1WUOA

Crystal structure of metallo-beta-lactamase imp-1 mutant (d81a)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
219
structure length
218
Chain Sequence
SLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSASTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the role of Asp-120(81) of metallo-beta-lactamase (IMP-1) by site-directed mutagenesis, kinetic studies, and X-ray crystallography.
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Hydrolase
molecule keywords Beta-lactamase IMP-1
total genus 61
structure length 218
sequence length 219
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2004-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1wuoA00
3G1PA 3AF5A 4C1DA 4EXSA 2I7TA 5EHTA 1ZTCA 3RPCA 1XTOA 2BC2A 4BP0A 2XF4A 3IEMA 4RBSA 3BK1A 2GCUA 1P9EA 2FM6A 1VGNA 2XR1A 1DD6A 3ESHA 4ZEJA 1X8IA 1A7TA 5HH5A 1X8HA 1QH3A 3SW3A 4Z7RA 4Z5YA 1YCFA 1SMLA 2BG7A 3I0VA 3I14A 3X30A 2FHXB 1YCHA 4TZBA 2YNTB 4F6ZA 5AXOA 4EYBA 2WYMA 3SBLA 2BGAA 4J5HA 2QINA 4NQ5A 5B3RA 4TZFA 4J5FA 5FQBA 5A87A 3BV6A 1KR3A 4NQ6A 2QDTA 4V0HA 4RAMA 3ZQ4A 4D1TA 4UBQA 1E5DA 2E7YA 3L6NA 3T3OA 2FU8A 2DOOA 3PY5A 2FU9A 2Q0JA 3RKKA 4NQ4A 3X2XA 1L9YA 5HH4A 4C1HA 5FQAA 1BVTA 5EVKA 3IOGA 3KL7A 4C1EA 5AHRA 2CBNA 3RKJA 2WYLA 4YSBA 5K4KA 2NZEA 3S0ZA 2YZ3A 2ZO4A 2BR6A 4EYLA 2BG8A 2QJSA 4GCWA 2AZ4A 3H3EA 4NQ2A 5LCFA 2FHXA 4RAWA 5ACWA 2P97A 3LVZA 2BIBA 2YNUA 4UWRB 3IE0A 5A0TA 4TYFA 2YNTA 2Y8BA 5ACVA 5LLDA 5LCHA 4ZO2A 1KO2A 4GYQA 3DHCA 2OHHA 4C1GA 4ZO3A 3Q6VA 4TZ9A 4Z6XA 5ACTA 2AIOA 4C1CA 5K0WA 4TYTA 1VJNA 4D1UA 4XWWA 3MD7A 4EFZA 5EWAA 5ACXA 5A0VA 5AHOA 3WXCA 5ACRA 2BG6A 3SPUA 4KEQA 3PY6A 4FR7A 4YSLA 3T3NA 5ACUA 4TZEA 3BK2A 2BTNA 1KO3A 3IE1A 3I13A 3PG4A 5FQCA 5KILA 3KNSA 4UWOB 4CHLA 3IELA 5K4MA 2QDSA 3R2UA 1WW1A 3P2UA 2I7VA 2YNVB 3JXPA 2YCBA 4FEKA 2VW8A 2P18A 1Y44A 5HIOA 4RM5A 3VPEA 2NXAA 4B87A 3AJ3A 4EY2A 1QH5A 4UWSB 2Q0IA 5ACPA 4ZNBA 5LSCA 2FU7A 2BG8B 2HB9A 4AX1B 2BMIA 4EYFA 4EXYA 2BFZB 5HISA 2BFLA 4AD9A 1JJTA 2QEDA 1JJEA 1DDKA 1WUOA 4D02A 3BC2A 2FU6A 3TP9A 3FAIA 2P4ZA 5KIKA 3T9MA 4O98A 4UWPB 5HIQA 4PVOA 4PVTA 2BFKA 4RL0A 2Q42A 3A4YA 4C09A 4UA4A 4D1WA 5EW0A 4Z67A 4AX0B 3IDZA 5EV8A 4FSBA 5DPXA 3ADRA 4RL2A 4Z60A 5LS3A 3DHAA 2OHIA 3AF6A 4Z5ZA 2GFKA 2WRSA 1A8TA 5K4NA 5HH6A 4BZ3A 4P62A 5EVDA 1YCGA 4XWTA 2ZNBA 5A5ZA 1X8GA 1HLKA 2Y8AA 5HIPA 2GMNA 2ZWRA 4DILA 4C1FA 4XUKA 4GYUA 2YNVA 2ZZIA 5IQKA 4KEPA 1JT1A 2M5CA 2M5DA 4H0DA 2OHJA 4LE6A 2BFZA 3X2YA 3IOFA 3X2ZA 1WUPA 1BC2A 3DH8A 4F6HA 1VMEA 4JO0A 4WD6A 5ACQA 2A7MA 4U4LA 2H6AA 3I11A 4HL2A 3ZWFA 2DKFA 2NYPA 5EH9A 1MQOA 2BG2A 4HL1A 5B1UA 5LCAA 5EVBA 3SD9A 1K07A 2FK6A 4DIKA 1ZNBA 5B15A 4HKYA 2NZFA 2WHGA 3IE2A 4YSKA 5LM6A 3KNRA 4AWZA 3IEKA 5ACSA 3VQZA 1WRAA 2YNWA 1ZKPA 5AEBA 2Y87A 4UAMA 1BMCA 4D1VA 3FCZA 5LMCA 5AXRA 3QH8A 2GKLA 1M2XA 5AYAA 2UYXA 5LE1A 1DXKA 3SFPA 2GFJA 2Q9UA 3I15A 4AWYB 3F9OA 2P1EA 3ZNBA 3ZR9A 2I7XA 1XM8A 2WYMC 5EV6A 3SRXA 3DHBA 2R2DA
chains in the Genus database with same CATH superfamily
3G1PA 3AF5A 4C1DA 4EXSA 2I7TA 5EHTA 1ZTCA 3RPCA 2CFUA 1XTOA 2BC2A 4BP0A 2XF4A 3IEMA 4RBSA 3BK1A 2GCUA 1P9EA 2FM6A 1VGNA 2XR1A 4PDXA 1DD6A 3ESHA 4ZEJA 1X8IA 1A7TA 5HH5A 1X8HA 1QH3A 3SW3A 4Z7RA 4Z5YA 1YCFA 1SMLA 2BG7A 3I0VA 3I14A 3X30A 2FHXB 2CG2A 1YCHA 4TZBA 2YNTB 4F6ZA 5AXOA 4EYBA 2WYMA 3SBLA 2BGAA 4J5HA 2QINA 4NQ5A 5B3RA 4TZFA 5AJLA 4J5FA 5FQBA 5A87A 3BV6A 4AV7A 1KR3A 4NQ6A 2QDTA 4V0HA 4RAMA 3ZQ4A 4D1TA 4UBQA 1E5DA 2E7YA 3L6NA 3T3OA 2FU8A 2DOOA 3PY5A 2FU9A 2Q0JA 3RKKA 4NQ4A 3X2XA 1L9YA 5HH4A 4C1HA 5FQAA 1BVTA 5EVKA 3IOGA 3KL7A 4C1EA 5AHRA 2CBNA 3RKJA 2WYLA 4YSBA 5K4KA 2NZEA 3S0ZA 2YZ3A 2ZO4A 2BR6A 4EYLA 2BG8A 2QJSA 4GCWA 2AZ4A 3H3EA 4NQ2A 5LCFA 2FHXA 4RAWA 5ACWA 2P97A 3LVZA 2BIBA 2YNUA 4UWRB 3IE0A 5A0TA 4TYFA 2YNTA 2Y8BA 5ACVA 5LLDA 5LCHA 5AIJA 4ZO2A 1KO2A 4GYQA 3DHCA 2OHHA 4C1GA 4ZO3A 3Q6VA 4TZ9A 4Z6XA 5ACTA 2AIOA 4C1CA 5K0WA 4TYTA 1VJNA 5A23A 4D1UA 4XWWA 3MD7A 4EFZA 5EWAA 5ACXA 5A0VA 5AHOA 3WXCA 5ACRA 2BG6A 3SPUA 4KEQA 3PY6A 4FR7A 4YSLA 3T3NA 5ACUA 4TZEA 3BK2A 2BTNA 1KO3A 3IE1A 3I13A 3PG4A 5FQCA 5KILA 3KNSA 4UWOB 4CHLA 4NURA 3IELA 5K4MA 2QDSA 3R2UA 1WW1A 3P2UA 2I7VA 2YNVB 3JXPA 2YCBA 4FEKA 2VW8A 2P18A 1Y44A 5HIOA 4RM5A 3VPEA 2NXAA 4B87A 3AJ3A 4EY2A 1QH5A 4AXHA 2CFZA 4UWSB 2Q0IA 5ACPA 4ZNBA 5LSCA 2FU7A 2BG8B 2HB9A 4AX1B 2BMIA 4EYFA 4EXYA 2BFZB 5HISA 2BFLA 4AD9A 1JJTA 2QEDA 1JJEA 1DDKA 1WUOA 4D02A 3BC2A 2FU6A 3TP9A 3FAIA 2P4ZA 2YHEA 5KIKA 3T9MA 4O98A 4UWPB 5HIQA 4PVOA 4PVTA 2BFKA 4RL0A 2Q42A 3A4YA 2CG3A 4C09A 4UA4A 4D1WA 5EW0A 4Z67A 4AX0B 3IDZA 5EV8A 4FSBA 5DPXA 3ADRA 4RL2A 4Z60A 5LS3A 3DHAA 2OHIA 3AF6A 4Z5ZA 2GFKA 2WRSA 1A8TA 5K4NA 5HH6A 4BZ3A 4P62A 5EVDA 1YCGA 4XWTA 2ZNBA 5A5ZA 1X8GA 1HLKA 2Y8AA 5HIPA 2GMNA 2ZWRA 4DILA 4C1FA 4XUKA 4GYUA 2YNVA 2ZZIA 5IQKA 4KEPA 1JT1A 2M5CA 2M5DA 4H0DA 2OHJA 4LE6A 2BFZA 3X2YA 3IOFA 3X2ZA 1WUPA 1BC2A 3DH8A 4F6HA 1VMEA 4JO0A 4WD6A 5ACQA 2A7MA 4U4LA 2H6AA 3I11A 4HL2A 3ZWFA 2DKFA 2NYPA 5EH9A 1MQOA 2BG2A 4HL1A 5B1UA 5LCAA 5EVBA 3SD9A 1K07A 2FK6A 4DIKA 1ZNBA 5B15A 4HKYA 2NZFA 2WHGA 3IE2A 4YSKA 5LM6A 3KNRA 4AWZA 3IEKA 5ACSA 3VQZA 1WRAA 2YNWA 1ZKPA 5AEBA 2Y87A 4UAMA 1BMCA 4D1VA 3FCZA 5LMCA 5AXRA 3QH8A 2GKLA 1M2XA 5AYAA 2UYXA 5LE1A 1DXKA 3SFPA 2GFJA 2Q9UA 3I15A 4AWYB 3F9OA 2P1EA 3ZNBA 3ZR9A 2I7XA 1XM8A 2WYMC 5EV6A 3SRXA 3DHBA 2R2DA
chains in the Genus database with same CATH topology
3G1PA 3AF5A 4C1DA 4EXSA 2I7TA 5EHTA 1ZTCA 3RPCA 1XTOA 2BC2A 4BP0A 2XF4A 3IEMA 4RBSA 3BK1A 2GCUA 1P9EA 2FM6A 1VGNA 2XR1A 1DD6A 3ESHA 4ZEJA 1X8IA 1A7TA 5HH5A 1X8HA 1QH3A 3SW3A 4Z7RA 4Z5YA 1YCFA 1SMLA 2BG7A 3I0VA 3I14A 3X30A 2FHXB 1YCHA 4TZBA 2YNTB 4F6ZA 5AXOA 4EYBA 2WYMA 3SBLA 2BGAA 4J5HA 2QINA 4NQ5A 5B3RA 4TZFA 4J5FA 5FQBA 5A87A 3BV6A 1KR3A 4NQ6A 2QDTA 4V0HA 4RAMA 3ZQ4A 4D1TA 4UBQA 1E5DA 2E7YA 3L6NA 3T3OA 2FU8A 2DOOA 3PY5A 2FU9A 2Q0JA 3RKKA 4NQ4A 3X2XA 1L9YA 5HH4A 4C1HA 5FQAA 1BVTA 5EVKA 3IOGA 3KL7A 4C1EA 5AHRA 2CBNA 3RKJA 2WYLA 4YSBA 5K4KA 2NZEA 3S0ZA 2YZ3A 2ZO4A 2BR6A 4EYLA 2BG8A 2QJSA 4GCWA 2AZ4A 3H3EA 4NQ2A 5LCFA 2FHXA 4RAWA 5ACWA 2P97A 3LVZA 2BIBA 2YNUA 4UWRB 3IE0A 5A0TA 4TYFA 2YNTA 2Y8BA 5ACVA 5LLDA 5LCHA 4ZO2A 1KO2A 4GYQA 3DHCA 2OHHA 4C1GA 4ZO3A 3Q6VA 4TZ9A 4Z6XA 5ACTA 2AIOA 4C1CA 5K0WA 4TYTA 1VJNA 4D1UA 4XWWA 3MD7A 4EFZA 5EWAA 5ACXA 5A0VA 5AHOA 3WXCA 5ACRA 2BG6A 3SPUA 4KEQA 3PY6A 4FR7A 4YSLA 3T3NA 5ACUA 4TZEA 3BK2A 2BTNA 1KO3A 3IE1A 3I13A 3PG4A 5FQCA 5KILA 3KNSA 4UWOB 4CHLA 3IELA 5K4MA 2QDSA 3R2UA 1WW1A 3P2UA 2I7VA 2YNVB 3JXPA 2YCBA 4FEKA 2VW8A 2P18A 1Y44A 5HIOA 4RM5A 3VPEA 2NXAA 4B87A 3AJ3A 4EY2A 1QH5A 4UWSB 2Q0IA 5ACPA 4ZNBA 5LSCA 2FU7A 2BG8B 2HB9A 4AX1B 2BMIA 4EYFA 4EXYA 2BFZB 5HISA 2BFLA 4AD9A 1JJTA 2QEDA 1JJEA 1DDKA 1WUOA 4D02A 3BC2A 2FU6A 3TP9A 3FAIA 2P4ZA 5KIKA 3T9MA 4O98A 4UWPB 5HIQA 4PVOA 4PVTA 2BFKA 4RL0A 2Q42A 3A4YA 4C09A 4UA4A 4D1WA 5EW0A 4Z67A 4AX0B 3IDZA 5EV8A 4FSBA 5DPXA 3ADRA 4RL2A 4Z60A 5LS3A 3DHAA 2OHIA 3AF6A 4Z5ZA 2GFKA 2WRSA 1A8TA 5K4NA 5HH6A 4BZ3A 4P62A 5EVDA 1YCGA 4XWTA 2ZNBA 5A5ZA 1X8GA 1HLKA 2Y8AA 5HIPA 2GMNA 2ZWRA 4DILA 4C1FA 4XUKA 4GYUA 2YNVA 2ZZIA 5IQKA 4KEPA 1JT1A 2M5CA 2M5DA 4H0DA 2OHJA 4LE6A 2BFZA 3X2YA 3IOFA 3X2ZA 1WUPA 1BC2A 3DH8A 4F6HA 1VMEA 4JO0A 4WD6A 5ACQA 2A7MA 4U4LA 2H6AA 3I11A 4HL2A 3ZWFA 2DKFA 2NYPA 5EH9A 1MQOA 2BG2A 4HL1A 5B1UA 5LCAA 5EVBA 3SD9A 1K07A 2FK6A 4DIKA 1ZNBA 5B15A 4HKYA 2NZFA 2WHGA 3IE2A 4YSKA 5LM6A 3KNRA 4AWZA 3IEKA 5ACSA 3VQZA 1WRAA 2YNWA 1ZKPA 5AEBA 2Y87A 4UAMA 1BMCA 4D1VA 3FCZA 5LMCA 5AXRA 3QH8A 2GKLA 1M2XA 5AYAA 2UYXA 5LE1A 1DXKA 3SFPA 2GFJA 2Q9UA 3I15A 4AWYB 3F9OA 2P1EA 3ZNBA 3ZR9A 2I7XA 1XM8A 2WYMC 5EV6A 3SRXA 3DHBA 2R2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G1P A;  3AF5 A;  4C1D A;  4EXS A;  2I7T A;  5EHT A;  1ZTC A;  3RPC A;  1XTO A;  2BC2 A;  4BP0 A;  2XF4 A;  3IEM A;  4RBS A;  3BK1 A;  2GCU A;  1P9E A;  2FM6 A;  1VGN A;  2XR1 A;  1DD6 A;  3ESH A;  4ZEJ A;  1X8I A;  1A7T A;  5HH5 A;  1X8H A;  1QH3 A;  3SW3 A;  4Z7R A;  4Z5Y A;  1YCF A;  1SML A;  2BG7 A;  3I0V A;  3I14 A;  3X30 A;  2FHX B;  1YCH A;  4TZB A;  2YNT B;  4F6Z A;  5AXO A;  4EYB A;  2WYM A;  3SBL A;  2BGA A;  4J5H A;  2QIN A;  4NQ5 A;  5B3R A;  4TZF A;  4J5F A;  5FQB A;  5A87 A;  3BV6 A;  1KR3 A;  4NQ6 A;  2QDT A;  4V0H A;  4RAM A;  3ZQ4 A;  4D1T A;  4UBQ A;  1E5D A;  2E7Y A;  3L6N A;  3T3O A;  2FU8 A;  2DOO A;  3PY5 A;  2FU9 A;  2Q0J A;  3RKK A;  4NQ4 A;  3X2X A;  1L9Y A;  5HH4 A;  4C1H A;  5FQA A;  1BVT A;  5EVK A;  3IOG A;  3KL7 A;  4C1E A;  5AHR A;  2CBN A;  3RKJ A;  2WYL A;  4YSB A;  5K4K A;  2NZE A;  3S0Z A;  2YZ3 A;  2ZO4 A;  2BR6 A;  4EYL A;  2BG8 A;  2QJS A;  4GCW A;  2AZ4 A;  3H3E A;  4NQ2 A;  5LCF A;  2FHX A;  4RAW A;  5ACW A;  2P97 A;  3LVZ A;  2BIB A;  2YNU A;  4UWR B;  3IE0 A;  5A0T A;  4TYF A;  2YNT A;  2Y8B A;  5ACV A;  5LLD A;  5LCH A;  4ZO2 A;  1KO2 A;  4GYQ A;  3DHC A;  2OHH A;  4C1G A;  4ZO3 A;  3Q6V A;  4TZ9 A;  4Z6X A;  5ACT A;  2AIO A;  4C1C A;  5K0W A;  4TYT A;  1VJN A;  4D1U A;  4XWW A;  3MD7 A;  4EFZ A;  5EWA A;  5ACX A;  5A0V A;  5AHO A;  3WXC A;  5ACR A;  2BG6 A;  3SPU A;  4KEQ A;  3PY6 A;  4FR7 A;  4YSL A;  3T3N A;  5ACU A;  4TZE A;  3BK2 A;  2BTN A;  1KO3 A;  3IE1 A;  3I13 A;  3PG4 A;  5FQC A;  5KIL A;  3KNS A;  4UWO B;  4CHL A;  3IEL A;  5K4M A;  2QDS A;  3R2U A;  1WW1 A;  3P2U A;  2I7V A;  2YNV B;  3JXP A;  2YCB A;  4FEK A;  2VW8 A;  2P18 A;  1Y44 A;  5HIO A;  4RM5 A;  3VPE A;  2NXA A;  4B87 A;  3AJ3 A;  4EY2 A;  1QH5 A;  4UWS B;  2Q0I A;  5ACP A;  4ZNB A;  5LSC A;  2FU7 A;  2BG8 B;  2HB9 A;  4AX1 B;  2BMI A;  4EYF A;  4EXY A;  2BFZ B;  5HIS A;  2BFL A;  4AD9 A;  1JJT A;  2QED A;  1JJE A;  1DDK A;  1WUO A;  4D02 A;  3BC2 A;  2FU6 A;  3TP9 A;  3FAI A;  2P4Z A;  5KIK A;  3T9M A;  4O98 A;  4UWP B;  5HIQ A;  4PVO A;  4PVT A;  2BFK A;  4RL0 A;  2Q42 A;  3A4Y A;  4C09 A;  4UA4 A;  4D1W A;  5EW0 A;  4Z67 A;  4AX0 B;  3IDZ A;  5EV8 A;  4FSB A;  5DPX A;  3ADR A;  4RL2 A;  4Z60 A;  5LS3 A;  3DHA A;  2OHI A;  3AF6 A;  4Z5Z A;  2GFK A;  2WRS A;  1A8T A;  5K4N A;  5HH6 A;  4BZ3 A;  4P62 A;  5EVD A;  1YCG A;  4XWT A;  2ZNB A;  5A5Z A;  1X8G A;  1HLK A;  2Y8A A;  5HIP A;  2GMN A;  2ZWR A;  4DIL A;  4C1F A;  4XUK A;  4GYU A;  2YNV A;  2ZZI A;  5IQK A;  4KEP A;  1JT1 A;  2M5C A;  2M5D A;  4H0D A;  2OHJ A;  4LE6 A;  2BFZ A;  3X2Y A;  3IOF A;  3X2Z A;  1WUP A;  1BC2 A;  3DH8 A;  4F6H A;  1VME A;  4JO0 A;  4WD6 A;  5ACQ A;  2A7M A;  4U4L A;  2H6A A;  3I11 A;  4HL2 A;  3ZWF A;  2DKF A;  2NYP A;  5EH9 A;  1MQO A;  2BG2 A;  4HL1 A;  5B1U A;  5LCA A;  5EVB A;  3SD9 A;  1K07 A;  2FK6 A;  4DIK A;  1ZNB A;  5B15 A;  4HKY A;  2NZF A;  2WHG A;  3IE2 A;  4YSK A;  5LM6 A;  3KNR A;  4AWZ A;  3IEK A;  5ACS A;  3VQZ A;  1WRA A;  2YNW A;  1ZKP A;  5AEB A;  2Y87 A;  4UAM A;  1BMC A;  4D1V A;  3FCZ A;  5LMC A;  5AXR A;  3QH8 A;  2GKL A;  1M2X A;  5AYA A;  2UYX A;  5LE1 A;  1DXK A;  3SFP A;  2GFJ A;  2Q9U A;  3I15 A;  4AWY B;  3F9O A;  2P1E A;  3ZNB A;  3ZR9 A;  2I7X A;  1XM8 A;  2WYM C;  5EV6 A;  3SRX A;  3DHB A;  2R2D A; 
#chains in the Genus database with same CATH topology
 3G1P A;  3AF5 A;  4C1D A;  4EXS A;  2I7T A;  5EHT A;  1ZTC A;  3RPC A;  2CFU A;  1XTO A;  2BC2 A;  4BP0 A;  2XF4 A;  3IEM A;  4RBS A;  3BK1 A;  2GCU A;  1P9E A;  2FM6 A;  1VGN A;  2XR1 A;  4PDX A;  1DD6 A;  3ESH A;  4ZEJ A;  1X8I A;  1A7T A;  5HH5 A;  1X8H A;  1QH3 A;  3SW3 A;  4Z7R A;  4Z5Y A;  1YCF A;  1SML A;  2BG7 A;  3I0V A;  3I14 A;  3X30 A;  2FHX B;  2CG2 A;  1YCH A;  4TZB A;  2YNT B;  4F6Z A;  5AXO A;  4EYB A;  2WYM A;  3SBL A;  2BGA A;  4J5H A;  2QIN A;  4NQ5 A;  5B3R A;  4TZF A;  5AJL A;  4J5F A;  5FQB A;  5A87 A;  3BV6 A;  4AV7 A;  1KR3 A;  4NQ6 A;  2QDT A;  4V0H A;  4RAM A;  3ZQ4 A;  4D1T A;  4UBQ A;  1E5D A;  2E7Y A;  3L6N A;  3T3O A;  2FU8 A;  2DOO A;  3PY5 A;  2FU9 A;  2Q0J A;  3RKK A;  4NQ4 A;  3X2X A;  1L9Y A;  5HH4 A;  4C1H A;  5FQA A;  1BVT A;  5EVK A;  3IOG A;  3KL7 A;  4C1E A;  5AHR A;  2CBN A;  3RKJ A;  2WYL A;  4YSB A;  5K4K A;  2NZE A;  3S0Z A;  2YZ3 A;  2ZO4 A;  2BR6 A;  4EYL A;  2BG8 A;  2QJS A;  4GCW A;  2AZ4 A;  3H3E A;  4NQ2 A;  5LCF A;  2FHX A;  4RAW A;  5ACW A;  2P97 A;  3LVZ A;  2BIB A;  2YNU A;  4UWR B;  3IE0 A;  5A0T A;  4TYF A;  2YNT A;  2Y8B A;  5ACV A;  5LLD A;  5LCH A;  5AIJ A;  4ZO2 A;  1KO2 A;  4GYQ A;  3DHC A;  2OHH A;  4C1G A;  4ZO3 A;  3Q6V A;  4TZ9 A;  4Z6X A;  5ACT A;  2AIO A;  4C1C A;  5K0W A;  4TYT A;  1VJN A;  5A23 A;  4D1U A;  4XWW A;  3MD7 A;  4EFZ A;  5EWA A;  5ACX A;  5A0V A;  5AHO A;  3WXC A;  5ACR A;  2BG6 A;  3SPU A;  4KEQ A;  3PY6 A;  4FR7 A;  4YSL A;  3T3N A;  5ACU A;  4TZE A;  3BK2 A;  2BTN A;  1KO3 A;  3IE1 A;  3I13 A;  3PG4 A;  5FQC A;  5KIL A;  3KNS A;  4UWO B;  4CHL A;  4NUR A;  3IEL A;  5K4M A;  2QDS A;  3R2U A;  1WW1 A;  3P2U A;  2I7V A;  2YNV B;  3JXP A;  2YCB A;  4FEK A;  2VW8 A;  2P18 A;  1Y44 A;  5HIO A;  4RM5 A;  3VPE A;  2NXA A;  4B87 A;  3AJ3 A;  4EY2 A;  1QH5 A;  4AXH A;  2CFZ A;  4UWS B;  2Q0I A;  5ACP A;  4ZNB A;  5LSC A;  2FU7 A;  2BG8 B;  2HB9 A;  4AX1 B;  2BMI A;  4EYF A;  4EXY A;  2BFZ B;  5HIS A;  2BFL A;  4AD9 A;  1JJT A;  2QED A;  1JJE A;  1DDK A;  1WUO A;  4D02 A;  3BC2 A;  2FU6 A;  3TP9 A;  3FAI A;  2P4Z A;  2YHE A;  5KIK A;  3T9M A;  4O98 A;  4UWP B;  5HIQ A;  4PVO A;  4PVT A;  2BFK A;  4RL0 A;  2Q42 A;  3A4Y A;  2CG3 A;  4C09 A;  4UA4 A;  4D1W A;  5EW0 A;  4Z67 A;  4AX0 B;  3IDZ A;  5EV8 A;  4FSB A;  5DPX A;  3ADR A;  4RL2 A;  4Z60 A;  5LS3 A;  3DHA A;  2OHI A;  3AF6 A;  4Z5Z A;  2GFK A;  2WRS A;  1A8T A;  5K4N A;  5HH6 A;  4BZ3 A;  4P62 A;  5EVD A;  1YCG A;  4XWT A;  2ZNB A;  5A5Z A;  1X8G A;  1HLK A;  2Y8A A;  5HIP A;  2GMN A;  2ZWR A;  4DIL A;  4C1F A;  4XUK A;  4GYU A;  2YNV A;  2ZZI A;  5IQK A;  4KEP A;  1JT1 A;  2M5C A;  2M5D A;  4H0D A;  2OHJ A;  4LE6 A;  2BFZ A;  3X2Y A;  3IOF A;  3X2Z A;  1WUP A;  1BC2 A;  3DH8 A;  4F6H A;  1VME A;  4JO0 A;  4WD6 A;  5ACQ A;  2A7M A;  4U4L A;  2H6A A;  3I11 A;  4HL2 A;  3ZWF A;  2DKF A;  2NYP A;  5EH9 A;  1MQO A;  2BG2 A;  4HL1 A;  5B1U A;  5LCA A;  5EVB A;  3SD9 A;  1K07 A;  2FK6 A;  4DIK A;  1ZNB A;  5B15 A;  4HKY A;  2NZF A;  2WHG A;  3IE2 A;  4YSK A;  5LM6 A;  3KNR A;  4AWZ A;  3IEK A;  5ACS A;  3VQZ A;  1WRA A;  2YNW A;  1ZKP A;  5AEB A;  2Y87 A;  4UAM A;  1BMC A;  4D1V A;  3FCZ A;  5LMC A;  5AXR A;  3QH8 A;  2GKL A;  1M2X A;  5AYA A;  2UYX A;  5LE1 A;  1DXK A;  3SFP A;  2GFJ A;  2Q9U A;  3I15 A;  4AWY B;  3F9O A;  2P1E A;  3ZNB A;  3ZR9 A;  2I7X A;  1XM8 A;  2WYM C;  5EV6 A;  3SRX A;  3DHB A;  2R2D A; 
#chains in the Genus database with same CATH homology
 3G1P A;  3AF5 A;  4C1D A;  4EXS A;  2I7T A;  5EHT A;  1ZTC A;  3RPC A;  1XTO A;  2BC2 A;  4BP0 A;  2XF4 A;  3IEM A;  4RBS A;  3BK1 A;  2GCU A;  1P9E A;  2FM6 A;  1VGN A;  2XR1 A;  1DD6 A;  3ESH A;  4ZEJ A;  1X8I A;  1A7T A;  5HH5 A;  1X8H A;  1QH3 A;  3SW3 A;  4Z7R A;  4Z5Y A;  1YCF A;  1SML A;  2BG7 A;  3I0V A;  3I14 A;  3X30 A;  2FHX B;  1YCH A;  4TZB A;  2YNT B;  4F6Z A;  5AXO A;  4EYB A;  2WYM A;  3SBL A;  2BGA A;  4J5H A;  2QIN A;  4NQ5 A;  5B3R A;  4TZF A;  4J5F A;  5FQB A;  5A87 A;  3BV6 A;  1KR3 A;  4NQ6 A;  2QDT A;  4V0H A;  4RAM A;  3ZQ4 A;  4D1T A;  4UBQ A;  1E5D A;  2E7Y A;  3L6N A;  3T3O A;  2FU8 A;  2DOO A;  3PY5 A;  2FU9 A;  2Q0J A;  3RKK A;  4NQ4 A;  3X2X A;  1L9Y A;  5HH4 A;  4C1H A;  5FQA A;  1BVT A;  5EVK A;  3IOG A;  3KL7 A;  4C1E A;  5AHR A;  2CBN A;  3RKJ A;  2WYL A;  4YSB A;  5K4K A;  2NZE A;  3S0Z A;  2YZ3 A;  2ZO4 A;  2BR6 A;  4EYL A;  2BG8 A;  2QJS A;  4GCW A;  2AZ4 A;  3H3E A;  4NQ2 A;  5LCF A;  2FHX A;  4RAW A;  5ACW A;  2P97 A;  3LVZ A;  2BIB A;  2YNU A;  4UWR B;  3IE0 A;  5A0T A;  4TYF A;  2YNT A;  2Y8B A;  5ACV A;  5LLD A;  5LCH A;  4ZO2 A;  1KO2 A;  4GYQ A;  3DHC A;  2OHH A;  4C1G A;  4ZO3 A;  3Q6V A;  4TZ9 A;  4Z6X A;  5ACT A;  2AIO A;  4C1C A;  5K0W A;  4TYT A;  1VJN A;  4D1U A;  4XWW A;  3MD7 A;  4EFZ A;  5EWA A;  5ACX A;  5A0V A;  5AHO A;  3WXC A;  5ACR A;  2BG6 A;  3SPU A;  4KEQ A;  3PY6 A;  4FR7 A;  4YSL A;  3T3N A;  5ACU A;  4TZE A;  3BK2 A;  2BTN A;  1KO3 A;  3IE1 A;  3I13 A;  3PG4 A;  5FQC A;  5KIL A;  3KNS A;  4UWO B;  4CHL A;  3IEL A;  5K4M A;  2QDS A;  3R2U A;  1WW1 A;  3P2U A;  2I7V A;  2YNV B;  3JXP A;  2YCB A;  4FEK A;  2VW8 A;  2P18 A;  1Y44 A;  5HIO A;  4RM5 A;  3VPE A;  2NXA A;  4B87 A;  3AJ3 A;  4EY2 A;  1QH5 A;  4UWS B;  2Q0I A;  5ACP A;  4ZNB A;  5LSC A;  2FU7 A;  2BG8 B;  2HB9 A;  4AX1 B;  2BMI A;  4EYF A;  4EXY A;  2BFZ B;  5HIS A;  2BFL A;  4AD9 A;  1JJT A;  2QED A;  1JJE A;  1DDK A;  1WUO A;  4D02 A;  3BC2 A;  2FU6 A;  3TP9 A;  3FAI A;  2P4Z A;  5KIK A;  3T9M A;  4O98 A;  4UWP B;  5HIQ A;  4PVO A;  4PVT A;  2BFK A;  4RL0 A;  2Q42 A;  3A4Y A;  4C09 A;  4UA4 A;  4D1W A;  5EW0 A;  4Z67 A;  4AX0 B;  3IDZ A;  5EV8 A;  4FSB A;  5DPX A;  3ADR A;  4RL2 A;  4Z60 A;  5LS3 A;  3DHA A;  2OHI A;  3AF6 A;  4Z5Z A;  2GFK A;  2WRS A;  1A8T A;  5K4N A;  5HH6 A;  4BZ3 A;  4P62 A;  5EVD A;  1YCG A;  4XWT A;  2ZNB A;  5A5Z A;  1X8G A;  1HLK A;  2Y8A A;  5HIP A;  2GMN A;  2ZWR A;  4DIL A;  4C1F A;  4XUK A;  4GYU A;  2YNV A;  2ZZI A;  5IQK A;  4KEP A;  1JT1 A;  2M5C A;  2M5D A;  4H0D A;  2OHJ A;  4LE6 A;  2BFZ A;  3X2Y A;  3IOF A;  3X2Z A;  1WUP A;  1BC2 A;  3DH8 A;  4F6H A;  1VME A;  4JO0 A;  4WD6 A;  5ACQ A;  2A7M A;  4U4L A;  2H6A A;  3I11 A;  4HL2 A;  3ZWF A;  2DKF A;  2NYP A;  5EH9 A;  1MQO A;  2BG2 A;  4HL1 A;  5B1U A;  5LCA A;  5EVB A;  3SD9 A;  1K07 A;  2FK6 A;  4DIK A;  1ZNB A;  5B15 A;  4HKY A;  2NZF A;  2WHG A;  3IE2 A;  4YSK A;  5LM6 A;  3KNR A;  4AWZ A;  3IEK A;  5ACS A;  3VQZ A;  1WRA A;  2YNW A;  1ZKP A;  5AEB A;  2Y87 A;  4UAM A;  1BMC A;  4D1V A;  3FCZ A;  5LMC A;  5AXR A;  3QH8 A;  2GKL A;  1M2X A;  5AYA A;  2UYX A;  5LE1 A;  1DXK A;  3SFP A;  2GFJ A;  2Q9U A;  3I15 A;  4AWY B;  3F9O A;  2P1E A;  3ZNB A;  3ZR9 A;  2I7X A;  1XM8 A;  2WYM C;  5EV6 A;  3SRX A;  3DHB A;  2R2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...