4ZO2A

Aidc, a dizinc quorum-quenching lactonase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
293
structure length
293
Chain Sequence
DLSGFKKIKLGELELFILTDGYIHEENLISFAPRGNVAELKTILKDNFRADHYIDMAINILLVKTKEKLILMDTGMGIFADERTGFLLKSLQKAGFSAHDITDIFLSHAHPDHIGGVVDKQNKLVFPNASIFISKIEHDFWINASIKDFNNSALKAHPERLNQIIPALQNILKAIQPKLKFYDLNKTLYSHFNFQLAPGHTPGLTVTTISSGNEKLMYVADLIHSDVILFPHPDWGFSGDTDLDIATASRKKFLKQLADTKARAFTSHLPWPGLGFTKVKAPGFEWIPESFMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acylhomoserine lactonase
publication title Structural and Biochemical Characterization of AidC, a Quorum-Quenching Lactonase with Atypical Selectivity.
pubmed doi rcsb
source organism Chryseobacterium sp. strb126
molecule tags Hydrolase
total genus 87
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4zo2A00
4EYLA 4AWZA 4Z6XA 2BG8B 4Z67A 2I7VA 5LS3A 5K4NA 4RL2A 4RAMA 1YCGA 1KO2A 4GCWA 3ESHA 3SRXA 2P4ZA 4AD9A 5EWAA 3I11A 2A7MA 2I7TA 2YNVB 1WRAA 3X2YA 2OHJA 3F9OA 2ZWRA 3X30A 4TZBA 5HISA 2ZZIA 2BFZA 1DD6A 5FQCA 3IE0A 4P62A 1X8IA 3ZR9A 3G1PA 4EXYA 5LE1A 2Y8BA 4EY2A 5EHTA 3Q6VA 4EYFA 2Q0IA 3RKKA 1XM8A 1VGNA 3ZQ4A 4PVOA 5AEBA 4V0HA 4ZO3A 2BFZB 2QDTA 2WRSA 3I14A 1DXKA 4DIKA 2GCUA 2ZNBA 3H3EA 4WD6A 2FU7A 4B87A 3IE1A 1A8TA 5AYAA 4HL1A 5AXRA 2FHXA 3BK1A 3T9MA 4NQ4A 1JJTA 4KEQA 1JT1A 3IOFA 5LCHA 4CHLA 3IOGA 5FQAA 5LCFA 3MD7A 3X2XA 5LCAA 2BG7A 1DDKA 1BVTA 1YCFA 4F6ZA 1P9EA 1M2XA 5A0VA 3SBLA 4C1GA 4C1CA 1X8GA 3JXPA 4HL2A 5LSCA 5KILA 3SFPA 4NQ2A 4XWTA 4YSLA 4U4LA 3KNRA 3IDZA 2FU9A 4H0DA 4UWPB 4NQ5A 5HIOA 2H6AA 2QINA 2GKLA 2NYPA 1YCHA 4XUKA 4UWSB 2QJSA 5ACXA 1A7TA 3RKJA 4D1TA 4C1HA 5K4MA 2QDSA 4C1EA 4GYUA 2OHIA 5LLDA 3FAIA 3PY6A 5B15A 3SW3A 4RL0A 3AF5A 5EH9A 5LM6A 1QH5A 5ACWA 3VQZA 4NQ6A 4Z5ZA 3KNSA 3LVZA 4EFZA 3DH8A 5B3RA 2VW8A 3AJ3A 2BTNA 4F6HA 4UWRB 2DOOA 4TZFA 3VPEA 4ZEJA 2GFKA 2YZ3A 1SMLA 5ACSA 2BFLA 2HB9A 2OHHA 2XF4A 4FSBA 4UA4A 2UYXA 4O98A 1E5DA 5AXOA 1MQOA 5ACVA 1K07A 5ACPA 3DHCA 5A5ZA 4UAMA 2Y87A 5A0TA 2Q42A 3IEKA 2M5DA 2ZO4A 3I0VA 4UBQA 4J5FA 1BC2A 2I7XA 2WYLA 3ADRA 4EYBA 3T3OA 2GMNA 3PG4A 3I15A 2YCBA 2NZFA 3T3NA 3I13A 4LE6A 4D02A 2FHXB 4D1WA 3AF6A 5EVKA 4FEKA 3S0ZA 3IELA 2GFJA 4AX1B 5EW0A 4XWWA 3P2UA 1QH3A 4FR7A 1VJNA 1ZTCA 3DHBA 4KEPA 4AWYB 4J5HA 2BG2A 4RBSA 5HH5A 1WW1A 2BMIA 4ZO2A 5ACQA 3QH8A 3TP9A 1WUOA 1ZKPA 2NXAA 2AIOA 4RM5A 5AHRA 5ACTA 1KO3A 2E7YA 4D1VA 3A4YA 2NZEA 3L6NA 5EV8A 2YNUA 4EXSA 2FU8A 2FM6A 2YNVA 2BG6A 4JO0A 1X8HA 4YSBA 3BK2A 1L9YA 4ZNBA 5B1UA 2BGAA 2WYMA 5FQBA 5HIPA 5KIKA 2R2DA 5LMCA 5ACUA 4GYQA 1WUPA 2P1EA 2AZ4A 3X2ZA 3R2UA 1BMCA 4BP0A 5A87A 3WXCA 2WYMC 5K4KA 2BR6A 1JJEA 2FK6A 2P18A 4TYFA 2P97A 4TYTA 2CBNA 1Y44A 4AX0B 5AHOA 2WHGA 3SD9A 3FCZA 5EV6A 4TZEA 4Z7RA 1XTOA 4C1FA 2Q9UA 1KR3A 1VMEA 3PY5A 4D1UA 5IQKA 4Z5YA 2Y8AA 3ZNBA 2YNWA 5EVDA 1ZNBA 2M5CA 2Q0JA 2FU6A 2BIBA 4C09A 3SPUA 2QEDA 3IE2A 4TZ9A 4UWOB 4HKYA 5HH6A 3IEMA 3KL7A 3BC2A 4PVTA 5DPXA 3DHAA 5HH4A 3ZWFA 3RPCA 2YNTA 2BFKA 2BC2A 1HLKA 2BG8A 3BV6A 5ACRA 4RAWA 4YSKA 4C1DA 4Z60A 5EVBA 5HIQA 2XR1A 4DILA 2YNTB 2DKFA 5K0WA 4BZ3A
chains in the Genus database with same CATH superfamily
4EYLA 4AWZA 4Z6XA 2BG8B 4Z67A 2I7VA 5LS3A 5K4NA 4RL2A 4RAMA 1YCGA 1KO2A 4GCWA 3ESHA 3SRXA 2P4ZA 4AD9A 5EWAA 3I11A 2A7MA 2I7TA 2YNVB 1WRAA 3X2YA 2OHJA 3F9OA 2ZWRA 3X30A 2YHEA 4TZBA 5HISA 2ZZIA 2BFZA 1DD6A 5FQCA 3IE0A 4P62A 1X8IA 3ZR9A 3G1PA 4EXYA 5LE1A 2Y8BA 4EY2A 5EHTA 3Q6VA 4EYFA 2Q0IA 3RKKA 4AV7A 1XM8A 1VGNA 3ZQ4A 4PVOA 5AEBA 4V0HA 4ZO3A 2BFZB 2QDTA 2WRSA 3I14A 1DXKA 4DIKA 2GCUA 2ZNBA 3H3EA 4WD6A 2FU7A 4B87A 3IE1A 1A8TA 5AYAA 4HL1A 5AXRA 2FHXA 3BK1A 3T9MA 4NQ4A 1JJTA 4KEQA 1JT1A 3IOFA 5AIJA 5LCHA 4CHLA 3IOGA 5FQAA 5LCFA 3MD7A 3X2XA 5LCAA 2BG7A 1DDKA 1BVTA 1YCFA 4F6ZA 1P9EA 1M2XA 5A0VA 3SBLA 4C1GA 4C1CA 1X8GA 3JXPA 4HL2A 5LSCA 5KILA 3SFPA 4NQ2A 4XWTA 4YSLA 4U4LA 3KNRA 3IDZA 2FU9A 4H0DA 4UWPB 4NQ5A 5HIOA 2H6AA 2QINA 2GKLA 2NYPA 1YCHA 4XUKA 4UWSB 2QJSA 5ACXA 1A7TA 3RKJA 4D1TA 4C1HA 5K4MA 4NURA 4AXHA 2QDSA 4C1EA 4GYUA 2OHIA 5LLDA 3FAIA 3PY6A 5B15A 2CG3A 3SW3A 4RL0A 3AF5A 5EH9A 5LM6A 1QH5A 5ACWA 3VQZA 4NQ6A 5A23A 4Z5ZA 3KNSA 3LVZA 3DH8A 5B3RA 4EFZA 2VW8A 3AJ3A 2BTNA 4F6HA 4UWRB 2DOOA 4TZFA 3VPEA 4ZEJA 2GFKA 2YZ3A 1SMLA 5ACSA 2BFLA 2HB9A 2OHHA 2XF4A 4FSBA 4UA4A 2UYXA 4O98A 1E5DA 5AXOA 1MQOA 5ACVA 1K07A 5ACPA 3DHCA 5A5ZA 4UAMA 2Y87A 5A0TA 2Q42A 3IEKA 2M5DA 2ZO4A 3I0VA 4UBQA 4J5FA 1BC2A 2I7XA 2WYLA 2CG2A 3ADRA 4EYBA 3T3OA 2GMNA 3PG4A 3I15A 2YCBA 2NZFA 3T3NA 3I13A 4LE6A 4D02A 2FHXB 4D1WA 3AF6A 5EVKA 4FEKA 3S0ZA 3IELA 2GFJA 4AX1B 5EW0A 4XWWA 3P2UA 1QH3A 4FR7A 1VJNA 1ZTCA 3DHBA 4KEPA 4AWYB 4J5HA 2BG2A 4RBSA 5HH5A 1WW1A 2BMIA 4ZO2A 5ACQA 3QH8A 3TP9A 1WUOA 1ZKPA 2NXAA 2AIOA 4RM5A 5AHRA 5ACTA 1KO3A 2E7YA 4D1VA 3A4YA 2NZEA 3L6NA 5EV8A 2YNUA 4EXSA 2FU8A 2FM6A 2YNVA 2BG6A 4JO0A 1X8HA 4YSBA 3BK2A 1L9YA 4ZNBA 5B1UA 2BGAA 2WYMA 5FQBA 5HIPA 5KIKA 2R2DA 5LMCA 5ACUA 4GYQA 1WUPA 2P1EA 2AZ4A 3X2ZA 3R2UA 1BMCA 4BP0A 5A87A 3WXCA 2WYMC 5K4KA 2BR6A 1JJEA 2FK6A 2P18A 4TYFA 2CFUA 2P97A 4TYTA 2CBNA 1Y44A 4AX0B 5AHOA 2WHGA 3SD9A 3FCZA 5EV6A 4TZEA 4Z7RA 1XTOA 4C1FA 2Q9UA 1KR3A 1VMEA 3PY5A 4D1UA 5IQKA 4Z5YA 2Y8AA 5AJLA 3ZNBA 2YNWA 5EVDA 1ZNBA 2M5CA 2Q0JA 2FU6A 2BIBA 4C09A 3SPUA 2QEDA 3IE2A 4TZ9A 4UWOB 4HKYA 5HH6A 3IEMA 3KL7A 3BC2A 4PVTA 5DPXA 3DHAA 5HH4A 2CFZA 3ZWFA 3RPCA 2YNTA 2BFKA 2BC2A 1HLKA 2BG8A 3BV6A 5ACRA 4RAWA 4YSKA 4C1DA 4Z60A 5EVBA 5HIQA 2XR1A 4PDXA 4DILA 2YNTB 2DKFA 5K0WA 4BZ3A
chains in the Genus database with same CATH topology
4EYLA 4AWZA 4Z6XA 2BG8B 4Z67A 2I7VA 5LS3A 5K4NA 4RL2A 4RAMA 1YCGA 1KO2A 4GCWA 3ESHA 3SRXA 2P4ZA 4AD9A 5EWAA 3I11A 2A7MA 2I7TA 2YNVB 1WRAA 3X2YA 2OHJA 3F9OA 2ZWRA 3X30A 4TZBA 5HISA 2ZZIA 2BFZA 1DD6A 5FQCA 3IE0A 4P62A 1X8IA 3ZR9A 3G1PA 4EXYA 5LE1A 2Y8BA 4EY2A 5EHTA 3Q6VA 4EYFA 2Q0IA 3RKKA 1XM8A 1VGNA 3ZQ4A 4PVOA 5AEBA 4V0HA 4ZO3A 2BFZB 2QDTA 2WRSA 3I14A 1DXKA 4DIKA 2GCUA 2ZNBA 3H3EA 4WD6A 2FU7A 4B87A 3IE1A 1A8TA 5AYAA 4HL1A 5AXRA 2FHXA 3BK1A 3T9MA 4NQ4A 1JJTA 4KEQA 1JT1A 3IOFA 5LCHA 4CHLA 3IOGA 5FQAA 5LCFA 3MD7A 3X2XA 5LCAA 2BG7A 1DDKA 1BVTA 1YCFA 4F6ZA 1P9EA 1M2XA 5A0VA 3SBLA 4C1GA 4C1CA 1X8GA 3JXPA 4HL2A 5LSCA 5KILA 3SFPA 4NQ2A 4XWTA 4YSLA 4U4LA 3KNRA 3IDZA 2FU9A 4H0DA 4UWPB 4NQ5A 5HIOA 2H6AA 2QINA 2GKLA 2NYPA 1YCHA 4XUKA 4UWSB 2QJSA 5ACXA 1A7TA 3RKJA 4D1TA 4C1HA 5K4MA 2QDSA 4C1EA 4GYUA 2OHIA 5LLDA 3FAIA 3PY6A 5B15A 3SW3A 4RL0A 3AF5A 5EH9A 5LM6A 1QH5A 5ACWA 3VQZA 4NQ6A 4Z5ZA 3KNSA 3LVZA 4EFZA 3DH8A 5B3RA 2VW8A 3AJ3A 2BTNA 4F6HA 4UWRB 2DOOA 4TZFA 3VPEA 4ZEJA 2GFKA 2YZ3A 1SMLA 5ACSA 2BFLA 2HB9A 2OHHA 2XF4A 4FSBA 4UA4A 2UYXA 4O98A 1E5DA 5AXOA 1MQOA 5ACVA 1K07A 5ACPA 3DHCA 5A5ZA 4UAMA 2Y87A 5A0TA 2Q42A 3IEKA 2M5DA 2ZO4A 3I0VA 4UBQA 4J5FA 1BC2A 2I7XA 2WYLA 3ADRA 4EYBA 3T3OA 2GMNA 3PG4A 3I15A 2YCBA 2NZFA 3T3NA 3I13A 4LE6A 4D02A 2FHXB 4D1WA 3AF6A 5EVKA 4FEKA 3S0ZA 3IELA 2GFJA 4AX1B 5EW0A 4XWWA 3P2UA 1QH3A 4FR7A 1VJNA 1ZTCA 3DHBA 4KEPA 4AWYB 4J5HA 2BG2A 4RBSA 5HH5A 1WW1A 2BMIA 4ZO2A 5ACQA 3QH8A 3TP9A 1WUOA 1ZKPA 2NXAA 2AIOA 4RM5A 5AHRA 5ACTA 1KO3A 2E7YA 4D1VA 3A4YA 2NZEA 3L6NA 5EV8A 2YNUA 4EXSA 2FU8A 2FM6A 2YNVA 2BG6A 4JO0A 1X8HA 4YSBA 3BK2A 1L9YA 4ZNBA 5B1UA 2BGAA 2WYMA 5FQBA 5HIPA 5KIKA 2R2DA 5LMCA 5ACUA 4GYQA 1WUPA 2P1EA 2AZ4A 3X2ZA 3R2UA 1BMCA 4BP0A 5A87A 3WXCA 2WYMC 5K4KA 2BR6A 1JJEA 2FK6A 2P18A 4TYFA 2P97A 4TYTA 2CBNA 1Y44A 4AX0B 5AHOA 2WHGA 3SD9A 3FCZA 5EV6A 4TZEA 4Z7RA 1XTOA 4C1FA 2Q9UA 1KR3A 1VMEA 3PY5A 4D1UA 5IQKA 4Z5YA 2Y8AA 3ZNBA 2YNWA 5EVDA 1ZNBA 2M5CA 2Q0JA 2FU6A 2BIBA 4C09A 3SPUA 2QEDA 3IE2A 4TZ9A 4UWOB 4HKYA 5HH6A 3IEMA 3KL7A 3BC2A 4PVTA 5DPXA 3DHAA 5HH4A 3ZWFA 3RPCA 2YNTA 2BFKA 2BC2A 1HLKA 2BG8A 3BV6A 5ACRA 4RAWA 4YSKA 4C1DA 4Z60A 5EVBA 5HIQA 2XR1A 4DILA 2YNTB 2DKFA 5K0WA 4BZ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EYL A;  4AWZ A;  4Z6X A;  2BG8 B;  4Z67 A;  2I7V A;  5LS3 A;  5K4N A;  4RL2 A;  4RAM A;  1YCG A;  1KO2 A;  4GCW A;  3ESH A;  3SRX A;  2P4Z A;  4AD9 A;  5EWA A;  3I11 A;  2A7M A;  2I7T A;  2YNV B;  1WRA A;  3X2Y A;  2OHJ A;  3F9O A;  2ZWR A;  3X30 A;  4TZB A;  5HIS A;  2ZZI A;  2BFZ A;  1DD6 A;  5FQC A;  3IE0 A;  4P62 A;  1X8I A;  3ZR9 A;  3G1P A;  4EXY A;  5LE1 A;  2Y8B A;  4EY2 A;  5EHT A;  3Q6V A;  4EYF A;  2Q0I A;  3RKK A;  1XM8 A;  1VGN A;  3ZQ4 A;  4PVO A;  5AEB A;  4V0H A;  4ZO3 A;  2BFZ B;  2QDT A;  2WRS A;  3I14 A;  1DXK A;  4DIK A;  2GCU A;  2ZNB A;  3H3E A;  4WD6 A;  2FU7 A;  4B87 A;  3IE1 A;  1A8T A;  5AYA A;  4HL1 A;  5AXR A;  2FHX A;  3BK1 A;  3T9M A;  4NQ4 A;  1JJT A;  4KEQ A;  1JT1 A;  3IOF A;  5LCH A;  4CHL A;  3IOG A;  5FQA A;  5LCF A;  3MD7 A;  3X2X A;  5LCA A;  2BG7 A;  1DDK A;  1BVT A;  1YCF A;  4F6Z A;  1P9E A;  1M2X A;  5A0V A;  3SBL A;  4C1G A;  4C1C A;  1X8G A;  3JXP A;  4HL2 A;  5LSC A;  5KIL A;  3SFP A;  4NQ2 A;  4XWT A;  4YSL A;  4U4L A;  3KNR A;  3IDZ A;  2FU9 A;  4H0D A;  4UWP B;  4NQ5 A;  5HIO A;  2H6A A;  2QIN A;  2GKL A;  2NYP A;  1YCH A;  4XUK A;  4UWS B;  2QJS A;  5ACX A;  1A7T A;  3RKJ A;  4D1T A;  4C1H A;  5K4M A;  2QDS A;  4C1E A;  4GYU A;  2OHI A;  5LLD A;  3FAI A;  3PY6 A;  5B15 A;  3SW3 A;  4RL0 A;  3AF5 A;  5EH9 A;  5LM6 A;  1QH5 A;  5ACW A;  3VQZ A;  4NQ6 A;  4Z5Z A;  3KNS A;  3LVZ A;  4EFZ A;  3DH8 A;  5B3R A;  2VW8 A;  3AJ3 A;  2BTN A;  4F6H A;  4UWR B;  2DOO A;  4TZF A;  3VPE A;  4ZEJ A;  2GFK A;  2YZ3 A;  1SML A;  5ACS A;  2BFL A;  2HB9 A;  2OHH A;  2XF4 A;  4FSB A;  4UA4 A;  2UYX A;  4O98 A;  1E5D A;  5AXO A;  1MQO A;  5ACV A;  1K07 A;  5ACP A;  3DHC A;  5A5Z A;  4UAM A;  2Y87 A;  5A0T A;  2Q42 A;  3IEK A;  2M5D A;  2ZO4 A;  3I0V A;  4UBQ A;  4J5F A;  1BC2 A;  2I7X A;  2WYL A;  3ADR A;  4EYB A;  3T3O A;  2GMN A;  3PG4 A;  3I15 A;  2YCB A;  2NZF A;  3T3N A;  3I13 A;  4LE6 A;  4D02 A;  2FHX B;  4D1W A;  3AF6 A;  5EVK A;  4FEK A;  3S0Z A;  3IEL A;  2GFJ A;  4AX1 B;  5EW0 A;  4XWW A;  3P2U A;  1QH3 A;  4FR7 A;  1VJN A;  1ZTC A;  3DHB A;  4KEP A;  4AWY B;  4J5H A;  2BG2 A;  4RBS A;  5HH5 A;  1WW1 A;  2BMI A;  4ZO2 A;  5ACQ A;  3QH8 A;  3TP9 A;  1WUO A;  1ZKP A;  2NXA A;  2AIO A;  4RM5 A;  5AHR A;  5ACT A;  1KO3 A;  2E7Y A;  4D1V A;  3A4Y A;  2NZE A;  3L6N A;  5EV8 A;  2YNU A;  4EXS A;  2FU8 A;  2FM6 A;  2YNV A;  2BG6 A;  4JO0 A;  1X8H A;  4YSB A;  3BK2 A;  1L9Y A;  4ZNB A;  5B1U A;  2BGA A;  2WYM A;  5FQB A;  5HIP A;  5KIK A;  2R2D A;  5LMC A;  5ACU A;  4GYQ A;  1WUP A;  2P1E A;  2AZ4 A;  3X2Z A;  3R2U A;  1BMC A;  4BP0 A;  5A87 A;  3WXC A;  2WYM C;  5K4K A;  2BR6 A;  1JJE A;  2FK6 A;  2P18 A;  4TYF A;  2P97 A;  4TYT A;  2CBN A;  1Y44 A;  4AX0 B;  5AHO A;  2WHG A;  3SD9 A;  3FCZ A;  5EV6 A;  4TZE A;  4Z7R A;  1XTO A;  4C1F A;  2Q9U A;  1KR3 A;  1VME A;  3PY5 A;  4D1U A;  5IQK A;  4Z5Y A;  2Y8A A;  3ZNB A;  2YNW A;  5EVD A;  1ZNB A;  2M5C A;  2Q0J A;  2FU6 A;  2BIB A;  4C09 A;  3SPU A;  2QED A;  3IE2 A;  4TZ9 A;  4UWO B;  4HKY A;  5HH6 A;  3IEM A;  3KL7 A;  3BC2 A;  4PVT A;  5DPX A;  3DHA A;  5HH4 A;  3ZWF A;  3RPC A;  2YNT A;  2BFK A;  2BC2 A;  1HLK A;  2BG8 A;  3BV6 A;  5ACR A;  4RAW A;  4YSK A;  4C1D A;  4Z60 A;  5EVB A;  5HIQ A;  2XR1 A;  4DIL A;  2YNT B;  2DKF A;  5K0W A;  4BZ3 A; 
#chains in the Genus database with same CATH topology
 4EYL A;  4AWZ A;  4Z6X A;  2BG8 B;  4Z67 A;  2I7V A;  5LS3 A;  5K4N A;  4RL2 A;  4RAM A;  1YCG A;  1KO2 A;  4GCW A;  3ESH A;  3SRX A;  2P4Z A;  4AD9 A;  5EWA A;  3I11 A;  2A7M A;  2I7T A;  2YNV B;  1WRA A;  3X2Y A;  2OHJ A;  3F9O A;  2ZWR A;  3X30 A;  2YHE A;  4TZB A;  5HIS A;  2ZZI A;  2BFZ A;  1DD6 A;  5FQC A;  3IE0 A;  4P62 A;  1X8I A;  3ZR9 A;  3G1P A;  4EXY A;  5LE1 A;  2Y8B A;  4EY2 A;  5EHT A;  3Q6V A;  4EYF A;  2Q0I A;  3RKK A;  4AV7 A;  1XM8 A;  1VGN A;  3ZQ4 A;  4PVO A;  5AEB A;  4V0H A;  4ZO3 A;  2BFZ B;  2QDT A;  2WRS A;  3I14 A;  1DXK A;  4DIK A;  2GCU A;  2ZNB A;  3H3E A;  4WD6 A;  2FU7 A;  4B87 A;  3IE1 A;  1A8T A;  5AYA A;  4HL1 A;  5AXR A;  2FHX A;  3BK1 A;  3T9M A;  4NQ4 A;  1JJT A;  4KEQ A;  1JT1 A;  3IOF A;  5AIJ A;  5LCH A;  4CHL A;  3IOG A;  5FQA A;  5LCF A;  3MD7 A;  3X2X A;  5LCA A;  2BG7 A;  1DDK A;  1BVT A;  1YCF A;  4F6Z A;  1P9E A;  1M2X A;  5A0V A;  3SBL A;  4C1G A;  4C1C A;  1X8G A;  3JXP A;  4HL2 A;  5LSC A;  5KIL A;  3SFP A;  4NQ2 A;  4XWT A;  4YSL A;  4U4L A;  3KNR A;  3IDZ A;  2FU9 A;  4H0D A;  4UWP B;  4NQ5 A;  5HIO A;  2H6A A;  2QIN A;  2GKL A;  2NYP A;  1YCH A;  4XUK A;  4UWS B;  2QJS A;  5ACX A;  1A7T A;  3RKJ A;  4D1T A;  4C1H A;  5K4M A;  4NUR A;  4AXH A;  2QDS A;  4C1E A;  4GYU A;  2OHI A;  5LLD A;  3FAI A;  3PY6 A;  5B15 A;  2CG3 A;  3SW3 A;  4RL0 A;  3AF5 A;  5EH9 A;  5LM6 A;  1QH5 A;  5ACW A;  3VQZ A;  4NQ6 A;  5A23 A;  4Z5Z A;  3KNS A;  3LVZ A;  3DH8 A;  5B3R A;  4EFZ A;  2VW8 A;  3AJ3 A;  2BTN A;  4F6H A;  4UWR B;  2DOO A;  4TZF A;  3VPE A;  4ZEJ A;  2GFK A;  2YZ3 A;  1SML A;  5ACS A;  2BFL A;  2HB9 A;  2OHH A;  2XF4 A;  4FSB A;  4UA4 A;  2UYX A;  4O98 A;  1E5D A;  5AXO A;  1MQO A;  5ACV A;  1K07 A;  5ACP A;  3DHC A;  5A5Z A;  4UAM A;  2Y87 A;  5A0T A;  2Q42 A;  3IEK A;  2M5D A;  2ZO4 A;  3I0V A;  4UBQ A;  4J5F A;  1BC2 A;  2I7X A;  2WYL A;  2CG2 A;  3ADR A;  4EYB A;  3T3O A;  2GMN A;  3PG4 A;  3I15 A;  2YCB A;  2NZF A;  3T3N A;  3I13 A;  4LE6 A;  4D02 A;  2FHX B;  4D1W A;  3AF6 A;  5EVK A;  4FEK A;  3S0Z A;  3IEL A;  2GFJ A;  4AX1 B;  5EW0 A;  4XWW A;  3P2U A;  1QH3 A;  4FR7 A;  1VJN A;  1ZTC A;  3DHB A;  4KEP A;  4AWY B;  4J5H A;  2BG2 A;  4RBS A;  5HH5 A;  1WW1 A;  2BMI A;  4ZO2 A;  5ACQ A;  3QH8 A;  3TP9 A;  1WUO A;  1ZKP A;  2NXA A;  2AIO A;  4RM5 A;  5AHR A;  5ACT A;  1KO3 A;  2E7Y A;  4D1V A;  3A4Y A;  2NZE A;  3L6N A;  5EV8 A;  2YNU A;  4EXS A;  2FU8 A;  2FM6 A;  2YNV A;  2BG6 A;  4JO0 A;  1X8H A;  4YSB A;  3BK2 A;  1L9Y A;  4ZNB A;  5B1U A;  2BGA A;  2WYM A;  5FQB A;  5HIP A;  5KIK A;  2R2D A;  5LMC A;  5ACU A;  4GYQ A;  1WUP A;  2P1E A;  2AZ4 A;  3X2Z A;  3R2U A;  1BMC A;  4BP0 A;  5A87 A;  3WXC A;  2WYM C;  5K4K A;  2BR6 A;  1JJE A;  2FK6 A;  2P18 A;  4TYF A;  2CFU A;  2P97 A;  4TYT A;  2CBN A;  1Y44 A;  4AX0 B;  5AHO A;  2WHG A;  3SD9 A;  3FCZ A;  5EV6 A;  4TZE A;  4Z7R A;  1XTO A;  4C1F A;  2Q9U A;  1KR3 A;  1VME A;  3PY5 A;  4D1U A;  5IQK A;  4Z5Y A;  2Y8A A;  5AJL A;  3ZNB A;  2YNW A;  5EVD A;  1ZNB A;  2M5C A;  2Q0J A;  2FU6 A;  2BIB A;  4C09 A;  3SPU A;  2QED A;  3IE2 A;  4TZ9 A;  4UWO B;  4HKY A;  5HH6 A;  3IEM A;  3KL7 A;  3BC2 A;  4PVT A;  5DPX A;  3DHA A;  5HH4 A;  2CFZ A;  3ZWF A;  3RPC A;  2YNT A;  2BFK A;  2BC2 A;  1HLK A;  2BG8 A;  3BV6 A;  5ACR A;  4RAW A;  4YSK A;  4C1D A;  4Z60 A;  5EVB A;  5HIQ A;  2XR1 A;  4PDX A;  4DIL A;  2YNT B;  2DKF A;  5K0W A;  4BZ3 A; 
#chains in the Genus database with same CATH homology
 4EYL A;  4AWZ A;  4Z6X A;  2BG8 B;  4Z67 A;  2I7V A;  5LS3 A;  5K4N A;  4RL2 A;  4RAM A;  1YCG A;  1KO2 A;  4GCW A;  3ESH A;  3SRX A;  2P4Z A;  4AD9 A;  5EWA A;  3I11 A;  2A7M A;  2I7T A;  2YNV B;  1WRA A;  3X2Y A;  2OHJ A;  3F9O A;  2ZWR A;  3X30 A;  4TZB A;  5HIS A;  2ZZI A;  2BFZ A;  1DD6 A;  5FQC A;  3IE0 A;  4P62 A;  1X8I A;  3ZR9 A;  3G1P A;  4EXY A;  5LE1 A;  2Y8B A;  4EY2 A;  5EHT A;  3Q6V A;  4EYF A;  2Q0I A;  3RKK A;  1XM8 A;  1VGN A;  3ZQ4 A;  4PVO A;  5AEB A;  4V0H A;  4ZO3 A;  2BFZ B;  2QDT A;  2WRS A;  3I14 A;  1DXK A;  4DIK A;  2GCU A;  2ZNB A;  3H3E A;  4WD6 A;  2FU7 A;  4B87 A;  3IE1 A;  1A8T A;  5AYA A;  4HL1 A;  5AXR A;  2FHX A;  3BK1 A;  3T9M A;  4NQ4 A;  1JJT A;  4KEQ A;  1JT1 A;  3IOF A;  5LCH A;  4CHL A;  3IOG A;  5FQA A;  5LCF A;  3MD7 A;  3X2X A;  5LCA A;  2BG7 A;  1DDK A;  1BVT A;  1YCF A;  4F6Z A;  1P9E A;  1M2X A;  5A0V A;  3SBL A;  4C1G A;  4C1C A;  1X8G A;  3JXP A;  4HL2 A;  5LSC A;  5KIL A;  3SFP A;  4NQ2 A;  4XWT A;  4YSL A;  4U4L A;  3KNR A;  3IDZ A;  2FU9 A;  4H0D A;  4UWP B;  4NQ5 A;  5HIO A;  2H6A A;  2QIN A;  2GKL A;  2NYP A;  1YCH A;  4XUK A;  4UWS B;  2QJS A;  5ACX A;  1A7T A;  3RKJ A;  4D1T A;  4C1H A;  5K4M A;  2QDS A;  4C1E A;  4GYU A;  2OHI A;  5LLD A;  3FAI A;  3PY6 A;  5B15 A;  3SW3 A;  4RL0 A;  3AF5 A;  5EH9 A;  5LM6 A;  1QH5 A;  5ACW A;  3VQZ A;  4NQ6 A;  4Z5Z A;  3KNS A;  3LVZ A;  4EFZ A;  3DH8 A;  5B3R A;  2VW8 A;  3AJ3 A;  2BTN A;  4F6H A;  4UWR B;  2DOO A;  4TZF A;  3VPE A;  4ZEJ A;  2GFK A;  2YZ3 A;  1SML A;  5ACS A;  2BFL A;  2HB9 A;  2OHH A;  2XF4 A;  4FSB A;  4UA4 A;  2UYX A;  4O98 A;  1E5D A;  5AXO A;  1MQO A;  5ACV A;  1K07 A;  5ACP A;  3DHC A;  5A5Z A;  4UAM A;  2Y87 A;  5A0T A;  2Q42 A;  3IEK A;  2M5D A;  2ZO4 A;  3I0V A;  4UBQ A;  4J5F A;  1BC2 A;  2I7X A;  2WYL A;  3ADR A;  4EYB A;  3T3O A;  2GMN A;  3PG4 A;  3I15 A;  2YCB A;  2NZF A;  3T3N A;  3I13 A;  4LE6 A;  4D02 A;  2FHX B;  4D1W A;  3AF6 A;  5EVK A;  4FEK A;  3S0Z A;  3IEL A;  2GFJ A;  4AX1 B;  5EW0 A;  4XWW A;  3P2U A;  1QH3 A;  4FR7 A;  1VJN A;  1ZTC A;  3DHB A;  4KEP A;  4AWY B;  4J5H A;  2BG2 A;  4RBS A;  5HH5 A;  1WW1 A;  2BMI A;  4ZO2 A;  5ACQ A;  3QH8 A;  3TP9 A;  1WUO A;  1ZKP A;  2NXA A;  2AIO A;  4RM5 A;  5AHR A;  5ACT A;  1KO3 A;  2E7Y A;  4D1V A;  3A4Y A;  2NZE A;  3L6N A;  5EV8 A;  2YNU A;  4EXS A;  2FU8 A;  2FM6 A;  2YNV A;  2BG6 A;  4JO0 A;  1X8H A;  4YSB A;  3BK2 A;  1L9Y A;  4ZNB A;  5B1U A;  2BGA A;  2WYM A;  5FQB A;  5HIP A;  5KIK A;  2R2D A;  5LMC A;  5ACU A;  4GYQ A;  1WUP A;  2P1E A;  2AZ4 A;  3X2Z A;  3R2U A;  1BMC A;  4BP0 A;  5A87 A;  3WXC A;  2WYM C;  5K4K A;  2BR6 A;  1JJE A;  2FK6 A;  2P18 A;  4TYF A;  2P97 A;  4TYT A;  2CBN A;  1Y44 A;  4AX0 B;  5AHO A;  2WHG A;  3SD9 A;  3FCZ A;  5EV6 A;  4TZE A;  4Z7R A;  1XTO A;  4C1F A;  2Q9U A;  1KR3 A;  1VME A;  3PY5 A;  4D1U A;  5IQK A;  4Z5Y A;  2Y8A A;  3ZNB A;  2YNW A;  5EVD A;  1ZNB A;  2M5C A;  2Q0J A;  2FU6 A;  2BIB A;  4C09 A;  3SPU A;  2QED A;  3IE2 A;  4TZ9 A;  4UWO B;  4HKY A;  5HH6 A;  3IEM A;  3KL7 A;  3BC2 A;  4PVT A;  5DPX A;  3DHA A;  5HH4 A;  3ZWF A;  3RPC A;  2YNT A;  2BFK A;  2BC2 A;  1HLK A;  2BG8 A;  3BV6 A;  5ACR A;  4RAW A;  4YSK A;  4C1D A;  4Z60 A;  5EVB A;  5HIQ A;  2XR1 A;  4DIL A;  2YNT B;  2DKF A;  5K0W A;  4BZ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...