4ZO2A

Aidc, a dizinc quorum-quenching lactonase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
293
structure length
293
Chain Sequence
DLSGFKKIKLGELELFILTDGYIHEENLISFAPRGNVAELKTILKDNFRADHYIDMAINILLVKTKEKLILMDTGMGIFADERTGFLLKSLQKAGFSAHDITDIFLSHAHPDHIGGVVDKQNKLVFPNASIFISKIEHDFWINASIKDFNNSALKAHPERLNQIIPALQNILKAIQPKLKFYDLNKTLYSHFNFQLAPGHTPGLTVTTISSGNEKLMYVADLIHSDVILFPHPDWGFSGDTDLDIATASRKKFLKQLADTKARAFTSHLPWPGLGFTKVKAPGFEWIPESFMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Characterization of AidC, a Quorum-Quenching Lactonase with Atypical Selectivity.
pubmed doi rcsb
source organism Chryseobacterium sp. strb126
molecule tags Hydrolase
molecule keywords Acylhomoserine lactonase
total genus 87
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4zo2A00
2YNTB 3X2XA 3FCZA 2BG6A 5HIQA 2BG8B 3BC2A 2FU9A 4ZEJA 3RKKA 3ESHA 3JXPA 4EYLA 4B87A 2Y8BA 5HH4A 3X2YA 5FQCA 3SBLA 1K07A 4UWPB 2BFLA 2WYMA 1YCFA 1A8TA 4UBQA 2NZEA 4AX1B 2BMIA 1BMCA 3I14A 5FQAA 1BVTA 1HLKA 5B1UA 4C1CA 1VGNA 2XR1A 3L6NA 5A5ZA 4ZO3A 4BP0A 2FU7A 5ACWA 5IQKA 3P2UA 2HB9A 5A87A 5EVDA 5AYAA 3I15A 4KEQA 4AX0B 1QH3A 2YZ3A 3FAIA 2YNUA 5LMCA 4V0HA 3PG4A 5LCHA 1ZTCA 2R2DA 3SW3A 4AD9A 5K4NA 4YSKA 3A4YA 3X30A 4EYBA 5A0TA 2E7YA 5ACSA 1JJTA 3DHCA 4XWTA 2P4ZA 4HL1A 4P62A 4Z7RA 2ZWRA 5LLDA 2BIBA 4XUKA 5ACVA 3BK2A 3TP9A 4FSBA 5ACUA 5EVBA 2UYXA 5HISA 3VQZA 5EV6A 3Q6VA 2Q0JA 3IE2A 1KO2A 1DDKA 4DILA 4LE6A 4GCWA 2FU8A 5HH6A 3ZR9A 4C09A 1DD6A 2Q42A 1KO3A 4C1HA 4U4LA 2OHIA 3ZQ4A 1WRAA 3IE0A 1ZKPA 4H0DA 5EWAA 2YCBA 2I7TA 3IOFA 3IEMA 4HKYA 3SRXA 3R2UA 3DH8A 3SPUA 4O98A 3IELA 4CHLA 4Z5YA 2FHXB 3SD9A 1DXKA 5EV8A 4UWSB 4ZNBA 2Y8AA 5ACQA 1SMLA 4C1EA 4HL2A 1YCGA 5HH5A 1WW1A 4KEPA 1WUPA 1L9YA 1ZNBA 2M5CA 5AHOA 4D1VA 4Z5ZA 5B3RA 2FM6A 2BFKA 1XTOA 4PVTA 3DHBA 3PY6A 4DIKA 2M5DA 2NZFA 2BTNA 3AJ3A 4UWRB 3IE1A 5ACXA 4YSBA 5AXRA 2BFZB 2DOOA 4Z67A 2AZ4A 1JJEA 3ZWFA 3BK1A 3MD7A 4EYFA 5K4MA 5LM6A 4BZ3A 2GFKA 2P18A 2NXAA 4RM5A 1Y44A 2QINA 3T3NA 2BG7A 2FU6A 3T9MA 2GCUA 3IOGA 5EVKA 3LVZA 5KILA 3QH8A 3AF6A 3F9OA 3DHAA 3IDZA 2GMNA 4NQ2A 2WYMC 4UA4A 2CBNA 4RBSA 1VJNA 2Q0IA 5B15A 2OHJA 5HIPA 2VW8A 2A7MA 2GKLA 2BR6A 2YNVA 3VPEA 1E5DA 4C1FA 4NQ5A 4TZEA 1X8GA 2I7XA 4TZFA 1VMEA 5ACRA 1P9EA 4RL2A 2AIOA 2ZO4A 4C1DA 3KL7A 3KNRA 4JO0A 4UAMA 4ZO2A 1X8IA 3T3OA 2P97A 5K0WA 2QDSA 2P1EA 4PVOA 2BFZA 5KIKA 3PY5A 4F6ZA 2WHGA 4TYFA 4Z60A 2NYPA 3IEKA 3ZNBA 4D02A 4GYUA 5LS3A 3KNSA 4RAMA 2WRSA 4D1WA 1QH5A 1A7TA 4WD6A 2BG2A 4RL0A 5K4KA 5EH9A 2H6AA 2Q9UA 4FEKA 4F6HA 2FK6A 3H3EA 4GYQA 5EW0A 3X2ZA 3WXCA 4J5FA 5LE1A 4FR7A 3I0VA 2BG8A 4D1UA 4EY2A 3ADRA 3RPCA 5HIOA 4AWYB 5AHRA 3BV6A 4TZBA 2XF4A 5A0VA 1YCHA 5ACPA 2FHXA 2YNTA 3RKJA 2I7VA 4AWZA 4YSLA 4C1GA 4UWOB 4XWWA 1M2XA 2WYLA 2OHHA 2YNVB 3SFPA 3I13A 2QDTA 1BC2A 2ZZIA 2QJSA 4TYTA 3S0ZA 3G1PA 3AF5A 1JT1A 4EXSA 5LCFA 2DKFA 2Y87A 2YNWA 1KR3A 3I11A 2BC2A 2QEDA 1X8HA 4D1TA 5LCAA 4RAWA 1XM8A 4TZ9A 5DPXA 4EFZA 5LSCA 5EHTA 2ZNBA 4Z6XA 1WUOA 4NQ4A 5AEBA 2GFJA 5AXOA 1MQOA 2BGAA 5FQBA 4EXYA 4NQ6A 5ACTA 4J5HA
chains in the Genus database with same CATH superfamily
2YNTB 3X2XA 3FCZA 2BG6A 5HIQA 2BG8B 3BC2A 2FU9A 4ZEJA 3RKKA 3ESHA 3JXPA 4EYLA 4B87A 2Y8BA 5HH4A 3X2YA 5FQCA 3SBLA 1K07A 4UWPB 4AXHA 2BFLA 2WYMA 1YCFA 1A8TA 4UBQA 2NZEA 4AX1B 2BMIA 1BMCA 3I14A 5FQAA 1BVTA 1HLKA 5B1UA 4C1CA 1VGNA 2XR1A 3L6NA 5A5ZA 4ZO3A 4BP0A 2FU7A 5ACWA 5IQKA 3P2UA 2HB9A 5A87A 5EVDA 5AYAA 3I15A 4KEQA 4AX0B 1QH3A 2YZ3A 3FAIA 2YNUA 5LMCA 4V0HA 3PG4A 2CG2A 5LCHA 1ZTCA 2R2DA 3SW3A 4AD9A 5K4NA 4YSKA 2CFUA 3A4YA 3X30A 4EYBA 5A0TA 2E7YA 5ACSA 1JJTA 3DHCA 4XWTA 2P4ZA 4HL1A 4P62A 4Z7RA 2ZWRA 5LLDA 2BIBA 4XUKA 5ACVA 3BK2A 3TP9A 4FSBA 5ACUA 5EVBA 2UYXA 5HISA 3VQZA 5EV6A 3Q6VA 2Q0JA 3IE2A 1KO2A 1DDKA 4DILA 4LE6A 4GCWA 2FU8A 5HH6A 3ZR9A 4C09A 1DD6A 2Q42A 1KO3A 4C1HA 4U4LA 2CG3A 2OHIA 3ZQ4A 1WRAA 3IE0A 1ZKPA 4H0DA 5EWAA 2YCBA 2I7TA 3IOFA 3IEMA 4HKYA 3SRXA 3R2UA 3DH8A 3SPUA 4O98A 3IELA 4CHLA 4Z5YA 2FHXB 3SD9A 1DXKA 5EV8A 4UWSB 4ZNBA 2Y8AA 5ACQA 1SMLA 4C1EA 4HL2A 1YCGA 5HH5A 1WW1A 4KEPA 1WUPA 1L9YA 1ZNBA 2M5CA 5AHOA 4D1VA 4Z5ZA 5B3RA 2FM6A 2BFKA 1XTOA 4PVTA 3DHBA 3PY6A 4DIKA 2M5DA 2NZFA 2BTNA 3AJ3A 4UWRB 3IE1A 5ACXA 4YSBA 5AXRA 2BFZB 2DOOA 4Z67A 2AZ4A 1JJEA 3ZWFA 3BK1A 3MD7A 4EYFA 5K4MA 5LM6A 4BZ3A 2YHEA 2GFKA 2P18A 2NXAA 4RM5A 1Y44A 2QINA 4NURA 3T3NA 2BG7A 2FU6A 3T9MA 2GCUA 3IOGA 5EVKA 3LVZA 5KILA 3QH8A 5AJLA 3AF6A 3F9OA 3DHAA 3IDZA 2GMNA 4NQ2A 2WYMC 4UA4A 2CBNA 4RBSA 1VJNA 4PDXA 2Q0IA 5B15A 2OHJA 5HIPA 2VW8A 2A7MA 2GKLA 2BR6A 2YNVA 3VPEA 1E5DA 4C1FA 4NQ5A 4TZEA 1X8GA 2I7XA 4TZFA 1VMEA 5ACRA 1P9EA 4RL2A 2AIOA 2ZO4A 4C1DA 3KL7A 3KNRA 4JO0A 4UAMA 2CFZA 4ZO2A 1X8IA 3T3OA 2P97A 5K0WA 2QDSA 2P1EA 4PVOA 2BFZA 5KIKA 3PY5A 4F6ZA 2WHGA 4TYFA 4Z60A 2NYPA 3IEKA 3ZNBA 4D02A 4GYUA 5LS3A 3KNSA 4RAMA 2WRSA 4D1WA 1QH5A 5AIJA 1A7TA 4WD6A 2BG2A 4AV7A 4RL0A 5K4KA 5EH9A 2H6AA 2Q9UA 4FEKA 4F6HA 2FK6A 3H3EA 4GYQA 5EW0A 3X2ZA 3WXCA 4J5FA 5LE1A 4FR7A 3I0VA 2BG8A 4D1UA 4EY2A 3ADRA 3RPCA 5HIOA 4AWYB 5AHRA 3BV6A 4TZBA 2XF4A 5A0VA 1YCHA 5ACPA 2FHXA 2YNTA 3RKJA 2I7VA 4AWZA 4YSLA 4C1GA 4UWOB 4XWWA 1M2XA 2WYLA 2OHHA 2YNVB 3SFPA 3I13A 2QDTA 1BC2A 2ZZIA 2QJSA 4TYTA 3S0ZA 3G1PA 3AF5A 1JT1A 4EXSA 5LCFA 2DKFA 2Y87A 2YNWA 1KR3A 3I11A 2BC2A 2QEDA 1X8HA 4D1TA 5LCAA 4RAWA 1XM8A 4TZ9A 5DPXA 4EFZA 5LSCA 5EHTA 5A23A 2ZNBA 4Z6XA 1WUOA 4NQ4A 5AEBA 2GFJA 5AXOA 1MQOA 2BGAA 5FQBA 4EXYA 4NQ6A 5ACTA 4J5HA
chains in the Genus database with same CATH topology
2YNTB 3X2XA 3FCZA 2BG6A 5HIQA 2BG8B 3BC2A 2FU9A 4ZEJA 3RKKA 3ESHA 3JXPA 4EYLA 4B87A 2Y8BA 5HH4A 3X2YA 5FQCA 3SBLA 1K07A 4UWPB 2BFLA 2WYMA 1YCFA 1A8TA 4UBQA 2NZEA 4AX1B 2BMIA 1BMCA 3I14A 5FQAA 1BVTA 1HLKA 5B1UA 4C1CA 1VGNA 2XR1A 3L6NA 5A5ZA 4ZO3A 4BP0A 2FU7A 5ACWA 5IQKA 3P2UA 2HB9A 5A87A 5EVDA 5AYAA 3I15A 4KEQA 4AX0B 1QH3A 2YZ3A 3FAIA 2YNUA 5LMCA 4V0HA 3PG4A 5LCHA 1ZTCA 2R2DA 3SW3A 4AD9A 5K4NA 4YSKA 3A4YA 3X30A 4EYBA 5A0TA 2E7YA 5ACSA 1JJTA 3DHCA 4XWTA 2P4ZA 4HL1A 4P62A 4Z7RA 2ZWRA 5LLDA 2BIBA 4XUKA 5ACVA 3BK2A 3TP9A 4FSBA 5ACUA 5EVBA 2UYXA 5HISA 3VQZA 5EV6A 3Q6VA 2Q0JA 3IE2A 1KO2A 1DDKA 4DILA 4LE6A 4GCWA 2FU8A 5HH6A 3ZR9A 4C09A 1DD6A 2Q42A 1KO3A 4C1HA 4U4LA 2OHIA 3ZQ4A 1WRAA 3IE0A 1ZKPA 4H0DA 5EWAA 2YCBA 2I7TA 3IOFA 3IEMA 4HKYA 3SRXA 3R2UA 3DH8A 3SPUA 4O98A 3IELA 4CHLA 4Z5YA 2FHXB 3SD9A 1DXKA 5EV8A 4UWSB 4ZNBA 2Y8AA 5ACQA 1SMLA 4C1EA 4HL2A 1YCGA 5HH5A 1WW1A 4KEPA 1WUPA 1L9YA 1ZNBA 2M5CA 5AHOA 4D1VA 4Z5ZA 5B3RA 2FM6A 2BFKA 1XTOA 4PVTA 3DHBA 3PY6A 4DIKA 2M5DA 2NZFA 2BTNA 3AJ3A 4UWRB 3IE1A 5ACXA 4YSBA 5AXRA 2BFZB 2DOOA 4Z67A 2AZ4A 1JJEA 3ZWFA 3BK1A 3MD7A 4EYFA 5K4MA 5LM6A 4BZ3A 2GFKA 2P18A 2NXAA 4RM5A 1Y44A 2QINA 3T3NA 2BG7A 2FU6A 3T9MA 2GCUA 3IOGA 5EVKA 3LVZA 5KILA 3QH8A 3AF6A 3F9OA 3DHAA 3IDZA 2GMNA 4NQ2A 2WYMC 4UA4A 2CBNA 4RBSA 1VJNA 2Q0IA 5B15A 2OHJA 5HIPA 2VW8A 2A7MA 2GKLA 2BR6A 2YNVA 3VPEA 1E5DA 4C1FA 4NQ5A 4TZEA 1X8GA 2I7XA 4TZFA 1VMEA 5ACRA 1P9EA 4RL2A 2AIOA 2ZO4A 4C1DA 3KL7A 3KNRA 4JO0A 4UAMA 4ZO2A 1X8IA 3T3OA 2P97A 5K0WA 2QDSA 2P1EA 4PVOA 2BFZA 5KIKA 3PY5A 4F6ZA 2WHGA 4TYFA 4Z60A 2NYPA 3IEKA 3ZNBA 4D02A 4GYUA 5LS3A 3KNSA 4RAMA 2WRSA 4D1WA 1QH5A 1A7TA 4WD6A 2BG2A 4RL0A 5K4KA 5EH9A 2H6AA 2Q9UA 4FEKA 4F6HA 2FK6A 3H3EA 4GYQA 5EW0A 3X2ZA 3WXCA 4J5FA 5LE1A 4FR7A 3I0VA 2BG8A 4D1UA 4EY2A 3ADRA 3RPCA 5HIOA 4AWYB 5AHRA 3BV6A 4TZBA 2XF4A 5A0VA 1YCHA 5ACPA 2FHXA 2YNTA 3RKJA 2I7VA 4AWZA 4YSLA 4C1GA 4UWOB 4XWWA 1M2XA 2WYLA 2OHHA 2YNVB 3SFPA 3I13A 2QDTA 1BC2A 2ZZIA 2QJSA 4TYTA 3S0ZA 3G1PA 3AF5A 1JT1A 4EXSA 5LCFA 2DKFA 2Y87A 2YNWA 1KR3A 3I11A 2BC2A 2QEDA 1X8HA 4D1TA 5LCAA 4RAWA 1XM8A 4TZ9A 5DPXA 4EFZA 5LSCA 5EHTA 2ZNBA 4Z6XA 1WUOA 4NQ4A 5AEBA 2GFJA 5AXOA 1MQOA 2BGAA 5FQBA 4EXYA 4NQ6A 5ACTA 4J5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YNT B;  3X2X A;  3FCZ A;  2BG6 A;  5HIQ A;  2BG8 B;  3BC2 A;  2FU9 A;  4ZEJ A;  3RKK A;  3ESH A;  3JXP A;  4EYL A;  4B87 A;  2Y8B A;  5HH4 A;  3X2Y A;  5FQC A;  3SBL A;  1K07 A;  4UWP B;  2BFL A;  2WYM A;  1YCF A;  1A8T A;  4UBQ A;  2NZE A;  4AX1 B;  2BMI A;  1BMC A;  3I14 A;  5FQA A;  1BVT A;  1HLK A;  5B1U A;  4C1C A;  1VGN A;  2XR1 A;  3L6N A;  5A5Z A;  4ZO3 A;  4BP0 A;  2FU7 A;  5ACW A;  5IQK A;  3P2U A;  2HB9 A;  5A87 A;  5EVD A;  5AYA A;  3I15 A;  4KEQ A;  4AX0 B;  1QH3 A;  2YZ3 A;  3FAI A;  2YNU A;  5LMC A;  4V0H A;  3PG4 A;  5LCH A;  1ZTC A;  2R2D A;  3SW3 A;  4AD9 A;  5K4N A;  4YSK A;  3A4Y A;  3X30 A;  4EYB A;  5A0T A;  2E7Y A;  5ACS A;  1JJT A;  3DHC A;  4XWT A;  2P4Z A;  4HL1 A;  4P62 A;  4Z7R A;  2ZWR A;  5LLD A;  2BIB A;  4XUK A;  5ACV A;  3BK2 A;  3TP9 A;  4FSB A;  5ACU A;  5EVB A;  2UYX A;  5HIS A;  3VQZ A;  5EV6 A;  3Q6V A;  2Q0J A;  3IE2 A;  1KO2 A;  1DDK A;  4DIL A;  4LE6 A;  4GCW A;  2FU8 A;  5HH6 A;  3ZR9 A;  4C09 A;  1DD6 A;  2Q42 A;  1KO3 A;  4C1H A;  4U4L A;  2OHI A;  3ZQ4 A;  1WRA A;  3IE0 A;  1ZKP A;  4H0D A;  5EWA A;  2YCB A;  2I7T A;  3IOF A;  3IEM A;  4HKY A;  3SRX A;  3R2U A;  3DH8 A;  3SPU A;  4O98 A;  3IEL A;  4CHL A;  4Z5Y A;  2FHX B;  3SD9 A;  1DXK A;  5EV8 A;  4UWS B;  4ZNB A;  2Y8A A;  5ACQ A;  1SML A;  4C1E A;  4HL2 A;  1YCG A;  5HH5 A;  1WW1 A;  4KEP A;  1WUP A;  1L9Y A;  1ZNB A;  2M5C A;  5AHO A;  4D1V A;  4Z5Z A;  5B3R A;  2FM6 A;  2BFK A;  1XTO A;  4PVT A;  3DHB A;  3PY6 A;  4DIK A;  2M5D A;  2NZF A;  2BTN A;  3AJ3 A;  4UWR B;  3IE1 A;  5ACX A;  4YSB A;  5AXR A;  2BFZ B;  2DOO A;  4Z67 A;  2AZ4 A;  1JJE A;  3ZWF A;  3BK1 A;  3MD7 A;  4EYF A;  5K4M A;  5LM6 A;  4BZ3 A;  2GFK A;  2P18 A;  2NXA A;  4RM5 A;  1Y44 A;  2QIN A;  3T3N A;  2BG7 A;  2FU6 A;  3T9M A;  2GCU A;  3IOG A;  5EVK A;  3LVZ A;  5KIL A;  3QH8 A;  3AF6 A;  3F9O A;  3DHA A;  3IDZ A;  2GMN A;  4NQ2 A;  2WYM C;  4UA4 A;  2CBN A;  4RBS A;  1VJN A;  2Q0I A;  5B15 A;  2OHJ A;  5HIP A;  2VW8 A;  2A7M A;  2GKL A;  2BR6 A;  2YNV A;  3VPE A;  1E5D A;  4C1F A;  4NQ5 A;  4TZE A;  1X8G A;  2I7X A;  4TZF A;  1VME A;  5ACR A;  1P9E A;  4RL2 A;  2AIO A;  2ZO4 A;  4C1D A;  3KL7 A;  3KNR A;  4JO0 A;  4UAM A;  4ZO2 A;  1X8I A;  3T3O A;  2P97 A;  5K0W A;  2QDS A;  2P1E A;  4PVO A;  2BFZ A;  5KIK A;  3PY5 A;  4F6Z A;  2WHG A;  4TYF A;  4Z60 A;  2NYP A;  3IEK A;  3ZNB A;  4D02 A;  4GYU A;  5LS3 A;  3KNS A;  4RAM A;  2WRS A;  4D1W A;  1QH5 A;  1A7T A;  4WD6 A;  2BG2 A;  4RL0 A;  5K4K A;  5EH9 A;  2H6A A;  2Q9U A;  4FEK A;  4F6H A;  2FK6 A;  3H3E A;  4GYQ A;  5EW0 A;  3X2Z A;  3WXC A;  4J5F A;  5LE1 A;  4FR7 A;  3I0V A;  2BG8 A;  4D1U A;  4EY2 A;  3ADR A;  3RPC A;  5HIO A;  4AWY B;  5AHR A;  3BV6 A;  4TZB A;  2XF4 A;  5A0V A;  1YCH A;  5ACP A;  2FHX A;  2YNT A;  3RKJ A;  2I7V A;  4AWZ A;  4YSL A;  4C1G A;  4UWO B;  4XWW A;  1M2X A;  2WYL A;  2OHH A;  2YNV B;  3SFP A;  3I13 A;  2QDT A;  1BC2 A;  2ZZI A;  2QJS A;  4TYT A;  3S0Z A;  3G1P A;  3AF5 A;  1JT1 A;  4EXS A;  5LCF A;  2DKF A;  2Y87 A;  2YNW A;  1KR3 A;  3I11 A;  2BC2 A;  2QED A;  1X8H A;  4D1T A;  5LCA A;  4RAW A;  1XM8 A;  4TZ9 A;  5DPX A;  4EFZ A;  5LSC A;  5EHT A;  2ZNB A;  4Z6X A;  1WUO A;  4NQ4 A;  5AEB A;  2GFJ A;  5AXO A;  1MQO A;  2BGA A;  5FQB A;  4EXY A;  4NQ6 A;  5ACT A;  4J5H A; 
#chains in the Genus database with same CATH topology
 2YNT B;  3X2X A;  3FCZ A;  2BG6 A;  5HIQ A;  2BG8 B;  3BC2 A;  2FU9 A;  4ZEJ A;  3RKK A;  3ESH A;  3JXP A;  4EYL A;  4B87 A;  2Y8B A;  5HH4 A;  3X2Y A;  5FQC A;  3SBL A;  1K07 A;  4UWP B;  4AXH A;  2BFL A;  2WYM A;  1YCF A;  1A8T A;  4UBQ A;  2NZE A;  4AX1 B;  2BMI A;  1BMC A;  3I14 A;  5FQA A;  1BVT A;  1HLK A;  5B1U A;  4C1C A;  1VGN A;  2XR1 A;  3L6N A;  5A5Z A;  4ZO3 A;  4BP0 A;  2FU7 A;  5ACW A;  5IQK A;  3P2U A;  2HB9 A;  5A87 A;  5EVD A;  5AYA A;  3I15 A;  4KEQ A;  4AX0 B;  1QH3 A;  2YZ3 A;  3FAI A;  2YNU A;  5LMC A;  4V0H A;  3PG4 A;  2CG2 A;  5LCH A;  1ZTC A;  2R2D A;  3SW3 A;  4AD9 A;  5K4N A;  4YSK A;  2CFU A;  3A4Y A;  3X30 A;  4EYB A;  5A0T A;  2E7Y A;  5ACS A;  1JJT A;  3DHC A;  4XWT A;  2P4Z A;  4HL1 A;  4P62 A;  4Z7R A;  2ZWR A;  5LLD A;  2BIB A;  4XUK A;  5ACV A;  3BK2 A;  3TP9 A;  4FSB A;  5ACU A;  5EVB A;  2UYX A;  5HIS A;  3VQZ A;  5EV6 A;  3Q6V A;  2Q0J A;  3IE2 A;  1KO2 A;  1DDK A;  4DIL A;  4LE6 A;  4GCW A;  2FU8 A;  5HH6 A;  3ZR9 A;  4C09 A;  1DD6 A;  2Q42 A;  1KO3 A;  4C1H A;  4U4L A;  2CG3 A;  2OHI A;  3ZQ4 A;  1WRA A;  3IE0 A;  1ZKP A;  4H0D A;  5EWA A;  2YCB A;  2I7T A;  3IOF A;  3IEM A;  4HKY A;  3SRX A;  3R2U A;  3DH8 A;  3SPU A;  4O98 A;  3IEL A;  4CHL A;  4Z5Y A;  2FHX B;  3SD9 A;  1DXK A;  5EV8 A;  4UWS B;  4ZNB A;  2Y8A A;  5ACQ A;  1SML A;  4C1E A;  4HL2 A;  1YCG A;  5HH5 A;  1WW1 A;  4KEP A;  1WUP A;  1L9Y A;  1ZNB A;  2M5C A;  5AHO A;  4D1V A;  4Z5Z A;  5B3R A;  2FM6 A;  2BFK A;  1XTO A;  4PVT A;  3DHB A;  3PY6 A;  4DIK A;  2M5D A;  2NZF A;  2BTN A;  3AJ3 A;  4UWR B;  3IE1 A;  5ACX A;  4YSB A;  5AXR A;  2BFZ B;  2DOO A;  4Z67 A;  2AZ4 A;  1JJE A;  3ZWF A;  3BK1 A;  3MD7 A;  4EYF A;  5K4M A;  5LM6 A;  4BZ3 A;  2YHE A;  2GFK A;  2P18 A;  2NXA A;  4RM5 A;  1Y44 A;  2QIN A;  4NUR A;  3T3N A;  2BG7 A;  2FU6 A;  3T9M A;  2GCU A;  3IOG A;  5EVK A;  3LVZ A;  5KIL A;  3QH8 A;  5AJL A;  3AF6 A;  3F9O A;  3DHA A;  3IDZ A;  2GMN A;  4NQ2 A;  2WYM C;  4UA4 A;  2CBN A;  4RBS A;  1VJN A;  4PDX A;  2Q0I A;  5B15 A;  2OHJ A;  5HIP A;  2VW8 A;  2A7M A;  2GKL A;  2BR6 A;  2YNV A;  3VPE A;  1E5D A;  4C1F A;  4NQ5 A;  4TZE A;  1X8G A;  2I7X A;  4TZF A;  1VME A;  5ACR A;  1P9E A;  4RL2 A;  2AIO A;  2ZO4 A;  4C1D A;  3KL7 A;  3KNR A;  4JO0 A;  4UAM A;  2CFZ A;  4ZO2 A;  1X8I A;  3T3O A;  2P97 A;  5K0W A;  2QDS A;  2P1E A;  4PVO A;  2BFZ A;  5KIK A;  3PY5 A;  4F6Z A;  2WHG A;  4TYF A;  4Z60 A;  2NYP A;  3IEK A;  3ZNB A;  4D02 A;  4GYU A;  5LS3 A;  3KNS A;  4RAM A;  2WRS A;  4D1W A;  1QH5 A;  5AIJ A;  1A7T A;  4WD6 A;  2BG2 A;  4AV7 A;  4RL0 A;  5K4K A;  5EH9 A;  2H6A A;  2Q9U A;  4FEK A;  4F6H A;  2FK6 A;  3H3E A;  4GYQ A;  5EW0 A;  3X2Z A;  3WXC A;  4J5F A;  5LE1 A;  4FR7 A;  3I0V A;  2BG8 A;  4D1U A;  4EY2 A;  3ADR A;  3RPC A;  5HIO A;  4AWY B;  5AHR A;  3BV6 A;  4TZB A;  2XF4 A;  5A0V A;  1YCH A;  5ACP A;  2FHX A;  2YNT A;  3RKJ A;  2I7V A;  4AWZ A;  4YSL A;  4C1G A;  4UWO B;  4XWW A;  1M2X A;  2WYL A;  2OHH A;  2YNV B;  3SFP A;  3I13 A;  2QDT A;  1BC2 A;  2ZZI A;  2QJS A;  4TYT A;  3S0Z A;  3G1P A;  3AF5 A;  1JT1 A;  4EXS A;  5LCF A;  2DKF A;  2Y87 A;  2YNW A;  1KR3 A;  3I11 A;  2BC2 A;  2QED A;  1X8H A;  4D1T A;  5LCA A;  4RAW A;  1XM8 A;  4TZ9 A;  5DPX A;  4EFZ A;  5LSC A;  5EHT A;  5A23 A;  2ZNB A;  4Z6X A;  1WUO A;  4NQ4 A;  5AEB A;  2GFJ A;  5AXO A;  1MQO A;  2BGA A;  5FQB A;  4EXY A;  4NQ6 A;  5ACT A;  4J5H A; 
#chains in the Genus database with same CATH homology
 2YNT B;  3X2X A;  3FCZ A;  2BG6 A;  5HIQ A;  2BG8 B;  3BC2 A;  2FU9 A;  4ZEJ A;  3RKK A;  3ESH A;  3JXP A;  4EYL A;  4B87 A;  2Y8B A;  5HH4 A;  3X2Y A;  5FQC A;  3SBL A;  1K07 A;  4UWP B;  2BFL A;  2WYM A;  1YCF A;  1A8T A;  4UBQ A;  2NZE A;  4AX1 B;  2BMI A;  1BMC A;  3I14 A;  5FQA A;  1BVT A;  1HLK A;  5B1U A;  4C1C A;  1VGN A;  2XR1 A;  3L6N A;  5A5Z A;  4ZO3 A;  4BP0 A;  2FU7 A;  5ACW A;  5IQK A;  3P2U A;  2HB9 A;  5A87 A;  5EVD A;  5AYA A;  3I15 A;  4KEQ A;  4AX0 B;  1QH3 A;  2YZ3 A;  3FAI A;  2YNU A;  5LMC A;  4V0H A;  3PG4 A;  5LCH A;  1ZTC A;  2R2D A;  3SW3 A;  4AD9 A;  5K4N A;  4YSK A;  3A4Y A;  3X30 A;  4EYB A;  5A0T A;  2E7Y A;  5ACS A;  1JJT A;  3DHC A;  4XWT A;  2P4Z A;  4HL1 A;  4P62 A;  4Z7R A;  2ZWR A;  5LLD A;  2BIB A;  4XUK A;  5ACV A;  3BK2 A;  3TP9 A;  4FSB A;  5ACU A;  5EVB A;  2UYX A;  5HIS A;  3VQZ A;  5EV6 A;  3Q6V A;  2Q0J A;  3IE2 A;  1KO2 A;  1DDK A;  4DIL A;  4LE6 A;  4GCW A;  2FU8 A;  5HH6 A;  3ZR9 A;  4C09 A;  1DD6 A;  2Q42 A;  1KO3 A;  4C1H A;  4U4L A;  2OHI A;  3ZQ4 A;  1WRA A;  3IE0 A;  1ZKP A;  4H0D A;  5EWA A;  2YCB A;  2I7T A;  3IOF A;  3IEM A;  4HKY A;  3SRX A;  3R2U A;  3DH8 A;  3SPU A;  4O98 A;  3IEL A;  4CHL A;  4Z5Y A;  2FHX B;  3SD9 A;  1DXK A;  5EV8 A;  4UWS B;  4ZNB A;  2Y8A A;  5ACQ A;  1SML A;  4C1E A;  4HL2 A;  1YCG A;  5HH5 A;  1WW1 A;  4KEP A;  1WUP A;  1L9Y A;  1ZNB A;  2M5C A;  5AHO A;  4D1V A;  4Z5Z A;  5B3R A;  2FM6 A;  2BFK A;  1XTO A;  4PVT A;  3DHB A;  3PY6 A;  4DIK A;  2M5D A;  2NZF A;  2BTN A;  3AJ3 A;  4UWR B;  3IE1 A;  5ACX A;  4YSB A;  5AXR A;  2BFZ B;  2DOO A;  4Z67 A;  2AZ4 A;  1JJE A;  3ZWF A;  3BK1 A;  3MD7 A;  4EYF A;  5K4M A;  5LM6 A;  4BZ3 A;  2GFK A;  2P18 A;  2NXA A;  4RM5 A;  1Y44 A;  2QIN A;  3T3N A;  2BG7 A;  2FU6 A;  3T9M A;  2GCU A;  3IOG A;  5EVK A;  3LVZ A;  5KIL A;  3QH8 A;  3AF6 A;  3F9O A;  3DHA A;  3IDZ A;  2GMN A;  4NQ2 A;  2WYM C;  4UA4 A;  2CBN A;  4RBS A;  1VJN A;  2Q0I A;  5B15 A;  2OHJ A;  5HIP A;  2VW8 A;  2A7M A;  2GKL A;  2BR6 A;  2YNV A;  3VPE A;  1E5D A;  4C1F A;  4NQ5 A;  4TZE A;  1X8G A;  2I7X A;  4TZF A;  1VME A;  5ACR A;  1P9E A;  4RL2 A;  2AIO A;  2ZO4 A;  4C1D A;  3KL7 A;  3KNR A;  4JO0 A;  4UAM A;  4ZO2 A;  1X8I A;  3T3O A;  2P97 A;  5K0W A;  2QDS A;  2P1E A;  4PVO A;  2BFZ A;  5KIK A;  3PY5 A;  4F6Z A;  2WHG A;  4TYF A;  4Z60 A;  2NYP A;  3IEK A;  3ZNB A;  4D02 A;  4GYU A;  5LS3 A;  3KNS A;  4RAM A;  2WRS A;  4D1W A;  1QH5 A;  1A7T A;  4WD6 A;  2BG2 A;  4RL0 A;  5K4K A;  5EH9 A;  2H6A A;  2Q9U A;  4FEK A;  4F6H A;  2FK6 A;  3H3E A;  4GYQ A;  5EW0 A;  3X2Z A;  3WXC A;  4J5F A;  5LE1 A;  4FR7 A;  3I0V A;  2BG8 A;  4D1U A;  4EY2 A;  3ADR A;  3RPC A;  5HIO A;  4AWY B;  5AHR A;  3BV6 A;  4TZB A;  2XF4 A;  5A0V A;  1YCH A;  5ACP A;  2FHX A;  2YNT A;  3RKJ A;  2I7V A;  4AWZ A;  4YSL A;  4C1G A;  4UWO B;  4XWW A;  1M2X A;  2WYL A;  2OHH A;  2YNV B;  3SFP A;  3I13 A;  2QDT A;  1BC2 A;  2ZZI A;  2QJS A;  4TYT A;  3S0Z A;  3G1P A;  3AF5 A;  1JT1 A;  4EXS A;  5LCF A;  2DKF A;  2Y87 A;  2YNW A;  1KR3 A;  3I11 A;  2BC2 A;  2QED A;  1X8H A;  4D1T A;  5LCA A;  4RAW A;  1XM8 A;  4TZ9 A;  5DPX A;  4EFZ A;  5LSC A;  5EHT A;  2ZNB A;  4Z6X A;  1WUO A;  4NQ4 A;  5AEB A;  2GFJ A;  5AXO A;  1MQO A;  2BGA A;  5FQB A;  4EXY A;  4NQ6 A;  5ACT A;  4J5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...