4ZO2A

Aidc, a dizinc quorum-quenching lactonase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
293
structure length
293
Chain Sequence
DLSGFKKIKLGELELFILTDGYIHEENLISFAPRGNVAELKTILKDNFRADHYIDMAINILLVKTKEKLILMDTGMGIFADERTGFLLKSLQKAGFSAHDITDIFLSHAHPDHIGGVVDKQNKLVFPNASIFISKIEHDFWINASIKDFNNSALKAHPERLNQIIPALQNILKAIQPKLKFYDLNKTLYSHFNFQLAPGHTPGLTVTTISSGNEKLMYVADLIHSDVILFPHPDWGFSGDTDLDIATASRKKFLKQLADTKARAFTSHLPWPGLGFTKVKAPGFEWIPESFMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Acylhomoserine lactonase
publication title Structural and Biochemical Characterization of AidC, a Quorum-Quenching Lactonase with Atypical Selectivity.
pubmed doi rcsb
source organism Chryseobacterium sp. strb126
total genus 87
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4zo2A00
4NQ2A 5A5ZA 3IDZA 4GYQA 4PVTA 3I14A 1E5DA 4C1EA 5K4MA 5HH4A 4NQ5A 2Y87A 2Q9UA 2YZ3A 3BV6A 5AHRA 4XWTA 5LE1A 2ZNBA 1A7TA 3VPEA 4UWSB 5B3RA 2NYPA 2QDTA 1WUOA 4NQ6A 1L9YA 4HL1A 5LCFA 3SD9A 4RL0A 2ZO4A 1X8HA 1XTOA 2YNVA 3BK1A 5ACTA 4C1HA 3F9OA 2FM6A 3PY6A 2P18A 5EVDA 1JJEA 2ZZIA 5EV8A 3PY5A 4EXYA 5ACVA 2DOOA 4PVOA 3IE1A 1MQOA 5DPXA 3DHBA 4EYLA 5AXOA 1VJNA 2HB9A 4C1FA 3Q6VA 4Z5ZA 4GYUA 4C1DA 3RKJA 4TZBA 2GMNA 2BFLA 4RBSA 1WUPA 4YSKA 5HIOA 5K0WA 3H3EA 4V0HA 3BK2A 4EY2A 3X2ZA 3X2YA 2WYMA 3IE2A 3I15A 3WXCA 3RKKA 2WYLA 4YSLA 4UWOB 1VGNA 4RM5A 3KNSA 5FQAA 2P4ZA 3DHCA 5HH6A 2GFKA 4FR7A 4DILA 3SPUA 2BFZB 5ACPA 3KNRA 1BMCA 2OHIA 2FU7A 5K4KA 4RAWA 2WHGA 5AEBA 1ZTCA 5B1UA 3R2UA 4F6ZA 3SW3A 2BFKA 2Y8BA 2QEDA 2E7YA 3QH8A 2GCUA 3IOFA 4NQ4A 4C09A 3RPCA 5ACUA 4EXSA 2AZ4A 2A7MA 5EW0A 4BZ3A 2WRSA 3I0VA 4YSBA 2FK6A 2XR1A 4UWRB 4FSBA 1XM8A 1WRAA 2I7VA 2YNVB 1M2XA 5AXRA 4U4LA 2GFJA 2BG8A 4UAMA 2YNTB 3ZWFA 2Q0IA 1VMEA 1KR3A 3L6NA 4TYTA 5LCAA 2YNTA 5EWAA 1YCFA 5LLDA 2M5CA 2I7XA 1ZNBA 1X8GA 3SBLA 4ZNBA 4F6HA 5LS3A 2BC2A 4D02A 2Q42A 3T9MA 2NZFA 1DDKA 5FQCA 5EHTA 1BC2A 3JXPA 4EYBA 4UWPB 2YNWA 2YCBA 4RAMA 4D1WA 2QDSA 3IELA 2QINA 5B15A 2FHXA 3IE0A 5LM6A 5IQKA 3T3NA 3FAIA 1P9EA 1A8TA 1ZKPA 4JO0A 2WYMC 4TZ9A 4Z60A 4KEPA 5K4NA 2CBNA 3ZR9A 3DHAA 3T3OA 1QH3A 2ZWRA 2UYXA 1SMLA 5LMCA 4EFZA 2VW8A 3IEKA 4ZO3A 2M5DA 3ZQ4A 2BMIA 2DKFA 5EVBA 5A0VA 2Q0JA 4KEQA 3I13A 3PG4A 5EH9A 4RL2A 5ACWA 3SRXA 2GKLA 3LVZA 4ZO2A 5LCHA 3AF6A 3TP9A 1YCHA 4XWWA 5HIPA 2FU9A 4Z5YA 1JJTA 2H6AA 2AIOA 4H0DA 2BG7A 4J5HA 5EVKA 2FU8A 2P1EA 4AWYB 4D1UA 3ADRA 5HISA 2BG8B 2BTNA 4BP0A 5KILA 1Y44A 4Z6XA 2QJSA 4FEKA 3MD7A 2NZEA 3AJ3A 4ZEJA 4Z67A 3G1PA 5FQBA 1JT1A 4EYFA 2BG2A 5ACXA 2R2DA 3DH8A 1YCGA 4C1GA 5ACSA 5AYAA 4HKYA 4GCWA 2FU6A 1KO2A 2P97A 1QH5A 2I7TA 4O98A 4LE6A 3FCZA 2FHXB 3I11A 2BR6A 4AX0B 4AX1B 4AD9A 3SFPA 4UBQA 2Y8AA 3A4YA 2OHHA 4TYFA 3IOGA 4CHLA 4D1TA 1K07A 3X30A 1WW1A 4B87A 3KL7A 4HL2A 5ACQA 4UA4A 4P62A 3P2UA 3ZNBA 4TZEA 3AF5A 3X2XA 1KO3A 3IEMA 2BIBA 1DD6A 2OHJA 3ESHA 5A87A 2NXAA 3BC2A 5HIQA 4J5FA 4Z7RA 5ACRA 5AHOA 2XF4A 5HH5A 1HLKA 2BG6A 3VQZA 1DXKA 4AWZA 1BVTA 2BFZA 5EV6A 4DIKA 2YNUA 4TZFA 5A0TA 5LSCA 3S0ZA 5KIKA 4C1CA 4D1VA 4WD6A 1X8IA 4XUKA 2BGAA
chains in the Genus database with same CATH superfamily
4NQ2A 5A5ZA 3IDZA 4GYQA 4PVTA 3I14A 1E5DA 4C1EA 5K4MA 5HH4A 4NQ5A 2Y87A 2Q9UA 2YZ3A 3BV6A 5AHRA 4XWTA 5LE1A 2ZNBA 1A7TA 3VPEA 4UWSB 5B3RA 2NYPA 2QDTA 1WUOA 4NQ6A 1L9YA 4HL1A 5LCFA 3SD9A 4RL0A 2ZO4A 1X8HA 1XTOA 2YNVA 3BK1A 5ACTA 4C1HA 3F9OA 2FM6A 3PY6A 2P18A 2CG3A 5EVDA 1JJEA 2ZZIA 5EV8A 3PY5A 4EXYA 2CFUA 5ACVA 2DOOA 4PVOA 3IE1A 1MQOA 5DPXA 3DHBA 4EYLA 5AXOA 1VJNA 2HB9A 4C1FA 3Q6VA 4Z5ZA 4GYUA 4C1DA 3RKJA 4TZBA 2GMNA 2BFLA 4RBSA 1WUPA 4YSKA 5HIOA 5K0WA 5AJLA 3H3EA 4V0HA 3BK2A 5AIJA 4EY2A 3X2ZA 3X2YA 2WYMA 3IE2A 3I15A 3WXCA 3RKKA 2WYLA 4YSLA 4UWOB 1VGNA 4RM5A 3KNSA 5FQAA 2P4ZA 3DHCA 4NURA 5HH6A 2GFKA 4FR7A 4DILA 3SPUA 2BFZB 5ACPA 3KNRA 1BMCA 2OHIA 2FU7A 5K4KA 4RAWA 2WHGA 5AEBA 1ZTCA 5B1UA 3R2UA 4F6ZA 3SW3A 2BFKA 2Y8BA 2YHEA 2QEDA 4AV7A 2E7YA 3QH8A 2GCUA 3IOFA 4NQ4A 4C09A 3RPCA 5ACUA 4EXSA 2AZ4A 2A7MA 5EW0A 4BZ3A 2WRSA 3I0VA 4YSBA 2FK6A 2XR1A 4UWRB 4FSBA 1XM8A 1WRAA 2I7VA 2YNVB 1M2XA 5AXRA 4U4LA 2GFJA 2BG8A 4UAMA 2YNTB 3ZWFA 2Q0IA 1VMEA 1KR3A 3L6NA 4TYTA 5LCAA 2YNTA 5EWAA 1YCFA 5LLDA 2M5CA 2I7XA 1ZNBA 1X8GA 3SBLA 4ZNBA 4F6HA 5LS3A 2BC2A 4D02A 2Q42A 3T9MA 2NZFA 1DDKA 5FQCA 5EHTA 1BC2A 3JXPA 4EYBA 4UWPB 2YNWA 2YCBA 4RAMA 4D1WA 2QDSA 3IELA 2QINA 5B15A 2FHXA 3IE0A 5LM6A 5IQKA 3T3NA 4AXHA 3FAIA 1P9EA 1A8TA 1ZKPA 4JO0A 2WYMC 4TZ9A 4Z60A 4KEPA 5K4NA 2CBNA 3ZR9A 3DHAA 3T3OA 1QH3A 2ZWRA 2UYXA 1SMLA 5LMCA 4EFZA 2VW8A 3IEKA 4ZO3A 2M5DA 3ZQ4A 2BMIA 2DKFA 5EVBA 5A0VA 2CG2A 2Q0JA 4KEQA 3I13A 3PG4A 5EH9A 4RL2A 5ACWA 3SRXA 2GKLA 3LVZA 4ZO2A 5LCHA 3AF6A 3TP9A 1YCHA 4XWWA 5HIPA 2FU9A 4Z5YA 1JJTA 2H6AA 2AIOA 4H0DA 2BG7A 4J5HA 5EVKA 2FU8A 2P1EA 4AWYB 4D1UA 3ADRA 5HISA 2BG8B 2BTNA 4BP0A 5KILA 1Y44A 4Z6XA 2QJSA 4FEKA 3MD7A 2NZEA 3AJ3A 4ZEJA 4Z67A 3G1PA 5FQBA 1JT1A 4EYFA 2BG2A 5ACXA 2R2DA 3DH8A 1YCGA 4C1GA 5ACSA 5AYAA 2CFZA 4HKYA 4GCWA 2FU6A 1KO2A 2P97A 1QH5A 2I7TA 4O98A 4LE6A 3FCZA 2FHXB 3I11A 5A23A 2BR6A 4AX0B 4AX1B 4AD9A 3SFPA 4UBQA 2Y8AA 3A4YA 2OHHA 4TYFA 3IOGA 4CHLA 4D1TA 1K07A 3X30A 1WW1A 4B87A 3KL7A 4HL2A 5ACQA 4UA4A 4P62A 3P2UA 3ZNBA 4TZEA 3AF5A 3X2XA 1KO3A 3IEMA 2BIBA 1DD6A 2OHJA 3ESHA 5A87A 2NXAA 3BC2A 5HIQA 4J5FA 4Z7RA 5ACRA 5AHOA 2XF4A 5HH5A 1HLKA 2BG6A 3VQZA 1DXKA 4AWZA 1BVTA 2BFZA 5EV6A 4DIKA 2YNUA 4TZFA 5A0TA 4PDXA 5LSCA 3S0ZA 5KIKA 4C1CA 4D1VA 4WD6A 1X8IA 4XUKA 2BGAA
chains in the Genus database with same CATH topology
4NQ2A 5A5ZA 3IDZA 4GYQA 4PVTA 3I14A 1E5DA 4C1EA 5K4MA 5HH4A 4NQ5A 2Y87A 2Q9UA 2YZ3A 3BV6A 5AHRA 4XWTA 5LE1A 2ZNBA 1A7TA 3VPEA 4UWSB 5B3RA 2NYPA 2QDTA 1WUOA 4NQ6A 1L9YA 4HL1A 5LCFA 3SD9A 4RL0A 2ZO4A 1X8HA 1XTOA 2YNVA 3BK1A 5ACTA 4C1HA 3F9OA 2FM6A 3PY6A 2P18A 5EVDA 1JJEA 2ZZIA 5EV8A 3PY5A 4EXYA 5ACVA 2DOOA 4PVOA 3IE1A 1MQOA 5DPXA 3DHBA 4EYLA 5AXOA 1VJNA 2HB9A 4C1FA 3Q6VA 4Z5ZA 4GYUA 4C1DA 3RKJA 4TZBA 2GMNA 2BFLA 4RBSA 1WUPA 4YSKA 5HIOA 5K0WA 3H3EA 4V0HA 3BK2A 4EY2A 3X2ZA 3X2YA 2WYMA 3IE2A 3I15A 3WXCA 3RKKA 2WYLA 4YSLA 4UWOB 1VGNA 4RM5A 3KNSA 5FQAA 2P4ZA 3DHCA 5HH6A 2GFKA 4FR7A 4DILA 3SPUA 2BFZB 5ACPA 3KNRA 1BMCA 2OHIA 2FU7A 5K4KA 4RAWA 2WHGA 5AEBA 1ZTCA 5B1UA 3R2UA 4F6ZA 3SW3A 2BFKA 2Y8BA 2QEDA 2E7YA 3QH8A 2GCUA 3IOFA 4NQ4A 4C09A 3RPCA 5ACUA 4EXSA 2AZ4A 2A7MA 5EW0A 4BZ3A 2WRSA 3I0VA 4YSBA 2FK6A 2XR1A 4UWRB 4FSBA 1XM8A 1WRAA 2I7VA 2YNVB 1M2XA 5AXRA 4U4LA 2GFJA 2BG8A 4UAMA 2YNTB 3ZWFA 2Q0IA 1VMEA 1KR3A 3L6NA 4TYTA 5LCAA 2YNTA 5EWAA 1YCFA 5LLDA 2M5CA 2I7XA 1ZNBA 1X8GA 3SBLA 4ZNBA 4F6HA 5LS3A 2BC2A 4D02A 2Q42A 3T9MA 2NZFA 1DDKA 5FQCA 5EHTA 1BC2A 3JXPA 4EYBA 4UWPB 2YNWA 2YCBA 4RAMA 4D1WA 2QDSA 3IELA 2QINA 5B15A 2FHXA 3IE0A 5LM6A 5IQKA 3T3NA 3FAIA 1P9EA 1A8TA 1ZKPA 4JO0A 2WYMC 4TZ9A 4Z60A 4KEPA 5K4NA 2CBNA 3ZR9A 3DHAA 3T3OA 1QH3A 2ZWRA 2UYXA 1SMLA 5LMCA 4EFZA 2VW8A 3IEKA 4ZO3A 2M5DA 3ZQ4A 2BMIA 2DKFA 5EVBA 5A0VA 2Q0JA 4KEQA 3I13A 3PG4A 5EH9A 4RL2A 5ACWA 3SRXA 2GKLA 3LVZA 4ZO2A 5LCHA 3AF6A 3TP9A 1YCHA 4XWWA 5HIPA 2FU9A 4Z5YA 1JJTA 2H6AA 2AIOA 4H0DA 2BG7A 4J5HA 5EVKA 2FU8A 2P1EA 4AWYB 4D1UA 3ADRA 5HISA 2BG8B 2BTNA 4BP0A 5KILA 1Y44A 4Z6XA 2QJSA 4FEKA 3MD7A 2NZEA 3AJ3A 4ZEJA 4Z67A 3G1PA 5FQBA 1JT1A 4EYFA 2BG2A 5ACXA 2R2DA 3DH8A 1YCGA 4C1GA 5ACSA 5AYAA 4HKYA 4GCWA 2FU6A 1KO2A 2P97A 1QH5A 2I7TA 4O98A 4LE6A 3FCZA 2FHXB 3I11A 2BR6A 4AX0B 4AX1B 4AD9A 3SFPA 4UBQA 2Y8AA 3A4YA 2OHHA 4TYFA 3IOGA 4CHLA 4D1TA 1K07A 3X30A 1WW1A 4B87A 3KL7A 4HL2A 5ACQA 4UA4A 4P62A 3P2UA 3ZNBA 4TZEA 3AF5A 3X2XA 1KO3A 3IEMA 2BIBA 1DD6A 2OHJA 3ESHA 5A87A 2NXAA 3BC2A 5HIQA 4J5FA 4Z7RA 5ACRA 5AHOA 2XF4A 5HH5A 1HLKA 2BG6A 3VQZA 1DXKA 4AWZA 1BVTA 2BFZA 5EV6A 4DIKA 2YNUA 4TZFA 5A0TA 5LSCA 3S0ZA 5KIKA 4C1CA 4D1VA 4WD6A 1X8IA 4XUKA 2BGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NQ2 A;  5A5Z A;  3IDZ A;  4GYQ A;  4PVT A;  3I14 A;  1E5D A;  4C1E A;  5K4M A;  5HH4 A;  4NQ5 A;  2Y87 A;  2Q9U A;  2YZ3 A;  3BV6 A;  5AHR A;  4XWT A;  5LE1 A;  2ZNB A;  1A7T A;  3VPE A;  4UWS B;  5B3R A;  2NYP A;  2QDT A;  1WUO A;  4NQ6 A;  1L9Y A;  4HL1 A;  5LCF A;  3SD9 A;  4RL0 A;  2ZO4 A;  1X8H A;  1XTO A;  2YNV A;  3BK1 A;  5ACT A;  4C1H A;  3F9O A;  2FM6 A;  3PY6 A;  2P18 A;  5EVD A;  1JJE A;  2ZZI A;  5EV8 A;  3PY5 A;  4EXY A;  5ACV A;  2DOO A;  4PVO A;  3IE1 A;  1MQO A;  5DPX A;  3DHB A;  4EYL A;  5AXO A;  1VJN A;  2HB9 A;  4C1F A;  3Q6V A;  4Z5Z A;  4GYU A;  4C1D A;  3RKJ A;  4TZB A;  2GMN A;  2BFL A;  4RBS A;  1WUP A;  4YSK A;  5HIO A;  5K0W A;  3H3E A;  4V0H A;  3BK2 A;  4EY2 A;  3X2Z A;  3X2Y A;  2WYM A;  3IE2 A;  3I15 A;  3WXC A;  3RKK A;  2WYL A;  4YSL A;  4UWO B;  1VGN A;  4RM5 A;  3KNS A;  5FQA A;  2P4Z A;  3DHC A;  5HH6 A;  2GFK A;  4FR7 A;  4DIL A;  3SPU A;  2BFZ B;  5ACP A;  3KNR A;  1BMC A;  2OHI A;  2FU7 A;  5K4K A;  4RAW A;  2WHG A;  5AEB A;  1ZTC A;  5B1U A;  3R2U A;  4F6Z A;  3SW3 A;  2BFK A;  2Y8B A;  2QED A;  2E7Y A;  3QH8 A;  2GCU A;  3IOF A;  4NQ4 A;  4C09 A;  3RPC A;  5ACU A;  4EXS A;  2AZ4 A;  2A7M A;  5EW0 A;  4BZ3 A;  2WRS A;  3I0V A;  4YSB A;  2FK6 A;  2XR1 A;  4UWR B;  4FSB A;  1XM8 A;  1WRA A;  2I7V A;  2YNV B;  1M2X A;  5AXR A;  4U4L A;  2GFJ A;  2BG8 A;  4UAM A;  2YNT B;  3ZWF A;  2Q0I A;  1VME A;  1KR3 A;  3L6N A;  4TYT A;  5LCA A;  2YNT A;  5EWA A;  1YCF A;  5LLD A;  2M5C A;  2I7X A;  1ZNB A;  1X8G A;  3SBL A;  4ZNB A;  4F6H A;  5LS3 A;  2BC2 A;  4D02 A;  2Q42 A;  3T9M A;  2NZF A;  1DDK A;  5FQC A;  5EHT A;  1BC2 A;  3JXP A;  4EYB A;  4UWP B;  2YNW A;  2YCB A;  4RAM A;  4D1W A;  2QDS A;  3IEL A;  2QIN A;  5B15 A;  2FHX A;  3IE0 A;  5LM6 A;  5IQK A;  3T3N A;  3FAI A;  1P9E A;  1A8T A;  1ZKP A;  4JO0 A;  2WYM C;  4TZ9 A;  4Z60 A;  4KEP A;  5K4N A;  2CBN A;  3ZR9 A;  3DHA A;  3T3O A;  1QH3 A;  2ZWR A;  2UYX A;  1SML A;  5LMC A;  4EFZ A;  2VW8 A;  3IEK A;  4ZO3 A;  2M5D A;  3ZQ4 A;  2BMI A;  2DKF A;  5EVB A;  5A0V A;  2Q0J A;  4KEQ A;  3I13 A;  3PG4 A;  5EH9 A;  4RL2 A;  5ACW A;  3SRX A;  2GKL A;  3LVZ A;  4ZO2 A;  5LCH A;  3AF6 A;  3TP9 A;  1YCH A;  4XWW A;  5HIP A;  2FU9 A;  4Z5Y A;  1JJT A;  2H6A A;  2AIO A;  4H0D A;  2BG7 A;  4J5H A;  5EVK A;  2FU8 A;  2P1E A;  4AWY B;  4D1U A;  3ADR A;  5HIS A;  2BG8 B;  2BTN A;  4BP0 A;  5KIL A;  1Y44 A;  4Z6X A;  2QJS A;  4FEK A;  3MD7 A;  2NZE A;  3AJ3 A;  4ZEJ A;  4Z67 A;  3G1P A;  5FQB A;  1JT1 A;  4EYF A;  2BG2 A;  5ACX A;  2R2D A;  3DH8 A;  1YCG A;  4C1G A;  5ACS A;  5AYA A;  4HKY A;  4GCW A;  2FU6 A;  1KO2 A;  2P97 A;  1QH5 A;  2I7T A;  4O98 A;  4LE6 A;  3FCZ A;  2FHX B;  3I11 A;  2BR6 A;  4AX0 B;  4AX1 B;  4AD9 A;  3SFP A;  4UBQ A;  2Y8A A;  3A4Y A;  2OHH A;  4TYF A;  3IOG A;  4CHL A;  4D1T A;  1K07 A;  3X30 A;  1WW1 A;  4B87 A;  3KL7 A;  4HL2 A;  5ACQ A;  4UA4 A;  4P62 A;  3P2U A;  3ZNB A;  4TZE A;  3AF5 A;  3X2X A;  1KO3 A;  3IEM A;  2BIB A;  1DD6 A;  2OHJ A;  3ESH A;  5A87 A;  2NXA A;  3BC2 A;  5HIQ A;  4J5F A;  4Z7R A;  5ACR A;  5AHO A;  2XF4 A;  5HH5 A;  1HLK A;  2BG6 A;  3VQZ A;  1DXK A;  4AWZ A;  1BVT A;  2BFZ A;  5EV6 A;  4DIK A;  2YNU A;  4TZF A;  5A0T A;  5LSC A;  3S0Z A;  5KIK A;  4C1C A;  4D1V A;  4WD6 A;  1X8I A;  4XUK A;  2BGA A; 
#chains in the Genus database with same CATH topology
 4NQ2 A;  5A5Z A;  3IDZ A;  4GYQ A;  4PVT A;  3I14 A;  1E5D A;  4C1E A;  5K4M A;  5HH4 A;  4NQ5 A;  2Y87 A;  2Q9U A;  2YZ3 A;  3BV6 A;  5AHR A;  4XWT A;  5LE1 A;  2ZNB A;  1A7T A;  3VPE A;  4UWS B;  5B3R A;  2NYP A;  2QDT A;  1WUO A;  4NQ6 A;  1L9Y A;  4HL1 A;  5LCF A;  3SD9 A;  4RL0 A;  2ZO4 A;  1X8H A;  1XTO A;  2YNV A;  3BK1 A;  5ACT A;  4C1H A;  3F9O A;  2FM6 A;  3PY6 A;  2P18 A;  2CG3 A;  5EVD A;  1JJE A;  2ZZI A;  5EV8 A;  3PY5 A;  4EXY A;  2CFU A;  5ACV A;  2DOO A;  4PVO A;  3IE1 A;  1MQO A;  5DPX A;  3DHB A;  4EYL A;  5AXO A;  1VJN A;  2HB9 A;  4C1F A;  3Q6V A;  4Z5Z A;  4GYU A;  4C1D A;  3RKJ A;  4TZB A;  2GMN A;  2BFL A;  4RBS A;  1WUP A;  4YSK A;  5HIO A;  5K0W A;  5AJL A;  3H3E A;  4V0H A;  3BK2 A;  5AIJ A;  4EY2 A;  3X2Z A;  3X2Y A;  2WYM A;  3IE2 A;  3I15 A;  3WXC A;  3RKK A;  2WYL A;  4YSL A;  4UWO B;  1VGN A;  4RM5 A;  3KNS A;  5FQA A;  2P4Z A;  3DHC A;  4NUR A;  5HH6 A;  2GFK A;  4FR7 A;  4DIL A;  3SPU A;  2BFZ B;  5ACP A;  3KNR A;  1BMC A;  2OHI A;  2FU7 A;  5K4K A;  4RAW A;  2WHG A;  5AEB A;  1ZTC A;  5B1U A;  3R2U A;  4F6Z A;  3SW3 A;  2BFK A;  2Y8B A;  2YHE A;  2QED A;  4AV7 A;  2E7Y A;  3QH8 A;  2GCU A;  3IOF A;  4NQ4 A;  4C09 A;  3RPC A;  5ACU A;  4EXS A;  2AZ4 A;  2A7M A;  5EW0 A;  4BZ3 A;  2WRS A;  3I0V A;  4YSB A;  2FK6 A;  2XR1 A;  4UWR B;  4FSB A;  1XM8 A;  1WRA A;  2I7V A;  2YNV B;  1M2X A;  5AXR A;  4U4L A;  2GFJ A;  2BG8 A;  4UAM A;  2YNT B;  3ZWF A;  2Q0I A;  1VME A;  1KR3 A;  3L6N A;  4TYT A;  5LCA A;  2YNT A;  5EWA A;  1YCF A;  5LLD A;  2M5C A;  2I7X A;  1ZNB A;  1X8G A;  3SBL A;  4ZNB A;  4F6H A;  5LS3 A;  2BC2 A;  4D02 A;  2Q42 A;  3T9M A;  2NZF A;  1DDK A;  5FQC A;  5EHT A;  1BC2 A;  3JXP A;  4EYB A;  4UWP B;  2YNW A;  2YCB A;  4RAM A;  4D1W A;  2QDS A;  3IEL A;  2QIN A;  5B15 A;  2FHX A;  3IE0 A;  5LM6 A;  5IQK A;  3T3N A;  4AXH A;  3FAI A;  1P9E A;  1A8T A;  1ZKP A;  4JO0 A;  2WYM C;  4TZ9 A;  4Z60 A;  4KEP A;  5K4N A;  2CBN A;  3ZR9 A;  3DHA A;  3T3O A;  1QH3 A;  2ZWR A;  2UYX A;  1SML A;  5LMC A;  4EFZ A;  2VW8 A;  3IEK A;  4ZO3 A;  2M5D A;  3ZQ4 A;  2BMI A;  2DKF A;  5EVB A;  5A0V A;  2CG2 A;  2Q0J A;  4KEQ A;  3I13 A;  3PG4 A;  5EH9 A;  4RL2 A;  5ACW A;  3SRX A;  2GKL A;  3LVZ A;  4ZO2 A;  5LCH A;  3AF6 A;  3TP9 A;  1YCH A;  4XWW A;  5HIP A;  2FU9 A;  4Z5Y A;  1JJT A;  2H6A A;  2AIO A;  4H0D A;  2BG7 A;  4J5H A;  5EVK A;  2FU8 A;  2P1E A;  4AWY B;  4D1U A;  3ADR A;  5HIS A;  2BG8 B;  2BTN A;  4BP0 A;  5KIL A;  1Y44 A;  4Z6X A;  2QJS A;  4FEK A;  3MD7 A;  2NZE A;  3AJ3 A;  4ZEJ A;  4Z67 A;  3G1P A;  5FQB A;  1JT1 A;  4EYF A;  2BG2 A;  5ACX A;  2R2D A;  3DH8 A;  1YCG A;  4C1G A;  5ACS A;  5AYA A;  2CFZ A;  4HKY A;  4GCW A;  2FU6 A;  1KO2 A;  2P97 A;  1QH5 A;  2I7T A;  4O98 A;  4LE6 A;  3FCZ A;  2FHX B;  3I11 A;  5A23 A;  2BR6 A;  4AX0 B;  4AX1 B;  4AD9 A;  3SFP A;  4UBQ A;  2Y8A A;  3A4Y A;  2OHH A;  4TYF A;  3IOG A;  4CHL A;  4D1T A;  1K07 A;  3X30 A;  1WW1 A;  4B87 A;  3KL7 A;  4HL2 A;  5ACQ A;  4UA4 A;  4P62 A;  3P2U A;  3ZNB A;  4TZE A;  3AF5 A;  3X2X A;  1KO3 A;  3IEM A;  2BIB A;  1DD6 A;  2OHJ A;  3ESH A;  5A87 A;  2NXA A;  3BC2 A;  5HIQ A;  4J5F A;  4Z7R A;  5ACR A;  5AHO A;  2XF4 A;  5HH5 A;  1HLK A;  2BG6 A;  3VQZ A;  1DXK A;  4AWZ A;  1BVT A;  2BFZ A;  5EV6 A;  4DIK A;  2YNU A;  4TZF A;  5A0T A;  4PDX A;  5LSC A;  3S0Z A;  5KIK A;  4C1C A;  4D1V A;  4WD6 A;  1X8I A;  4XUK A;  2BGA A; 
#chains in the Genus database with same CATH homology
 4NQ2 A;  5A5Z A;  3IDZ A;  4GYQ A;  4PVT A;  3I14 A;  1E5D A;  4C1E A;  5K4M A;  5HH4 A;  4NQ5 A;  2Y87 A;  2Q9U A;  2YZ3 A;  3BV6 A;  5AHR A;  4XWT A;  5LE1 A;  2ZNB A;  1A7T A;  3VPE A;  4UWS B;  5B3R A;  2NYP A;  2QDT A;  1WUO A;  4NQ6 A;  1L9Y A;  4HL1 A;  5LCF A;  3SD9 A;  4RL0 A;  2ZO4 A;  1X8H A;  1XTO A;  2YNV A;  3BK1 A;  5ACT A;  4C1H A;  3F9O A;  2FM6 A;  3PY6 A;  2P18 A;  5EVD A;  1JJE A;  2ZZI A;  5EV8 A;  3PY5 A;  4EXY A;  5ACV A;  2DOO A;  4PVO A;  3IE1 A;  1MQO A;  5DPX A;  3DHB A;  4EYL A;  5AXO A;  1VJN A;  2HB9 A;  4C1F A;  3Q6V A;  4Z5Z A;  4GYU A;  4C1D A;  3RKJ A;  4TZB A;  2GMN A;  2BFL A;  4RBS A;  1WUP A;  4YSK A;  5HIO A;  5K0W A;  3H3E A;  4V0H A;  3BK2 A;  4EY2 A;  3X2Z A;  3X2Y A;  2WYM A;  3IE2 A;  3I15 A;  3WXC A;  3RKK A;  2WYL A;  4YSL A;  4UWO B;  1VGN A;  4RM5 A;  3KNS A;  5FQA A;  2P4Z A;  3DHC A;  5HH6 A;  2GFK A;  4FR7 A;  4DIL A;  3SPU A;  2BFZ B;  5ACP A;  3KNR A;  1BMC A;  2OHI A;  2FU7 A;  5K4K A;  4RAW A;  2WHG A;  5AEB A;  1ZTC A;  5B1U A;  3R2U A;  4F6Z A;  3SW3 A;  2BFK A;  2Y8B A;  2QED A;  2E7Y A;  3QH8 A;  2GCU A;  3IOF A;  4NQ4 A;  4C09 A;  3RPC A;  5ACU A;  4EXS A;  2AZ4 A;  2A7M A;  5EW0 A;  4BZ3 A;  2WRS A;  3I0V A;  4YSB A;  2FK6 A;  2XR1 A;  4UWR B;  4FSB A;  1XM8 A;  1WRA A;  2I7V A;  2YNV B;  1M2X A;  5AXR A;  4U4L A;  2GFJ A;  2BG8 A;  4UAM A;  2YNT B;  3ZWF A;  2Q0I A;  1VME A;  1KR3 A;  3L6N A;  4TYT A;  5LCA A;  2YNT A;  5EWA A;  1YCF A;  5LLD A;  2M5C A;  2I7X A;  1ZNB A;  1X8G A;  3SBL A;  4ZNB A;  4F6H A;  5LS3 A;  2BC2 A;  4D02 A;  2Q42 A;  3T9M A;  2NZF A;  1DDK A;  5FQC A;  5EHT A;  1BC2 A;  3JXP A;  4EYB A;  4UWP B;  2YNW A;  2YCB A;  4RAM A;  4D1W A;  2QDS A;  3IEL A;  2QIN A;  5B15 A;  2FHX A;  3IE0 A;  5LM6 A;  5IQK A;  3T3N A;  3FAI A;  1P9E A;  1A8T A;  1ZKP A;  4JO0 A;  2WYM C;  4TZ9 A;  4Z60 A;  4KEP A;  5K4N A;  2CBN A;  3ZR9 A;  3DHA A;  3T3O A;  1QH3 A;  2ZWR A;  2UYX A;  1SML A;  5LMC A;  4EFZ A;  2VW8 A;  3IEK A;  4ZO3 A;  2M5D A;  3ZQ4 A;  2BMI A;  2DKF A;  5EVB A;  5A0V A;  2Q0J A;  4KEQ A;  3I13 A;  3PG4 A;  5EH9 A;  4RL2 A;  5ACW A;  3SRX A;  2GKL A;  3LVZ A;  4ZO2 A;  5LCH A;  3AF6 A;  3TP9 A;  1YCH A;  4XWW A;  5HIP A;  2FU9 A;  4Z5Y A;  1JJT A;  2H6A A;  2AIO A;  4H0D A;  2BG7 A;  4J5H A;  5EVK A;  2FU8 A;  2P1E A;  4AWY B;  4D1U A;  3ADR A;  5HIS A;  2BG8 B;  2BTN A;  4BP0 A;  5KIL A;  1Y44 A;  4Z6X A;  2QJS A;  4FEK A;  3MD7 A;  2NZE A;  3AJ3 A;  4ZEJ A;  4Z67 A;  3G1P A;  5FQB A;  1JT1 A;  4EYF A;  2BG2 A;  5ACX A;  2R2D A;  3DH8 A;  1YCG A;  4C1G A;  5ACS A;  5AYA A;  4HKY A;  4GCW A;  2FU6 A;  1KO2 A;  2P97 A;  1QH5 A;  2I7T A;  4O98 A;  4LE6 A;  3FCZ A;  2FHX B;  3I11 A;  2BR6 A;  4AX0 B;  4AX1 B;  4AD9 A;  3SFP A;  4UBQ A;  2Y8A A;  3A4Y A;  2OHH A;  4TYF A;  3IOG A;  4CHL A;  4D1T A;  1K07 A;  3X30 A;  1WW1 A;  4B87 A;  3KL7 A;  4HL2 A;  5ACQ A;  4UA4 A;  4P62 A;  3P2U A;  3ZNB A;  4TZE A;  3AF5 A;  3X2X A;  1KO3 A;  3IEM A;  2BIB A;  1DD6 A;  2OHJ A;  3ESH A;  5A87 A;  2NXA A;  3BC2 A;  5HIQ A;  4J5F A;  4Z7R A;  5ACR A;  5AHO A;  2XF4 A;  5HH5 A;  1HLK A;  2BG6 A;  3VQZ A;  1DXK A;  4AWZ A;  1BVT A;  2BFZ A;  5EV6 A;  4DIK A;  2YNU A;  4TZF A;  5A0T A;  5LSC A;  3S0Z A;  5KIK A;  4C1C A;  4D1V A;  4WD6 A;  1X8I A;  4XUK A;  2BGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...