;  1WRA A;  2FK6 A;  4AWY B;  4C1F A;  4TYT A;  5ACV A;  5K4M A;  5AYA A;  4HL2 A;  4EFZ A;  2ZNB A;  5LCH A;  1ZKP A;  2Y87 A;  2FM6 A;  3AJ3 A;  2Y8A A;  4RL0 A;  5LSC A;  3KL7 A;  4KEQ A;  5K4K A;  3PG4 A;  1M2X A;  1KO2 A;  4Z5Z A;  2DOO A;  2P4Z A;  4NQ6 A;  4RAM A;  3IE1 A;  4D1V A;  4UWR B;  3RKK A;  5AXR A;  3I0V A;  1E5D A;  4NQ5 A;  3SFP A;  1YCH A;  2BC2 A;  1X8G A;  3PY6 A;  2FU6 A;  2FU7 A;  3IEK A;  5ACX A;  3H3E A;  4UWO B;  5EH9 A;  4ZO2 A;  4AX0 B;  1VJN A;  2I7X A;  2QDS A;  1ZTC A;  5EVK A;  2BGA A;  5LE1 A;  1BMC A;  3BV6 A;  3R2U A;  2BG2 A;  5B3R A;  2BFZ B;  1WUP A;  4JO0 A;  2OHH A;  2BTN A;  4TZB A;  3ZWF A;  5HIQ A;  3IE0 A;  2ZO4 A;  4D1T A;  2WYM C;  2FU8 A;  1BVT A;  2P97 A;  3KNS A;  3TP9 A;  2YNV A;  5EV6 A;  3PY5 A;  2WYL A;  3SRX A;  2WRS A;  2Q0J A;  5LCA A;  5A5Z A;  3X2X A;  2QIN A;  3X2Y A;  1WW1 A;  3DHC A;  1QH5 A;  3I15 A;  5ACW A;  4AWZ A;  4YSB A;  5K0W A;  1JT1 A;  4O98 A;  2R2D A;  1VGN A;  4AD9 A;  3X2Z A;  4WD6 A;  3AF5 A;  3ZQ4 A;  4UAM A;  4Z7R A;  4BP0 A;  2ZZI A;  4LE6 A;  4C1G A;  2A7M A;  3QH8 A;  3P2U A;  4ZEJ A;  4YSK A;  5HH4 A;  5ACQ A;  5LMC A;  1ZNB A;  1WUO A;  2H6A A;  1DDK A;  2BG7 A;  3T3N A;  2UYX A;  5KIL A;  5EHT A;  4DIK A;  4EYF A;  2HB9 A;  4RAW A;  3BC2 A;  2WHG A;  4C1C A;  4TZ9 A;  5ACS A;  2NZF A;  5FQB A;  2BR6 A;  4CHL A;  1DXK A;  1X8I A;  2GCU A;  1MQO A;  4PVO A;  5EVD A;  4H0D A;  3FCZ A;  5HIS A;  3KNR A;  5EVB A;  4RM5 A;  2GKL A;  1DD6 A;  4UWS B;  4D02 A;  2QDT A;  3IEM A;  5DPX A;  3ESH A;  3SPU A;  4NQ2 A;  2YNT A;  5IQK A;  5LS3 A;  3AF6 A;  5LM6 A;  2BG8 A;  5HH6 A;  3Q6V A;  1YCF A;  2GFJ A;  1QH3 A;  1SML A;  1YCG A;  2BMI A;  3F9O A;  3ADR A;  2YNV B;  4Z60 A;  4NQ4 A;  2QJS A;  4KEP A;  4RL2 A;  4UBQ A;  1HLK A;  5B1U A;  3FAI A;  4GYU A;  1JJE A;  2YNW A;  4F6H A;  5EW0 A;  1A8T A;  4DIL A;  2M5C A;  3DH8 A;  2CBN A;  4RBS A;  4D1W A;  1K07 A;  4FR7 A;  2NZE A;  2P1E A;  4D1U A;  5KIK A;  4B87 A;  3JXP A;  3DHA A;  3VQZ A;  2YCB A;  1KR3 A;  3I11 A;  2AIO A;  4FSB A;  3RKJ A;  3L6N A;  2YNU A;  3G1P A;  1P9E A;  5AEB A;  4U4L A;  5K4N A;  3RPC A;  2BG6 A;  2OHI A;  2VW8 A;  3I14 A;  5ACR A;  3T3O A;  5HIP A;  3A4Y A;  5EWA A;  5ACP A;  3LVZ A;  4XWT A;  4ZO3 A;  2BFL A;  5ACT A;  3SW3 A;  3SD9 A;  5EV8 A;  1KO3 A;  1L9Y A;  2I7V A;  4V0H A;  4HKY A;  1JJT A;  2ZWR A;  2BFK A;  2GMN A;  2YNT B;  4XUK A;  2BG8 B;  2I7T A;  4C1D A;  3ZNB A;  5AHR A;  2M5D A;  2Q9U A;  4XWW A;  4AX1 B;  2FHX B;  4HL1 A;  4EXS A;  3S0Z A;  2AZ4 A;  5LLD A;  5B15 A;  1X8H A;  5ACU A;  3IE2 A;  4C1E A;  4ZNB A;  5A0T A;  2FHX A;  2Q42 A;  4Z6X A;  5HH5 A;  1VME A; 
#chains in the Genus database with same CATH topology
 3ZR9 A;  3WXC A;  3IEL A;  2QED A;  4FEK A;  3IOF A;  3DHB A;  4Z67 A;  2FU9 A;  5AHO A;  4YSL A;  4UWP B;  1Y44 A;  3I13 A;  4NUR A;  4J5H A;  4TZF A;  5LCF A;  2OHJ A;  4GCW A;  5AIJ A;  1BC2 A;  4TZE A;  2DKF A;  2XF4 A;  4BZ3 A;  4UA4 A;  2E7Y A;  4PVT A;  2GFK A;  1XTO A;  5AXO A;  5HIO A;  4EY2 A;  4TYF A;  3IDZ A;  2BFZ A;  3T9M A;  4C09 A;  4EXY A;  4GYQ A;  4Z5Y A;  1XM8 A;  2P18 A;  4EYB A;  5A87 A;  4C1H A;  3IOG A;  2Q0I A;  4J5F A;  5A0V A;  4F6Z A;  3X30 A;  3BK1 A;  2XR1 A;  2YZ3 A;  4P62 A;  2NYP A;  2NXA A;  4EYL A;  1A7T A;  5FQA A;  3SBL A;  2CFZ A;  2WYM A;  2BIB A;  3BK2 A;  3MD7 A;  2Y8B A;  5FQC A;  3VPE A;  1WRA A;  2FK6 A;  4AWY B;  4C1F A;  4TYT A;  5ACV A;  5K4M A;  5AYA A;  4HL2 A;  4EFZ A;  2ZNB A;  2CG3 A;  5LCH A;  1ZKP A;  2Y87 A;  2FM6 A;  3AJ3 A;  2Y8A A;  4RL0 A;  5LSC A;  3KL7 A;  4KEQ A;  5K4K A;  3PG4 A;  1M2X A;  1KO2 A;  4Z5Z A;  2DOO A;  2P4Z A;  4NQ6 A;  4RAM A;  3IE1 A;  4D1V A;  4UWR B;  3RKK A;  5AXR A;  3I0V A;  4AV7 A;  1E5D A;  4NQ5 A;  3SFP A;  1YCH A;  2BC2 A;  1X8G A;  3PY6 A;  2FU6 A;  2FU7 A;  3IEK A;  5ACX A;  3H3E A;  4UWO B;  5EH9 A;  4ZO2 A;  4AX0 B;  1VJN A;  4PDX A;  2I7X A;  2QDS A;  1ZTC A;  5EVK A;  2BGA A;  5LE1 A;  1BMC A;  3BV6 A;  3R2U A;  2BG2 A;  5B3R A;  2BFZ B;  1WUP A;  4JO0 A;  2OHH A;  2BTN A;  4TZB A;  3ZWF A;  5HIQ A;  3IE0 A;  2ZO4 A;  4D1T A;  2WYM C;  2FU8 A;  1BVT A;  2P97 A;  3KNS A;  3TP9 A;  2YNV A;  5EV6 A;  3PY5 A;  2WYL A;  3SRX A;  2WRS A;  2Q0J A;  5LCA A;  5A5Z A;  3X2X A;  2QIN A;  3X2Y A;  1WW1 A;  3DHC A;  1QH5 A;  3I15 A;  5ACW A;  4AWZ A;  4YSB A;  5K0W A;  1JT1 A;  4O98 A;  2R2D A;  1VGN A;  4AD9 A;  3X2Z A;  4WD6 A;  3AF5 A;  3ZQ4 A;  4UAM A;  4Z7R A;  4BP0 A;  2ZZI A;  4LE6 A;  4C1G A;  2A7M A;  3QH8 A;  3P2U A;  4ZEJ A;  4YSK A;  5HH4 A;  5ACQ A;  5LMC A;  1ZNB A;  1WUO A;  2H6A A;  1DDK A;  2BG7 A;  3T3N A;  2UYX A;  5KIL A;  5A23 A;  5EHT A;  4DIK A;  4EYF A;  2HB9 A;  4RAW A;  3BC2 A;  2WHG A;  4C1C A;  4TZ9 A;  5ACS A;  2NZF A;  5FQB A;  2BR6 A;  4CHL A;  1DXK A;  1X8I A;  2GCU A;  2YHE A;  1MQO A;  4PVO A;  5EVD A;  4H0D A;  3FCZ A;  5HIS A;  3KNR A;  5AJL A;  5EVB A;  4RM5 A;  2GKL A;  1DD6 A;  4UWS B;  4D02 A;  2QDT A;  3IEM A;  5DPX A;  3ESH A;  3SPU A;  4NQ2 A;  2YNT A;  5IQK A;  5LS3 A;  3AF6 A;  5LM6 A;  2BG8 A;  5HH6 A;  3Q6V A;  1YCF A;  2GFJ A;  1QH3 A;  1SML A;  1YCG A;  2BMI A;  3F9O A;  3ADR A;  2YNV B;  4Z60 A;  4NQ4 A;  2QJS A;  4KEP A;  4RL2 A;  4UBQ A;  1HLK A;  5B1U A;  3FAI A;  4GYU A;  1JJE A;  2YNW A;  4F6H A;  5EW0 A;  1A8T A;  4DIL A;  2M5C A;  3DH8 A;  2CBN A;  4RBS A;  4D1W A;  1K07 A;  4FR7 A;  2NZE A;  2P1E A;  4D1U A;  5KIK A;  4B87 A;  3JXP A;  3DHA A;  3VQZ A;  2YCB A;  1KR3 A;  3I11 A;  2AIO A;  4FSB A;  3RKJ A;  3L6N A;  2YNU A;  3G1P A;  1P9E A;  5AEB A;  4U4L A;  5K4N A;  3RPC A;  2BG6 A;  2OHI A;  2VW8 A;  3I14 A;  5ACR A;  3T3O A;  5HIP A;  3A4Y A;  5EWA A;  5ACP A;  3LVZ A;  4XWT A;  4ZO3 A;  2BFL A;  5ACT A;  3SW3 A;  3SD9 A;  5EV8 A;  1KO3 A;  1L9Y A;  2I7V A;  4V0H A;  4HKY A;  1JJT A;  2ZWR A;  2BFK A;  2GMN A;  2CG2 A;  2YNT B;  4XUK A;  2BG8 B;  2I7T A;  4C1D A;  3ZNB A;  5AHR A;  2M5D A;  2Q9U A;  4XWW A;  4AX1 B;  2FHX B;  4HL1 A;  4EXS A;  3S0Z A;  2AZ4 A;  4AXH A;  5LLD A;  5B15 A;  1X8H A;  5ACU A;  2CFU A;  3IE2 A;  4C1E A;  4ZNB A;  5A0T A;  2FHX A;  2Q42 A;  4Z6X A;  5HH5 A;  1VME A; 
#chains in the Genus database with same CATH homology
 3ZR9 A;  3WXC A;  3IEL A;  2QED A;  4FEK A;  3IOF A;  3DHB A;  4Z67 A;  2FU9 A;  5AHO A;  4YSL A;  4UWP B;  1Y44 A;  3I13 A;  4TZF A;  4J5H A;  5LCF A;  2OHJ A;  4GCW A;  1BC2 A;  4TZE A;  2DKF A;  2XF4 A;  4BZ3 A;  4UA4 A;  2E7Y A;  4PVT A;  2GFK A;  1XTO A;  5AXO A;  5HIO A;  4EY2 A;  4TYF A;  3IDZ A;  2BFZ A;  3T9M A;  4C09 A;  4EXY A;  4GYQ A;  4Z5Y A;  1XM8 A;  2P18 A;  4EYB A;  5A87 A;  4C1H A;  3IOG A;  2Q0I A;  4J5F A;  5A0V A;  4F6Z A;  3X30 A;  3BK1 A;  2XR1 A;  2YZ3 A;  4P62 A;  2NYP A;  2NXA A;  4EYL A;  1A7T A;  5FQA A;  3SBL A;  2WYM A;  2BIB A;  3BK2 A;  3MD7 A;  2Y8B A;  5FQC A;  3VPE A;  1WRA A;  2FK6 A;  4AWY B;  4C1F A;  4TYT A;  5ACV A;  5K4M A;  5AYA A;  4HL2 A;  4EFZ A;  2ZNB A;  5LCH A;  1ZKP A;  2Y87 A;  2FM6 A;  3AJ3 A;  2Y8A A;  4RL0 A;  5LSC A;  3KL7 A;  4KEQ A;  5K4K A;  3PG4 A;  1M2X A;  1KO2 A;  4Z5Z A;  2DOO A;  2P4Z A;  4NQ6 A;  4RAM A;  3IE1 A;  4D1V A;  4UWR B;  3RKK A;  5AXR A;  3I0V A;  1E5D A;  4NQ5 A;  3SFP A;  1YCH A;  2BC2 A;  1X8G A;  3PY6 A;  2FU6 A;  2FU7 A;  3IEK A;  5ACX A;  3H3E A;  4UWO B;  5EH9 A;  4ZO2 A;  4AX0 B;  1VJN A;  2I7X A;  2QDS A;  1ZTC A;  5EVK A;  2BGA A;  5LE1 A;  1BMC A;  3BV6 A;  3R2U A;  2BG2 A;  5B3R A;  2BFZ B;  1WUP A;  4JO0 A;  2OHH A;  2BTN A;  4TZB A;  3ZWF A;  5HIQ A;  3IE0 A;  2ZO4 A;  4D1T A;  2WYM C;  2FU8 A;  1BVT A;  2P97 A;  3KNS A;  3TP9 A;  2YNV A;  5EV6 A;  3PY5 A;  2WYL A;  3SRX A;  2WRS A;  2Q0J A;  5LCA A;  5A5Z A;  3X2X A;  2QIN A;  3X2Y A;  1WW1 A;  3DHC A;  1QH5 A;  3I15 A;  5ACW A;  4AWZ A;  4YSB A;  5K0W A;  1JT1 A;  4O98 A;  2R2D A;  1VGN A;  4AD9 A;  3X2Z A;  4WD6 A;  3AF5 A;  3ZQ4 A;  4UAM A;  4Z7R A;  4BP0 A;  2ZZI A;  4LE6 A;  4C1G A;  2A7M A;  3QH8 A;  3P2U A;  4ZEJ A;  4YSK A;  5HH4 A;  5ACQ A;  5LMC A;  1ZNB A;  1WUO A;  2H6A A;  1DDK A;  2BG7 A;  3T3N A;  2UYX A;  5KIL A;  5EHT A;  4DIK A;  4EYF A;  2HB9 A;  4RAW A;  3BC2 A;  2WHG A;  4C1C A;  4TZ9 A;  5ACS A;  2NZF A;  5FQB A;  2BR6 A;  4CHL A;  1DXK A;  1X8I A;  2GCU A;  1MQO A;  4PVO A;  5EVD A;  4H0D A;  3FCZ A;  5HIS A;  3KNR A;  5EVB A;  4RM5 A;  2GKL A;  1DD6 A;  4UWS B;  4D02 A;  2QDT A;  3IEM A;  5DPX A;  3ESH A;  3SPU A;  4NQ2 A;  2YNT A;  5IQK A;  5LS3 A;  3AF6 A;  5LM6 A;  2BG8 A;  5HH6 A;  3Q6V A;  1YCF A;  2GFJ A;  1QH3 A;  1SML A;  1YCG A;  2BMI A;  3F9O A;  3ADR A;  2YNV B;  4Z60 A;  4NQ4 A;  2QJS A;  4KEP A;  4RL2 A;  4UBQ A;  1HLK A;  5B1U A;  3FAI A;  4GYU A;  1JJE A;  2YNW A;  4F6H A;  5EW0 A;  1A8T A;  4DIL A;  2M5C A;  3DH8 A;  2CBN A;  4RBS A;  4D1W A;  1K07 A;  4FR7 A;  2NZE A;  2P1E A;  4D1U A;  5KIK A;  4B87 A;  3JXP A;  3DHA A;  3VQZ A;  2YCB A;  1KR3 A;  3I11 A;  2AIO A;  4FSB A;  3RKJ A;  3L6N A;  2YNU A;  3G1P A;  1P9E A;  5AEB A;  4U4L A;  5K4N A;  3RPC A;  2BG6 A;  2OHI A;  2VW8 A;  3I14 A;  5ACR A;  3T3O A;  5HIP A;  3A4Y A;  5EWA A;  5ACP A;  3LVZ A;  4XWT A;  4ZO3 A;  2BFL A;  5ACT A;  3SW3 A;  3SD9 A;  5EV8 A;  1KO3 A;  1L9Y A;  2I7V A;  4V0H A;  4HKY A;  1JJT A;  2ZWR A;  2BFK A;  2GMN A;  2YNT B;  4XUK A;  2BG8 B;  2I7T A;  4C1D A;  3ZNB A;  5AHR A;  2M5D A;  2Q9U A;  4XWW A;  4AX1 B;  2FHX B;  4HL1 A;  4EXS A;  3S0Z A;  2AZ4 A;  5LLD A;  5B15 A;  1X8H A;  5ACU A;  3IE2 A;  4C1E A;  4ZNB A;  5A0T A;  2FHX A;  2Q42 A;  4Z6X A;  5HH5 A;  1VME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...