1WUOA

Crystal structure of metallo-beta-lactamase imp-1 mutant (d81a)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
219
structure length
218
Chain Sequence
SLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSASTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase IMP-1
publication title Probing the role of Asp-120(81) of metallo-beta-lactamase (IMP-1) by site-directed mutagenesis, kinetic studies, and X-ray crystallography.
pubmed doi rcsb
source organism Serratia marcescens
total genus 61
structure length 218
sequence length 219
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2004-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1wuoA00
2YCBA 4DIKA 1X8GA 4Z5YA 3KNSA 4PVTA 4EY2A 3RKKA 2BGAA 4TZ9A 4P62A 2VW8A 2FK6A 4RL2A 4NQ5A 4Z67A 5HISA 4TZBA 4YSKA 3PY6A 5HIPA 3IE0A 3SD9A 2FU9A 4UWRB 3IE1A 3SFPA 4Z5ZA 2BFZA 3AJ3A 3ZR9A 2ZO4A 3PY5A 3LVZA 3IOFA 5FQAA 2Y87A 3ZWFA 3G1PA 2BG8B 4RL0A 4TYTA 5AEBA 1E5DA 5B1UA 3X2XA 4XWWA 5ACXA 2QJSA 2OHHA 2M5CA 5FQCA 3I11A 2GCUA 3IEMA 3BK1A 1ZKPA 1VMEA 1WUOA 5ACUA 4F6HA 2GFJA 4O98A 1BVTA 5EV8A 4EFZA 2YNTB 4UWOB 4TYFA 4KEPA 3IEKA 1QH3A 4JO0A 4RM5A 1BMCA 2ZNBA 2BMIA 3DH8A 4J5HA 4RBSA 5LLDA 3TP9A 2H6AA 2YNWA 5DPXA 5EH9A 3ZNBA 4CHLA 4HKYA 3S0ZA 4RAWA 4FSBA 1A8TA 1DD6A 2DOOA 2WRSA 3IE2A 1SMLA 2Q0IA 2UYXA 3ADRA 3VQZA 2P18A 4AX0B 2BFZB 5ACQA 2FM6A 5AXOA 3ZQ4A 4WD6A 4Z60A 4ZNBA 2AZ4A 2DKFA 4GYQA 3SW3A 4FEKA 2Y8BA 2NXAA 2ZZIA 2FHXA 3I14A 2NZEA 4EXYA 5LE1A 3PG4A 3I13A 1K07A 2AIOA 2Q9UA 3A4YA 2NZFA 4J5FA 2GFKA 4XWTA 4C09A 3T3OA 5HH5A 2QDSA 2OHJA 2M5DA 2P1EA 3KNRA 2WYLA 4C1DA 3SPUA 5K4NA 4D1UA 5IQKA 2QINA 5A87A 2R2DA 4UBQA 3R2UA 3I0VA 5A0VA 5ACTA 3H3EA 2BFLA 3L6NA 2HB9A 4Z6XA 3AF5A 2Q0JA 5HIQA 5AHRA 1P9EA 1M2XA 1QH5A 4B87A 5EV6A 2QEDA 5K0WA 1WUPA 3BK2A 1KO3A 5EVBA 4U4LA 3T9MA 3RPCA 4YSLA 2QDTA 3BV6A 2XF4A 4EXSA 1DXKA 4C1CA 4D1VA 4AD9A 3KL7A 5AHOA 1L9YA 1MQOA 5EHTA 1HLKA 2FHXB 2BG2A 2YNUA 4AWZA 1WW1A 2GMNA 4EYLA 2YNVA 3SBLA 1X8HA 3BC2A 2GKLA 2CBNA 3Q6VA 3IDZA 5AYAA 3IELA 4D1TA 2E7YA 5KILA 4ZO3A 1YCGA 3FAIA 2Y8AA 4NQ2A 2FU6A 2ZWRA 4Z7RA 2BG7A 3DHCA 2A7MA 4BP0A 2OHIA 4C1EA 5A5ZA 3RKJA 3QH8A 2WYMA 5LM6A 5A0TA 1A7TA 1VGNA 4D02A 4FR7A 4EYBA 2BFKA 4F6ZA 1JT1A 2I7XA 5HH4A 1X8IA 1XM8A 5LMCA 4GCWA 5ACSA 2I7VA 2Q42A 4UA4A 2BG6A 2WHGA 2YZ3A 3X2ZA 1WRAA 5B15A 4PVOA 1YCHA 5KIKA 1BC2A 5EVKA 5K4KA 4UAMA 4DILA 5ACRA 4TZEA 5EW0A 5ACWA 4TZFA 4KEQA 4ZO2A 2BC2A 3FCZA 4C1HA 5LSCA 3DHBA 3DHAA 4LE6A 1DDKA 5HIOA 4YSBA 4HL2A 2YNVB 1ZTCA 3MD7A 1VJNA 3F9OA 3ESHA 1JJTA 3I15A 1ZNBA 3VPEA 4C1GA 4XUKA 4H0DA 2XR1A 2P4ZA 4UWSB 2FU7A 3WXCA 5EVDA 2BTNA 4HL1A 4EYFA 4AWYB 4NQ6A 4ZEJA 5AXRA 5K4MA 2BG8A 4NQ4A 2BR6A 5LCAA 4BZ3A 3AF6A 4UWPB 1Y44A 3X30A 1KR3A 2I7TA 2P97A 4GYUA 5FQBA 3X2YA 2WYMC 3JXPA 5HH6A 5LCFA 1JJEA 2YNTA 4D1WA 2BIBA 4V0HA 4C1FA 4RAMA 5LCHA 3IOGA 3T3NA 1XTOA 3P2UA 5ACPA 5B3RA 5ACVA 4AX1B 2NYPA 1KO2A 5EWAA 2FU8A 3SRXA 5LS3A 1YCFA
chains in the Genus database with same CATH superfamily
2YCBA 4DIKA 1X8GA 4Z5YA 3KNSA 4PVTA 4EY2A 3RKKA 2BGAA 4TZ9A 4P62A 2VW8A 2FK6A 4RL2A 4NQ5A 4Z67A 5HISA 4TZBA 4YSKA 3PY6A 5HIPA 3IE0A 3SD9A 2FU9A 4UWRB 3IE1A 3SFPA 4Z5ZA 2BFZA 3AJ3A 3ZR9A 2ZO4A 3PY5A 3LVZA 3IOFA 5FQAA 2Y87A 3ZWFA 3G1PA 2BG8B 4RL0A 4TYTA 5AEBA 1E5DA 5B1UA 3X2XA 4XWWA 5ACXA 2QJSA 2OHHA 2M5CA 4NURA 5FQCA 3I11A 2GCUA 3IEMA 3BK1A 1ZKPA 1VMEA 1WUOA 5ACUA 4F6HA 2GFJA 4O98A 1BVTA 5EV8A 4EFZA 2YNTB 4UWOB 4TYFA 4KEPA 3IEKA 1QH3A 4AXHA 4JO0A 4RM5A 5AJLA 1BMCA 2ZNBA 2BMIA 3DH8A 4J5HA 4RBSA 5LLDA 3TP9A 2H6AA 2YNWA 5DPXA 5EH9A 3ZNBA 4CHLA 4HKYA 3S0ZA 4RAWA 4FSBA 1A8TA 1DD6A 2DOOA 2WRSA 3IE2A 1SMLA 2Q0IA 2UYXA 3ADRA 3VQZA 2P18A 4AX0B 2BFZB 5ACQA 2FM6A 5AXOA 3ZQ4A 4WD6A 4Z60A 4ZNBA 2AZ4A 2DKFA 4GYQA 3SW3A 4FEKA 2Y8BA 2NXAA 2ZZIA 2FHXA 3I14A 2NZEA 4EXYA 5LE1A 4AV7A 3PG4A 2CG3A 3I13A 1K07A 2AIOA 2Q9UA 3A4YA 2NZFA 4J5FA 2GFKA 4XWTA 4C09A 3T3OA 5HH5A 2QDSA 2OHJA 2M5DA 2P1EA 3KNRA 2WYLA 4C1DA 3SPUA 5K4NA 4D1UA 5IQKA 2QINA 5A87A 2R2DA 4UBQA 3R2UA 3I0VA 5A0VA 5ACTA 3H3EA 2BFLA 3L6NA 2HB9A 4Z6XA 3AF5A 2Q0JA 5HIQA 5AHRA 1P9EA 1M2XA 1QH5A 4B87A 5EV6A 2QEDA 5K0WA 1WUPA 3BK2A 1KO3A 5EVBA 5A23A 4U4LA 3T9MA 3RPCA 4YSLA 2QDTA 3BV6A 2XF4A 4EXSA 1DXKA 4C1CA 4D1VA 4AD9A 3KL7A 5AHOA 1L9YA 1MQOA 5EHTA 1HLKA 2FHXB 2BG2A 2YNUA 4AWZA 1WW1A 2GMNA 4EYLA 2YNVA 3SBLA 1X8HA 3BC2A 2GKLA 2CBNA 3Q6VA 3IDZA 5AYAA 2CFZA 3IELA 4D1TA 2E7YA 5KILA 4ZO3A 1YCGA 3FAIA 2Y8AA 4NQ2A 2FU6A 2ZWRA 4Z7RA 2BG7A 3DHCA 2A7MA 4BP0A 2OHIA 4C1EA 5A5ZA 3RKJA 3QH8A 2WYMA 5LM6A 5A0TA 1A7TA 1VGNA 4D02A 4FR7A 4EYBA 2BFKA 4F6ZA 1JT1A 2I7XA 5HH4A 1X8IA 1XM8A 5LMCA 4GCWA 5ACSA 2I7VA 2Q42A 4UA4A 2BG6A 2WHGA 2YZ3A 3X2ZA 1WRAA 5B15A 4PVOA 1YCHA 5KIKA 1BC2A 5EVKA 5K4KA 4UAMA 4DILA 5ACRA 2CG2A 4TZEA 5EW0A 5ACWA 4TZFA 4KEQA 4ZO2A 2BC2A 3FCZA 4C1HA 5LSCA 3DHBA 3DHAA 4PDXA 4LE6A 1DDKA 5HIOA 4YSBA 4HL2A 2YNVB 1ZTCA 3MD7A 1VJNA 3F9OA 3ESHA 1JJTA 3I15A 1ZNBA 2YHEA 3VPEA 4C1GA 4XUKA 4H0DA 2XR1A 2P4ZA 4UWSB 2FU7A 3WXCA 5EVDA 2BTNA 4HL1A 5AIJA 4EYFA 4AWYB 4NQ6A 4ZEJA 5AXRA 5K4MA 2BG8A 4NQ4A 2BR6A 5LCAA 4BZ3A 3AF6A 4UWPB 1Y44A 3X30A 1KR3A 2I7TA 2P97A 4GYUA 5FQBA 3X2YA 2WYMC 3JXPA 5HH6A 5LCFA 1JJEA 2YNTA 2BIBA 4V0HA 4C1FA 4D1WA 4RAMA 5LCHA 3IOGA 3T3NA 2CFUA 1XTOA 3P2UA 5ACPA 5B3RA 5ACVA 4AX1B 2NYPA 1KO2A 5EWAA 2FU8A 3SRXA 5LS3A 1YCFA
chains in the Genus database with same CATH topology
2YCBA 4DIKA 1X8GA 4Z5YA 3KNSA 4PVTA 4EY2A 3RKKA 2BGAA 4TZ9A 4P62A 2VW8A 2FK6A 4RL2A 4NQ5A 4Z67A 5HISA 4TZBA 4YSKA 3PY6A 5HIPA 3IE0A 3SD9A 2FU9A 4UWRB 3IE1A 3SFPA 4Z5ZA 2BFZA 3AJ3A 3ZR9A 2ZO4A 3PY5A 3LVZA 3IOFA 5FQAA 2Y87A 3ZWFA 3G1PA 2BG8B 4RL0A 4TYTA 5AEBA 1E5DA 5B1UA 3X2XA 4XWWA 5ACXA 2QJSA 2OHHA 2M5CA 5FQCA 3I11A 2GCUA 3IEMA 3BK1A 1ZKPA 1VMEA 1WUOA 5ACUA 4F6HA 2GFJA 4O98A 1BVTA 5EV8A 4EFZA 2YNTB 4UWOB 4TYFA 4KEPA 3IEKA 1QH3A 4JO0A 4RM5A 1BMCA 2ZNBA 2BMIA 3DH8A 4J5HA 4RBSA 5LLDA 3TP9A 2H6AA 2YNWA 5DPXA 5EH9A 3ZNBA 4CHLA 4HKYA 3S0ZA 4RAWA 4FSBA 1A8TA 1DD6A 2DOOA 2WRSA 3IE2A 1SMLA 2Q0IA 2UYXA 3ADRA 3VQZA 2P18A 4AX0B 2BFZB 5ACQA 2FM6A 5AXOA 3ZQ4A 4WD6A 4Z60A 4ZNBA 2AZ4A 2DKFA 4GYQA 3SW3A 4FEKA 2Y8BA 2NXAA 2ZZIA 2FHXA 3I14A 2NZEA 4EXYA 5LE1A 3PG4A 3I13A 1K07A 2AIOA 2Q9UA 3A4YA 2NZFA 4J5FA 2GFKA 4XWTA 4C09A 3T3OA 5HH5A 2QDSA 2OHJA 2M5DA 2P1EA 3KNRA 2WYLA 4C1DA 3SPUA 5K4NA 4D1UA 5IQKA 2QINA 5A87A 2R2DA 4UBQA 3R2UA 3I0VA 5A0VA 5ACTA 3H3EA 2BFLA 3L6NA 2HB9A 4Z6XA 3AF5A 2Q0JA 5HIQA 5AHRA 1P9EA 1M2XA 1QH5A 4B87A 5EV6A 2QEDA 5K0WA 1WUPA 3BK2A 1KO3A 5EVBA 4U4LA 3T9MA 3RPCA 4YSLA 2QDTA 3BV6A 2XF4A 4EXSA 1DXKA 4C1CA 4D1VA 4AD9A 3KL7A 5AHOA 1L9YA 1MQOA 5EHTA 1HLKA 2FHXB 2BG2A 2YNUA 4AWZA 1WW1A 2GMNA 4EYLA 2YNVA 3SBLA 1X8HA 3BC2A 2GKLA 2CBNA 3Q6VA 3IDZA 5AYAA 3IELA 4D1TA 2E7YA 5KILA 4ZO3A 1YCGA 3FAIA 2Y8AA 4NQ2A 2FU6A 2ZWRA 4Z7RA 2BG7A 3DHCA 2A7MA 4BP0A 2OHIA 4C1EA 5A5ZA 3RKJA 3QH8A 2WYMA 5LM6A 5A0TA 1A7TA 1VGNA 4D02A 4FR7A 4EYBA 2BFKA 4F6ZA 1JT1A 2I7XA 5HH4A 1X8IA 1XM8A 5LMCA 4GCWA 5ACSA 2I7VA 2Q42A 4UA4A 2BG6A 2WHGA 2YZ3A 3X2ZA 1WRAA 5B15A 4PVOA 1YCHA 5KIKA 1BC2A 5EVKA 5K4KA 4UAMA 4DILA 5ACRA 4TZEA 5EW0A 5ACWA 4TZFA 4KEQA 4ZO2A 2BC2A 3FCZA 4C1HA 5LSCA 3DHBA 3DHAA 4LE6A 1DDKA 5HIOA 4YSBA 4HL2A 2YNVB 1ZTCA 3MD7A 1VJNA 3F9OA 3ESHA 1JJTA 3I15A 1ZNBA 3VPEA 4C1GA 4XUKA 4H0DA 2XR1A 2P4ZA 4UWSB 2FU7A 3WXCA 5EVDA 2BTNA 4HL1A 4EYFA 4AWYB 4NQ6A 4ZEJA 5AXRA 5K4MA 2BG8A 4NQ4A 2BR6A 5LCAA 4BZ3A 3AF6A 4UWPB 1Y44A 3X30A 1KR3A 2I7TA 2P97A 4GYUA 5FQBA 3X2YA 2WYMC 3JXPA 5HH6A 5LCFA 1JJEA 2YNTA 4D1WA 2BIBA 4V0HA 4C1FA 4RAMA 5LCHA 3IOGA 3T3NA 1XTOA 3P2UA 5ACPA 5B3RA 5ACVA 4AX1B 2NYPA 1KO2A 5EWAA 2FU8A 3SRXA 5LS3A 1YCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YCB A;  4DIK A;  1X8G A;  4Z5Y A;  3KNS A;  4PVT A;  4EY2 A;  3RKK A;  2BGA A;  4TZ9 A;  4P62 A;  2VW8 A;  2FK6 A;  4RL2 A;  4NQ5 A;  4Z67 A;  5HIS A;  4TZB A;  4YSK A;  3PY6 A;  5HIP A;  3IE0 A;  3SD9 A;  2FU9 A;  4UWR B;  3IE1 A;  3SFP A;  4Z5Z A;  2BFZ A;  3AJ3 A;  3ZR9 A;  2ZO4 A;  3PY5 A;  3LVZ A;  3IOF A;  5FQA A;  2Y87 A;  3ZWF A;  3G1P A;  2BG8 B;  4RL0 A;  4TYT A;  5AEB A;  1E5D A;  5B1U A;  3X2X A;  4XWW A;  5ACX A;  2QJS A;  2OHH A;  2M5C A;  5FQC A;  3I11 A;  2GCU A;  3IEM A;  3BK1 A;  1ZKP A;  1VME A;  1WUO A;  5ACU A;  4F6H A;  2GFJ A;  4O98 A;  1BVT A;  5EV8 A;  4EFZ A;  2YNT B;  4UWO B;  4TYF A;  4KEP A;  3IEK A;  1QH3 A;  4JO0 A;  4RM5 A;  1BMC A;  2ZNB A;  2BMI A;  3DH8 A;  4J5H A;  4RBS A;  5LLD A;  3TP9 A;  2H6A A;  2YNW A;  5DPX A;  5EH9 A;  3ZNB A;  4CHL A;  4HKY A;  3S0Z A;  4RAW A;  4FSB A;  1A8T A;  1DD6 A;  2DOO A;  2WRS A;  3IE2 A;  1SML A;  2Q0I A;  2UYX A;  3ADR A;  3VQZ A;  2P18 A;  4AX0 B;  2BFZ B;  5ACQ A;  2FM6 A;  5AXO A;  3ZQ4 A;  4WD6 A;  4Z60 A;  4ZNB A;  2AZ4 A;  2DKF A;  4GYQ A;  3SW3 A;  4FEK A;  2Y8B A;  2NXA A;  2ZZI A;  2FHX A;  3I14 A;  2NZE A;  4EXY A;  5LE1 A;  3PG4 A;  3I13 A;  1K07 A;  2AIO A;  2Q9U A;  3A4Y A;  2NZF A;  4J5F A;  2GFK A;  4XWT A;  4C09 A;  3T3O A;  5HH5 A;  2QDS A;  2OHJ A;  2M5D A;  2P1E A;  3KNR A;  2WYL A;  4C1D A;  3SPU A;  5K4N A;  4D1U A;  5IQK A;  2QIN A;  5A87 A;  2R2D A;  4UBQ A;  3R2U A;  3I0V A;  5A0V A;  5ACT A;  3H3E A;  2BFL A;  3L6N A;  2HB9 A;  4Z6X A;  3AF5 A;  2Q0J A;  5HIQ A;  5AHR A;  1P9E A;  1M2X A;  1QH5 A;  4B87 A;  5EV6 A;  2QED A;  5K0W A;  1WUP A;  3BK2 A;  1KO3 A;  5EVB A;  4U4L A;  3T9M A;  3RPC A;  4YSL A;  2QDT A;  3BV6 A;  2XF4 A;  4EXS A;  1DXK A;  4C1C A;  4D1V A;  4AD9 A;  3KL7 A;  5AHO A;  1L9Y A;  1MQO A;  5EHT A;  1HLK A;  2FHX B;  2BG2 A;  2YNU A;  4AWZ A;  1WW1 A;  2GMN A;  4EYL A;  2YNV A;  3SBL A;  1X8H A;  3BC2 A;  2GKL A;  2CBN A;  3Q6V A;  3IDZ A;  5AYA A;  3IEL A;  4D1T A;  2E7Y A;  5KIL A;  4ZO3 A;  1YCG A;  3FAI A;  2Y8A A;  4NQ2 A;  2FU6 A;  2ZWR A;  4Z7R A;  2BG7 A;  3DHC A;  2A7M A;  4BP0 A;  2OHI A;  4C1E A;  5A5Z A;  3RKJ A;  3QH8 A;  2WYM A;  5LM6 A;  5A0T A;  1A7T A;  1VGN A;  4D02 A;  4FR7 A;  4EYB A;  2BFK A;  4F6Z A;  1JT1 A;  2I7X A;  5HH4 A;  1X8I A;  1XM8 A;  5LMC A;  4GCW A;  5ACS A;  2I7V A;  2Q42 A;  4UA4 A;  2BG6 A;  2WHG A;  2YZ3 A;  3X2Z A;  1WRA A;  5B15 A;  4PVO A;  1YCH A;  5KIK A;  1BC2 A;  5EVK A;  5K4K A;  4UAM A;  4DIL A;  5ACR A;  4TZE A;  5EW0 A;  5ACW A;  4TZF A;  4KEQ A;  4ZO2 A;  2BC2 A;  3FCZ A;  4C1H A;  5LSC A;  3DHB A;  3DHA A;  4LE6 A;  1DDK A;  5HIO A;  4YSB A;  4HL2 A;  2YNV B;  1ZTC A;  3MD7 A;  1VJN A;  3F9O A;  3ESH A;  1JJT A;  3I15 A;  1ZNB A;  3VPE A;  4C1G A;  4XUK A;  4H0D A;  2XR1 A;  2P4Z A;  4UWS B;  2FU7 A;  3WXC A;  5EVD A;  2BTN A;  4HL1 A;  4EYF A;  4AWY B;  4NQ6 A;  4ZEJ A;  5AXR A;  5K4M A;  2BG8 A;  4NQ4 A;  2BR6 A;  5LCA A;  4BZ3 A;  3AF6 A;  4UWP B;  1Y44 A;  3X30 A;  1KR3 A;  2I7T A;  2P97 A;  4GYU A;  5FQB A;  3X2Y A;  2WYM C;  3JXP A;  5HH6 A;  5LCF A;  1JJE A;  2YNT A;  4D1W A;  2BIB A;  4V0H A;  4C1F A;  4RAM A;  5LCH A;  3IOG A;  3T3N A;  1XTO A;  3P2U A;  5ACP A;  5B3R A;  5ACV A;  4AX1 B;  2NYP A;  1KO2 A;  5EWA A;  2FU8 A;  3SRX A;  5LS3 A;  1YCF A; 
#chains in the Genus database with same CATH topology
 2YCB A;  4DIK A;  1X8G A;  4Z5Y A;  3KNS A;  4PVT A;  4EY2 A;  3RKK A;  2BGA A;  4TZ9 A;  4P62 A;  2VW8 A;  2FK6 A;  4RL2 A;  4NQ5 A;  4Z67 A;  5HIS A;  4TZB A;  4YSK A;  3PY6 A;  5HIP A;  3IE0 A;  3SD9 A;  2FU9 A;  4UWR B;  3IE1 A;  3SFP A;  4Z5Z A;  2BFZ A;  3AJ3 A;  3ZR9 A;  2ZO4 A;  3PY5 A;  3LVZ A;  3IOF A;  5FQA A;  2Y87 A;  3ZWF A;  3G1P A;  2BG8 B;  4RL0 A;  4TYT A;  5AEB A;  1E5D A;  5B1U A;  3X2X A;  4XWW A;  5ACX A;  2QJS A;  2OHH A;  2M5C A;  4NUR A;  5FQC A;  3I11 A;  2GCU A;  3IEM A;  3BK1 A;  1ZKP A;  1VME A;  1WUO A;  5ACU A;  4F6H A;  2GFJ A;  4O98 A;  1BVT A;  5EV8 A;  4EFZ A;  2YNT B;  4UWO B;  4TYF A;  4KEP A;  3IEK A;  1QH3 A;  4AXH A;  4JO0 A;  4RM5 A;  5AJL A;  1BMC A;  2ZNB A;  2BMI A;  3DH8 A;  4J5H A;  4RBS A;  5LLD A;  3TP9 A;  2H6A A;  2YNW A;  5DPX A;  5EH9 A;  3ZNB A;  4CHL A;  4HKY A;  3S0Z A;  4RAW A;  4FSB A;  1A8T A;  1DD6 A;  2DOO A;  2WRS A;  3IE2 A;  1SML A;  2Q0I A;  2UYX A;  3ADR A;  3VQZ A;  2P18 A;  4AX0 B;  2BFZ B;  5ACQ A;  2FM6 A;  5AXO A;  3ZQ4 A;  4WD6 A;  4Z60 A;  4ZNB A;  2AZ4 A;  2DKF A;  4GYQ A;  3SW3 A;  4FEK A;  2Y8B A;  2NXA A;  2ZZI A;  2FHX A;  3I14 A;  2NZE A;  4EXY A;  5LE1 A;  4AV7 A;  3PG4 A;  2CG3 A;  3I13 A;  1K07 A;  2AIO A;  2Q9U A;  3A4Y A;  2NZF A;  4J5F A;  2GFK A;  4XWT A;  4C09 A;  3T3O A;  5HH5 A;  2QDS A;  2OHJ A;  2M5D A;  2P1E A;  3KNR A;  2WYL A;  4C1D A;  3SPU A;  5K4N A;  4D1U A;  5IQK A;  2QIN A;  5A87 A;  2R2D A;  4UBQ A;  3R2U A;  3I0V A;  5A0V A;  5ACT A;  3H3E A;  2BFL A;  3L6N A;  2HB9 A;  4Z6X A;  3AF5 A;  2Q0J A;  5HIQ A;  5AHR A;  1P9E A;  1M2X A;  1QH5 A;  4B87 A;  5EV6 A;  2QED A;  5K0W A;  1WUP A;  3BK2 A;  1KO3 A;  5EVB A;  5A23 A;  4U4L A;  3T9M A;  3RPC A;  4YSL A;  2QDT A;  3BV6 A;  2XF4 A;  4EXS A;  1DXK A;  4C1C A;  4D1V A;  4AD9 A;  3KL7 A;  5AHO A;  1L9Y A;  1MQO A;  5EHT A;  1HLK A;  2FHX B;  2BG2 A;  2YNU A;  4AWZ A;  1WW1 A;  2GMN A;  4EYL A;  2YNV A;  3SBL A;  1X8H A;  3BC2 A;  2GKL A;  2CBN A;  3Q6V A;  3IDZ A;  5AYA A;  2CFZ A;  3IEL A;  4D1T A;  2E7Y A;  5KIL A;  4ZO3 A;  1YCG A;  3FAI A;  2Y8A A;  4NQ2 A;  2FU6 A;  2ZWR A;  4Z7R A;  2BG7 A;  3DHC A;  2A7M A;  4BP0 A;  2OHI A;  4C1E A;  5A5Z A;  3RKJ A;  3QH8 A;  2WYM A;  5LM6 A;  5A0T A;  1A7T A;  1VGN A;  4D02 A;  4FR7 A;  4EYB A;  2BFK A;  4F6Z A;  1JT1 A;  2I7X A;  5HH4 A;  1X8I A;  1XM8 A;  5LMC A;  4GCW A;  5ACS A;  2I7V A;  2Q42 A;  4UA4 A;  2BG6 A;  2WHG A;  2YZ3 A;  3X2Z A;  1WRA A;  5B15 A;  4PVO A;  1YCH A;  5KIK A;  1BC2 A;  5EVK A;  5K4K A;  4UAM A;  4DIL A;  5ACR A;  2CG2 A;  4TZE A;  5EW0 A;  5ACW A;  4TZF A;  4KEQ A;  4ZO2 A;  2BC2 A;  3FCZ A;  4C1H A;  5LSC A;  3DHB A;  3DHA A;  4PDX A;  4LE6 A;  1DDK A;  5HIO A;  4YSB A;  4HL2 A;  2YNV B;  1ZTC A;  3MD7 A;  1VJN A;  3F9O A;  3ESH A;  1JJT A;  3I15 A;  1ZNB A;  2YHE A;  3VPE A;  4C1G A;  4XUK A;  4H0D A;  2XR1 A;  2P4Z A;  4UWS B;  2FU7 A;  3WXC A;  5EVD A;  2BTN A;  4HL1 A;  5AIJ A;  4EYF A;  4AWY B;  4NQ6 A;  4ZEJ A;  5AXR A;  5K4M A;  2BG8 A;  4NQ4 A;  2BR6 A;  5LCA A;  4BZ3 A;  3AF6 A;  4UWP B;  1Y44 A;  3X30 A;  1KR3 A;  2I7T A;  2P97 A;  4GYU A;  5FQB A;  3X2Y A;  2WYM C;  3JXP A;  5HH6 A;  5LCF A;  1JJE A;  2YNT A;  2BIB A;  4V0H A;  4C1F A;  4D1W A;  4RAM A;  5LCH A;  3IOG A;  3T3N A;  2CFU A;  1XTO A;  3P2U A;  5ACP A;  5B3R A;  5ACV A;  4AX1 B;  2NYP A;  1KO2 A;  5EWA A;  2FU8 A;  3SRX A;  5LS3 A;  1YCF A; 
#chains in the Genus database with same CATH homology
 2YCB A;  4DIK A;  1X8G A;  4Z5Y A;  3KNS A;  4PVT A;  4EY2 A;  3RKK A;  2BGA A;  4TZ9 A;  4P62 A;  2VW8 A;  2FK6 A;  4RL2 A;  4NQ5 A;  4Z67 A;  5HIS A;  4TZB A;  4YSK A;  3PY6 A;  5HIP A;  3IE0 A;  3SD9 A;  2FU9 A;  4UWR B;  3IE1 A;  3SFP A;  4Z5Z A;  2BFZ A;  3AJ3 A;  3ZR9 A;  2ZO4 A;  3PY5 A;  3LVZ A;  3IOF A;  5FQA A;  2Y87 A;  3ZWF A;  3G1P A;  2BG8 B;  4RL0 A;  4TYT A;  5AEB A;  1E5D A;  5B1U A;  3X2X A;  4XWW A;  5ACX A;  2QJS A;  2OHH A;  2M5C A;  5FQC A;  3I11 A;  2GCU A;  3IEM A;  3BK1 A;  1ZKP A;  1VME A;  1WUO A;  5ACU A;  4F6H A;  2GFJ A;  4O98 A;  1BVT A;  5EV8 A;  4EFZ A;  2YNT B;  4UWO B;  4TYF A;  4KEP A;  3IEK A;  1QH3 A;  4JO0 A;  4RM5 A;  1BMC A;  2ZNB A;  2BMI A;  3DH8 A;  4J5H A;  4RBS A;  5LLD A;  3TP9 A;  2H6A A;  2YNW A;  5DPX A;  5EH9 A;  3ZNB A;  4CHL A;  4HKY A;  3S0Z A;  4RAW A;  4FSB A;  1A8T A;  1DD6 A;  2DOO A;  2WRS A;  3IE2 A;  1SML A;  2Q0I A;  2UYX A;  3ADR A;  3VQZ A;  2P18 A;  4AX0 B;  2BFZ B;  5ACQ A;  2FM6 A;  5AXO A;  3ZQ4 A;  4WD6 A;  4Z60 A;  4ZNB A;  2AZ4 A;  2DKF A;  4GYQ A;  3SW3 A;  4FEK A;  2Y8B A;  2NXA A;  2ZZI A;  2FHX A;  3I14 A;  2NZE A;  4EXY A;  5LE1 A;  3PG4 A;  3I13 A;  1K07 A;  2AIO A;  2Q9U A;  3A4Y A;  2NZF A;  4J5F A;  2GFK A;  4XWT A;  4C09 A;  3T3O A;  5HH5 A;  2QDS A;  2OHJ A;  2M5D A;  2P1E A;  3KNR A;  2WYL A;  4C1D A;  3SPU A;  5K4N A;  4D1U A;  5IQK A;  2QIN A;  5A87 A;  2R2D A;  4UBQ A;  3R2U A;  3I0V A;  5A0V A;  5ACT A;  3H3E A;  2BFL A;  3L6N A;  2HB9 A;  4Z6X A;  3AF5 A;  2Q0J A;  5HIQ A;  5AHR A;  1P9E A;  1M2X A;  1QH5 A;  4B87 A;  5EV6 A;  2QED A;  5K0W A;  1WUP A;  3BK2 A;  1KO3 A;  5EVB A;  4U4L A;  3T9M A;  3RPC A;  4YSL A;  2QDT A;  3BV6 A;  2XF4 A;  4EXS A;  1DXK A;  4C1C A;  4D1V A;  4AD9 A;  3KL7 A;  5AHO A;  1L9Y A;  1MQO A;  5EHT A;  1HLK A;  2FHX B;  2BG2 A;  2YNU A;  4AWZ A;  1WW1 A;  2GMN A;  4EYL A;  2YNV A;  3SBL A;  1X8H A;  3BC2 A;  2GKL A;  2CBN A;  3Q6V A;  3IDZ A;  5AYA A;  3IEL A;  4D1T A;  2E7Y A;  5KIL A;  4ZO3 A;  1YCG A;  3FAI A;  2Y8A A;  4NQ2 A;  2FU6 A;  2ZWR A;  4Z7R A;  2BG7 A;  3DHC A;  2A7M A;  4BP0 A;  2OHI A;  4C1E A;  5A5Z A;  3RKJ A;  3QH8 A;  2WYM A;  5LM6 A;  5A0T A;  1A7T A;  1VGN A;  4D02 A;  4FR7 A;  4EYB A;  2BFK A;  4F6Z A;  1JT1 A;  2I7X A;  5HH4 A;  1X8I A;  1XM8 A;  5LMC A;  4GCW A;  5ACS A;  2I7V A;  2Q42 A;  4UA4 A;  2BG6 A;  2WHG A;  2YZ3 A;  3X2Z A;  1WRA A;  5B15 A;  4PVO A;  1YCH A;  5KIK A;  1BC2 A;  5EVK A;  5K4K A;  4UAM A;  4DIL A;  5ACR A;  4TZE A;  5EW0 A;  5ACW A;  4TZF A;  4KEQ A;  4ZO2 A;  2BC2 A;  3FCZ A;  4C1H A;  5LSC A;  3DHB A;  3DHA A;  4LE6 A;  1DDK A;  5HIO A;  4YSB A;  4HL2 A;  2YNV B;  1ZTC A;  3MD7 A;  1VJN A;  3F9O A;  3ESH A;  1JJT A;  3I15 A;  1ZNB A;  3VPE A;  4C1G A;  4XUK A;  4H0D A;  2XR1 A;  2P4Z A;  4UWS B;  2FU7 A;  3WXC A;  5EVD A;  2BTN A;  4HL1 A;  4EYF A;  4AWY B;  4NQ6 A;  4ZEJ A;  5AXR A;  5K4M A;  2BG8 A;  4NQ4 A;  2BR6 A;  5LCA A;  4BZ3 A;  3AF6 A;  4UWP B;  1Y44 A;  3X30 A;  1KR3 A;  2I7T A;  2P97 A;  4GYU A;  5FQB A;  3X2Y A;  2WYM C;  3JXP A;  5HH6 A;  5LCF A;  1JJE A;  2YNT A;  4D1W A;  2BIB A;  4V0H A;  4C1F A;  4RAM A;  5LCH A;  3IOG A;  3T3N A;  1XTO A;  3P2U A;  5ACP A;  5B3R A;  5ACV A;  4AX1 B;  2NYP A;  1KO2 A;  5EWA A;  2FU8 A;  3SRX A;  5LS3 A;  1YCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...