4Z5YA

The 1.56-angstrom crystal structure of copper(ii)-bound pqqb from pseudomonas putida
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
308
structure length
308
Chain Sequence
b'MMYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIALSDDGVHWILCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLREGCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFPLRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLLVDGTLWEDDEMQRRGVGTRTGREMGHLAQNGPGGTLEVLDGFPRQRKVLIHINNTNPILDENSPERAEVLRRGVEVAFDGMSIELLEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coenzyme PQQ synthesis protein B
publication title Crystal structures reveal metal-binding plasticity at the active site of PqqB
rcsb
source organism Pseudomonas putida (strain kt2440)
molecule tags Hydrolase
total genus 100
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4z5yA00
4KEPA 1BMCA 5HH5A 1A7TA 5ACXA 2BMIA 2GMNA 3ADRA 3IOFA 2XR1A 4YSBA 1YCFA 4FR7A 4DILA 1ZKPA 3S0ZA 4EFZA 4C1CA 1A8TA 2BFZB 1MQOA 3AJ3A 2AZ4A 4UWSB 3PY6A 3I15A 3AF6A 3I14A 5ACQA 5HIPA 3X2XA 4D02A 4CHLA 3TP9A 2BG8A 4ZO3A 5EHTA 3IEMA 1VMEA 4D1TA 2OHIA 3I11A 2BG6A 2I7TA 3DHBA 4TZ9A 3WXCA 2Y8AA 2P4ZA 2Y8BA 4YSLA 5K0WA 3DHAA 2HB9A 3T3OA 4NQ5A 3KNSA 4RL0A 4KEQA 2M5DA 3SRXA 1WUPA 5B1UA 1JJEA 1JT1A 4C1FA 2GCUA 4P62A 4EXYA 5A5ZA 1DD6A 1YCHA 4HKYA 2QINA 2QEDA 3IE0A 4YSKA 3VQZA 1BC2A 5HISA 4RL2A 1WUOA 4Z5YA 4GYQA 2FU9A 2QJSA 2BG8B 3DHCA 3BK1A 1X8GA 5FQCA 5K4KA 1DDKA 1SMLA 4AX0B 5A0TA 3X30A 5LCAA 2CBNA 1BVTA 5LCFA 5ACWA 4D1WA 2NXAA 5ACUA 2YNTA 5HIQA 3H3EA 2ZO4A 3BV6A 3L6NA 2OHJA 3IOGA 4UA4A 3A4YA 4U4LA 3R2UA 4D1VA 1KO3A 2FU7A 3ZR9A 4TYTA 3RPCA 4ZNBA 2GFJA 4FSBA 2VW8A 2P97A 4Z7RA 4HL1A 4EYFA 2WYMC 2R2DA 5ACRA 2BC2A 1XTOA 5AHRA 2FU8A 3BC2A 2WRSA 4Z5ZA 4F6ZA 2NYPA 3ZNBA 4HL2A 3G1PA 5LM6A 4EYBA 5ACPA 1KO2A 2H6AA 1L9YA 4NQ4A 4RAWA 5B3RA 4EYLA 2YNWA 5LMCA 1QH5A 2BFKA 4EY2A 2DKFA 3PY5A 4BZ3A 3MD7A 2P18A 4C1GA 3BK2A 5EVBA 4RBSA 3ESHA 5A87A 4UBQA 2UYXA 4NQ2A 4C1HA 2QDTA 3QH8A 2WHGA 3X2YA 2FU6A 4C1EA 1HLKA 4TYFA 4GCWA 4Z67A 2FHXA 4H0DA 3RKKA 3SFPA 3X2ZA 4C1DA 5AEBA 3F9OA 2WYLA 3FAIA 5EVKA 1K07A 1X8HA 5ACTA 2Q9UA 4GYUA 4F6HA 4RM5A 4Z60A 1ZNBA 2Q0IA 4RAMA 3VPEA 2I7XA 5A0VA 4DIKA 5LS3A 3IELA 5B15A 2YNUA 4PVTA 4XUKA 1X8IA 3DH8A 5HH4A 1KR3A 5LCHA 2A7MA 5ACVA 5FQBA 4J5HA 1XM8A 3I0VA 4PVOA 5HIOA 2M5CA 3SPUA 4AX1B 3IE1A 2QDSA 5EWAA 4B87A 5KILA 5FQAA 2FHXB 4ZEJA 5LE1A 2NZEA 3IE2A 4AD9A 3JXPA 2ZNBA 5AXOA 5EV6A 5K4MA 3KL7A 2FM6A 1YCGA 4AWYB 3Q6VA 3SW3A 2NZFA 5AXRA 2E7YA 5K4NA 4J5FA 3SD9A 2YNTB 4UWRB 2ZWRA 1WW1A 3T3NA 1P9EA 4UWPB 2BG2A 4V0HA 5EH9A 3RKJA 1QH3A 2DOOA 5EV8A 2WYMA 2FK6A 2YCBA 2BGAA 3IDZA 3AF5A 4JO0A 3FCZA 1E5DA 1ZTCA 2Q0JA 4TZBA 4ZO2A 4TZFA 3ZQ4A 2ZZIA 4XWTA 2YNVA 3I13A 5EVDA 4EXSA 1VJNA 5DPXA 4Z6XA 2GFKA 4UAMA 5AYAA 5ACSA 1M2XA 2P1EA 5LLDA 1VGNA 2BFZA 1JJTA 3T9MA 2I7VA 1DXKA 5EW0A 5AHOA 2BG7A 2BFLA 1WRAA 2Q42A 5HH6A 4AWZA 4XWWA 4BP0A 2YZ3A 2GKLA 3P2UA 4D1UA 5IQKA 2XF4A 5LSCA 2OHHA 2BTNA 4UWOB 3KNRA 4NQ6A 4C09A 2AIOA 2BIBA 2Y87A 3ZWFA 3SBLA 4FEKA 3PG4A 4LE6A 1Y44A 4O98A 4WD6A 2BR6A 5KIKA 4TZEA 3LVZA 2YNVB 3IEKA
chains in the Genus database with same CATH superfamily
4KEPA 1BMCA 5HH5A 1A7TA 5ACXA 2BMIA 2GMNA 3ADRA 3IOFA 2XR1A 4YSBA 1YCFA 4FR7A 4DILA 1ZKPA 3S0ZA 4EFZA 4C1CA 1A8TA 2BFZB 1MQOA 3AJ3A 2AZ4A 4UWSB 3PY6A 3I15A 3AF6A 3I14A 5ACQA 5HIPA 3X2XA 4D02A 4CHLA 3TP9A 2BG8A 4ZO3A 5EHTA 3IEMA 1VMEA 4D1TA 2OHIA 3I11A 2BG6A 2I7TA 3DHBA 4TZ9A 3WXCA 4AV7A 2Y8AA 2P4ZA 2Y8BA 4YSLA 5K0WA 3DHAA 2HB9A 3T3OA 4NQ5A 3KNSA 4RL0A 4KEQA 2M5DA 3SRXA 1WUPA 5B1UA 1JJEA 4AXHA 4C1FA 1JT1A 2GCUA 4P62A 2CFZA 4EXYA 5A5ZA 1DD6A 1YCHA 4HKYA 2QINA 2QEDA 5AJLA 3IE0A 4YSKA 3VQZA 1BC2A 5HISA 4RL2A 1WUOA 5A23A 4Z5YA 4GYQA 2FU9A 2QJSA 2BG8B 3DHCA 3BK1A 1X8GA 5FQCA 5AIJA 5K4KA 1DDKA 1SMLA 4AX0B 5A0TA 3X30A 5LCAA 2CBNA 1BVTA 5LCFA 5ACWA 4D1WA 2NXAA 5ACUA 2YNTA 5HIQA 3H3EA 2ZO4A 3BV6A 3L6NA 2OHJA 3IOGA 4UA4A 3A4YA 2CG3A 4U4LA 3R2UA 4D1VA 1KO3A 2FU7A 3ZR9A 4TYTA 3RPCA 4ZNBA 2GFJA 4FSBA 2VW8A 2P97A 4Z7RA 4HL1A 4EYFA 2WYMC 2R2DA 5ACRA 2BC2A 1XTOA 5AHRA 2FU8A 3BC2A 2WRSA 4Z5ZA 4F6ZA 2NYPA 3ZNBA 4HL2A 3G1PA 5LM6A 4EYBA 5ACPA 1KO2A 2H6AA 1L9YA 4NQ4A 4RAWA 5B3RA 4EYLA 2YNWA 5LMCA 1QH5A 2BFKA 4EY2A 2DKFA 3PY5A 4BZ3A 3MD7A 2P18A 4C1GA 3BK2A 4NURA 5EVBA 4RBSA 3ESHA 5A87A 2CFUA 4UBQA 2UYXA 2CG2A 4NQ2A 4C1HA 2QDTA 3QH8A 2WHGA 3X2YA 2FU6A 4C1EA 1HLKA 4TYFA 4GCWA 4Z67A 2FHXA 4H0DA 3RKKA 3SFPA 3X2ZA 4C1DA 5AEBA 3F9OA 2WYLA 3FAIA 5EVKA 1K07A 1X8HA 5ACTA 4PDXA 2Q9UA 4GYUA 4F6HA 4RM5A 4Z60A 1ZNBA 2Q0IA 4RAMA 3VPEA 2I7XA 5A0VA 4DIKA 5LS3A 3IELA 5B15A 2YNUA 4PVTA 4XUKA 1X8IA 3DH8A 5HH4A 1KR3A 5LCHA 2A7MA 5ACVA 5FQBA 4J5HA 1XM8A 3I0VA 4PVOA 5HIOA 2M5CA 3SPUA 4AX1B 3IE1A 2QDSA 5EWAA 4B87A 5KILA 5FQAA 2FHXB 4ZEJA 2YHEA 5LE1A 2NZEA 3IE2A 4AD9A 3JXPA 2ZNBA 5AXOA 5EV6A 5K4MA 3KL7A 2FM6A 1YCGA 4AWYB 3Q6VA 3SW3A 2NZFA 5AXRA 2E7YA 5K4NA 4J5FA 3SD9A 2YNTB 4UWRB 2ZWRA 1WW1A 3T3NA 1P9EA 4UWPB 2BG2A 4V0HA 5EH9A 3RKJA 1QH3A 2DOOA 5EV8A 2WYMA 2FK6A 2YCBA 2BGAA 3IDZA 3AF5A 4JO0A 3FCZA 1E5DA 1ZTCA 2Q0JA 4TZBA 4ZO2A 4TZFA 3ZQ4A 2ZZIA 4XWTA 2YNVA 3I13A 5EVDA 4EXSA 1VJNA 5DPXA 4Z6XA 2GFKA 4UAMA 5AYAA 5ACSA 1M2XA 2P1EA 5LLDA 1VGNA 2BFZA 1JJTA 3T9MA 2I7VA 1DXKA 5EW0A 5AHOA 2BG7A 2BFLA 1WRAA 2Q42A 5HH6A 4AWZA 4XWWA 4BP0A 2YZ3A 2GKLA 3P2UA 4D1UA 5IQKA 2XF4A 5LSCA 2OHHA 2BTNA 4UWOB 3KNRA 4NQ6A 4C09A 2AIOA 2BIBA 2Y87A 3ZWFA 3SBLA 4FEKA 3PG4A 4LE6A 1Y44A 4O98A 4WD6A 2BR6A 5KIKA 4TZEA 3LVZA 2YNVB 3IEKA
chains in the Genus database with same CATH topology
4KEPA 1BMCA 5HH5A 1A7TA 5ACXA 2BMIA 2GMNA 3ADRA 3IOFA 2XR1A 4YSBA 1YCFA 4FR7A 4DILA 1ZKPA 3S0ZA 4EFZA 4C1CA 1A8TA 2BFZB 1MQOA 3AJ3A 2AZ4A 4UWSB 3PY6A 3I15A 3AF6A 3I14A 5ACQA 5HIPA 3X2XA 4D02A 4CHLA 3TP9A 2BG8A 4ZO3A 5EHTA 3IEMA 1VMEA 4D1TA 2OHIA 3I11A 2BG6A 2I7TA 3DHBA 4TZ9A 3WXCA 2Y8AA 2P4ZA 2Y8BA 4YSLA 5K0WA 3DHAA 2HB9A 3T3OA 4NQ5A 3KNSA 4RL0A 4KEQA 2M5DA 3SRXA 1WUPA 5B1UA 1JJEA 1JT1A 4C1FA 2GCUA 4P62A 4EXYA 5A5ZA 1DD6A 1YCHA 4HKYA 2QINA 2QEDA 3IE0A 4YSKA 3VQZA 1BC2A 5HISA 4RL2A 1WUOA 4Z5YA 4GYQA 2FU9A 2QJSA 2BG8B 3DHCA 3BK1A 1X8GA 5FQCA 5K4KA 1DDKA 1SMLA 4AX0B 5A0TA 3X30A 5LCAA 2CBNA 1BVTA 5LCFA 5ACWA 4D1WA 2NXAA 5ACUA 2YNTA 5HIQA 3H3EA 2ZO4A 3BV6A 3L6NA 2OHJA 3IOGA 4UA4A 3A4YA 4U4LA 3R2UA 4D1VA 1KO3A 2FU7A 3ZR9A 4TYTA 3RPCA 4ZNBA 2GFJA 4FSBA 2VW8A 2P97A 4Z7RA 4HL1A 4EYFA 2WYMC 2R2DA 5ACRA 2BC2A 1XTOA 5AHRA 2FU8A 3BC2A 2WRSA 4Z5ZA 4F6ZA 2NYPA 3ZNBA 4HL2A 3G1PA 5LM6A 4EYBA 5ACPA 1KO2A 2H6AA 1L9YA 4NQ4A 4RAWA 5B3RA 4EYLA 2YNWA 5LMCA 1QH5A 2BFKA 4EY2A 2DKFA 3PY5A 4BZ3A 3MD7A 2P18A 4C1GA 3BK2A 5EVBA 4RBSA 3ESHA 5A87A 4UBQA 2UYXA 4NQ2A 4C1HA 2QDTA 3QH8A 2WHGA 3X2YA 2FU6A 4C1EA 1HLKA 4TYFA 4GCWA 4Z67A 2FHXA 4H0DA 3RKKA 3SFPA 3X2ZA 4C1DA 5AEBA 3F9OA 2WYLA 3FAIA 5EVKA 1K07A 1X8HA 5ACTA 2Q9UA 4GYUA 4F6HA 4RM5A 4Z60A 1ZNBA 2Q0IA 4RAMA 3VPEA 2I7XA 5A0VA 4DIKA 5LS3A 3IELA 5B15A 2YNUA 4PVTA 4XUKA 1X8IA 3DH8A 5HH4A 1KR3A 5LCHA 2A7MA 5ACVA 5FQBA 4J5HA 1XM8A 3I0VA 4PVOA 5HIOA 2M5CA 3SPUA 4AX1B 3IE1A 2QDSA 5EWAA 4B87A 5KILA 5FQAA 2FHXB 4ZEJA 5LE1A 2NZEA 3IE2A 4AD9A 3JXPA 2ZNBA 5AXOA 5EV6A 5K4MA 3KL7A 2FM6A 1YCGA 4AWYB 3Q6VA 3SW3A 2NZFA 5AXRA 2E7YA 5K4NA 4J5FA 3SD9A 2YNTB 4UWRB 2ZWRA 1WW1A 3T3NA 1P9EA 4UWPB 2BG2A 4V0HA 5EH9A 3RKJA 1QH3A 2DOOA 5EV8A 2WYMA 2FK6A 2YCBA 2BGAA 3IDZA 3AF5A 4JO0A 3FCZA 1E5DA 1ZTCA 2Q0JA 4TZBA 4ZO2A 4TZFA 3ZQ4A 2ZZIA 4XWTA 2YNVA 3I13A 5EVDA 4EXSA 1VJNA 5DPXA 4Z6XA 2GFKA 4UAMA 5AYAA 5ACSA 1M2XA 2P1EA 5LLDA 1VGNA 2BFZA 1JJTA 3T9MA 2I7VA 1DXKA 5EW0A 5AHOA 2BG7A 2BFLA 1WRAA 2Q42A 5HH6A 4AWZA 4XWWA 4BP0A 2YZ3A 2GKLA 3P2UA 4D1UA 5IQKA 2XF4A 5LSCA 2OHHA 2BTNA 4UWOB 3KNRA 4NQ6A 4C09A 2AIOA 2BIBA 2Y87A 3ZWFA 3SBLA 4FEKA 3PG4A 4LE6A 1Y44A 4O98A 4WD6A 2BR6A 5KIKA 4TZEA 3LVZA 2YNVB 3IEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KEP A;  1BMC A;  5HH5 A;  1A7T A;  5ACX A;  2BMI A;  2GMN A;  3ADR A;  3IOF A;  2XR1 A;  4YSB A;  1YCF A;  4FR7 A;  4DIL A;  1ZKP A;  3S0Z A;  4EFZ A;  4C1C A;  1A8T A;  2BFZ B;  1MQO A;  3AJ3 A;  2AZ4 A;  4UWS B;  3PY6 A;  3I15 A;  3AF6 A;  3I14 A;  5ACQ A;  5HIP A;  3X2X A;  4D02 A;  4CHL A;  3TP9 A;  2BG8 A;  4ZO3 A;  5EHT A;  3IEM A;  1VME A;  4D1T A;  2OHI A;  3I11 A;  2BG6 A;  2I7T A;  3DHB A;  4TZ9 A;  3WXC A;  2Y8A A;  2P4Z A;  2Y8B A;  4YSL A;  5K0W A;  3DHA A;  2HB9 A;  3T3O A;  4NQ5 A;  3KNS A;  4RL0 A;  4KEQ A;  2M5D A;  3SRX A;  1WUP A;  5B1U A;  1JJE A;  1JT1 A;  4C1F A;  2GCU A;  4P62 A;  4EXY A;  5A5Z A;  1DD6 A;  1YCH A;  4HKY A;  2QIN A;  2QED A;  3IE0 A;  4YSK A;  3VQZ A;  1BC2 A;  5HIS A;  4RL2 A;  1WUO A;  4Z5Y A;  4GYQ A;  2FU9 A;  2QJS A;  2BG8 B;  3DHC A;  3BK1 A;  1X8G A;  5FQC A;  5K4K A;  1DDK A;  1SML A;  4AX0 B;  5A0T A;  3X30 A;  5LCA A;  2CBN A;  1BVT A;  5LCF A;  5ACW A;  4D1W A;  2NXA A;  5ACU A;  2YNT A;  5HIQ A;  3H3E A;  2ZO4 A;  3BV6 A;  3L6N A;  2OHJ A;  3IOG A;  4UA4 A;  3A4Y A;  4U4L A;  3R2U A;  4D1V A;  1KO3 A;  2FU7 A;  3ZR9 A;  4TYT A;  3RPC A;  4ZNB A;  2GFJ A;  4FSB A;  2VW8 A;  2P97 A;  4Z7R A;  4HL1 A;  4EYF A;  2WYM C;  2R2D A;  5ACR A;  2BC2 A;  1XTO A;  5AHR A;  2FU8 A;  3BC2 A;  2WRS A;  4Z5Z A;  4F6Z A;  2NYP A;  3ZNB A;  4HL2 A;  3G1P A;  5LM6 A;  4EYB A;  5ACP A;  1KO2 A;  2H6A A;  1L9Y A;  4NQ4 A;  4RAW A;  5B3R A;  4EYL A;  2YNW A;  5LMC A;  1QH5 A;  2BFK A;  4EY2 A;  2DKF A;  3PY5 A;  4BZ3 A;  3MD7 A;  2P18 A;  4C1G A;  3BK2 A;  5EVB A;  4RBS A;  3ESH A;  5A87 A;  4UBQ A;  2UYX A;  4NQ2 A;  4C1H A;  2QDT A;  3QH8 A;  2WHG A;  3X2Y A;  2FU6 A;  4C1E A;  1HLK A;  4TYF A;  4GCW A;  4Z67 A;  2FHX A;  4H0D A;  3RKK A;  3SFP A;  3X2Z A;  4C1D A;  5AEB A;  3F9O A;  2WYL A;  3FAI A;  5EVK A;  1K07 A;  1X8H A;  5ACT A;  2Q9U A;  4GYU A;  4F6H A;  4RM5 A;  4Z60 A;  1ZNB A;  2Q0I A;  4RAM A;  3VPE A;  2I7X A;  5A0V A;  4DIK A;  5LS3 A;  3IEL A;  5B15 A;  2YNU A;  4PVT A;  4XUK A;  1X8I A;  3DH8 A;  5HH4 A;  1KR3 A;  5LCH A;  2A7M A;  5ACV A;  5FQB A;  4J5H A;  1XM8 A;  3I0V A;  4PVO A;  5HIO A;  2M5C A;  3SPU A;  4AX1 B;  3IE1 A;  2QDS A;  5EWA A;  4B87 A;  5KIL A;  5FQA A;  2FHX B;  4ZEJ A;  5LE1 A;  2NZE A;  3IE2 A;  4AD9 A;  3JXP A;  2ZNB A;  5AXO A;  5EV6 A;  5K4M A;  3KL7 A;  2FM6 A;  1YCG A;  4AWY B;  3Q6V A;  3SW3 A;  2NZF A;  5AXR A;  2E7Y A;  5K4N A;  4J5F A;  3SD9 A;  2YNT B;  4UWR B;  2ZWR A;  1WW1 A;  3T3N A;  1P9E A;  4UWP B;  2BG2 A;  4V0H A;  5EH9 A;  3RKJ A;  1QH3 A;  2DOO A;  5EV8 A;  2WYM A;  2FK6 A;  2YCB A;  2BGA A;  3IDZ A;  3AF5 A;  4JO0 A;  3FCZ A;  1E5D A;  1ZTC A;  2Q0J A;  4TZB A;  4ZO2 A;  4TZF A;  3ZQ4 A;  2ZZI A;  4XWT A;  2YNV A;  3I13 A;  5EVD A;  4EXS A;  1VJN A;  5DPX A;  4Z6X A;  2GFK A;  4UAM A;  5AYA A;  5ACS A;  1M2X A;  2P1E A;  5LLD A;  1VGN A;  2BFZ A;  1JJT A;  3T9M A;  2I7V A;  1DXK A;  5EW0 A;  5AHO A;  2BG7 A;  2BFL A;  1WRA A;  2Q42 A;  5HH6 A;  4AWZ A;  4XWW A;  4BP0 A;  2YZ3 A;  2GKL A;  3P2U A;  4D1U A;  5IQK A;  2XF4 A;  5LSC A;  2OHH A;  2BTN A;  4UWO B;  3KNR A;  4NQ6 A;  4C09 A;  2AIO A;  2BIB A;  2Y87 A;  3ZWF A;  3SBL A;  4FEK A;  3PG4 A;  4LE6 A;  1Y44 A;  4O98 A;  4WD6 A;  2BR6 A;  5KIK A;  4TZE A;  3LVZ A;  2YNV B;  3IEK A; 
#chains in the Genus database with same CATH topology
 4KEP A;  1BMC A;  5HH5 A;  1A7T A;  5ACX A;  2BMI A;  2GMN A;  3ADR A;  3IOF A;  2XR1 A;  4YSB A;  1YCF A;  4FR7 A;  4DIL A;  1ZKP A;  3S0Z A;  4EFZ A;  4C1C A;  1A8T A;  2BFZ B;  1MQO A;  3AJ3 A;  2AZ4 A;  4UWS B;  3PY6 A;  3I15 A;  3AF6 A;  3I14 A;  5ACQ A;  5HIP A;  3X2X A;  4D02 A;  4CHL A;  3TP9 A;  2BG8 A;  4ZO3 A;  5EHT A;  3IEM A;  1VME A;  4D1T A;  2OHI A;  3I11 A;  2BG6 A;  2I7T A;  3DHB A;  4TZ9 A;  3WXC A;  4AV7 A;  2Y8A A;  2P4Z A;  2Y8B A;  4YSL A;  5K0W A;  3DHA A;  2HB9 A;  3T3O A;  4NQ5 A;  3KNS A;  4RL0 A;  4KEQ A;  2M5D A;  3SRX A;  1WUP A;  5B1U A;  1JJE A;  4AXH A;  4C1F A;  1JT1 A;  2GCU A;  4P62 A;  2CFZ A;  4EXY A;  5A5Z A;  1DD6 A;  1YCH A;  4HKY A;  2QIN A;  2QED A;  5AJL A;  3IE0 A;  4YSK A;  3VQZ A;  1BC2 A;  5HIS A;  4RL2 A;  1WUO A;  5A23 A;  4Z5Y A;  4GYQ A;  2FU9 A;  2QJS A;  2BG8 B;  3DHC A;  3BK1 A;  1X8G A;  5FQC A;  5AIJ A;  5K4K A;  1DDK A;  1SML A;  4AX0 B;  5A0T A;  3X30 A;  5LCA A;  2CBN A;  1BVT A;  5LCF A;  5ACW A;  4D1W A;  2NXA A;  5ACU A;  2YNT A;  5HIQ A;  3H3E A;  2ZO4 A;  3BV6 A;  3L6N A;  2OHJ A;  3IOG A;  4UA4 A;  3A4Y A;  2CG3 A;  4U4L A;  3R2U A;  4D1V A;  1KO3 A;  2FU7 A;  3ZR9 A;  4TYT A;  3RPC A;  4ZNB A;  2GFJ A;  4FSB A;  2VW8 A;  2P97 A;  4Z7R A;  4HL1 A;  4EYF A;  2WYM C;  2R2D A;  5ACR A;  2BC2 A;  1XTO A;  5AHR A;  2FU8 A;  3BC2 A;  2WRS A;  4Z5Z A;  4F6Z A;  2NYP A;  3ZNB A;  4HL2 A;  3G1P A;  5LM6 A;  4EYB A;  5ACP A;  1KO2 A;  2H6A A;  1L9Y A;  4NQ4 A;  4RAW A;  5B3R A;  4EYL A;  2YNW A;  5LMC A;  1QH5 A;  2BFK A;  4EY2 A;  2DKF A;  3PY5 A;  4BZ3 A;  3MD7 A;  2P18 A;  4C1G A;  3BK2 A;  4NUR A;  5EVB A;  4RBS A;  3ESH A;  5A87 A;  2CFU A;  4UBQ A;  2UYX A;  2CG2 A;  4NQ2 A;  4C1H A;  2QDT A;  3QH8 A;  2WHG A;  3X2Y A;  2FU6 A;  4C1E A;  1HLK A;  4TYF A;  4GCW A;  4Z67 A;  2FHX A;  4H0D A;  3RKK A;  3SFP A;  3X2Z A;  4C1D A;  5AEB A;  3F9O A;  2WYL A;  3FAI A;  5EVK A;  1K07 A;  1X8H A;  5ACT A;  4PDX A;  2Q9U A;  4GYU A;  4F6H A;  4RM5 A;  4Z60 A;  1ZNB A;  2Q0I A;  4RAM A;  3VPE A;  2I7X A;  5A0V A;  4DIK A;  5LS3 A;  3IEL A;  5B15 A;  2YNU A;  4PVT A;  4XUK A;  1X8I A;  3DH8 A;  5HH4 A;  1KR3 A;  5LCH A;  2A7M A;  5ACV A;  5FQB A;  4J5H A;  1XM8 A;  3I0V A;  4PVO A;  5HIO A;  2M5C A;  3SPU A;  4AX1 B;  3IE1 A;  2QDS A;  5EWA A;  4B87 A;  5KIL A;  5FQA A;  2FHX B;  4ZEJ A;  2YHE A;  5LE1 A;  2NZE A;  3IE2 A;  4AD9 A;  3JXP A;  2ZNB A;  5AXO A;  5EV6 A;  5K4M A;  3KL7 A;  2FM6 A;  1YCG A;  4AWY B;  3Q6V A;  3SW3 A;  2NZF A;  5AXR A;  2E7Y A;  5K4N A;  4J5F A;  3SD9 A;  2YNT B;  4UWR B;  2ZWR A;  1WW1 A;  3T3N A;  1P9E A;  4UWP B;  2BG2 A;  4V0H A;  5EH9 A;  3RKJ A;  1QH3 A;  2DOO A;  5EV8 A;  2WYM A;  2FK6 A;  2YCB A;  2BGA A;  3IDZ A;  3AF5 A;  4JO0 A;  3FCZ A;  1E5D A;  1ZTC A;  2Q0J A;  4TZB A;  4ZO2 A;  4TZF A;  3ZQ4 A;  2ZZI A;  4XWT A;  2YNV A;  3I13 A;  5EVD A;  4EXS A;  1VJN A;  5DPX A;  4Z6X A;  2GFK A;  4UAM A;  5AYA A;  5ACS A;  1M2X A;  2P1E A;  5LLD A;  1VGN A;  2BFZ A;  1JJT A;  3T9M A;  2I7V A;  1DXK A;  5EW0 A;  5AHO A;  2BG7 A;  2BFL A;  1WRA A;  2Q42 A;  5HH6 A;  4AWZ A;  4XWW A;  4BP0 A;  2YZ3 A;  2GKL A;  3P2U A;  4D1U A;  5IQK A;  2XF4 A;  5LSC A;  2OHH A;  2BTN A;  4UWO B;  3KNR A;  4NQ6 A;  4C09 A;  2AIO A;  2BIB A;  2Y87 A;  3ZWF A;  3SBL A;  4FEK A;  3PG4 A;  4LE6 A;  1Y44 A;  4O98 A;  4WD6 A;  2BR6 A;  5KIK A;  4TZE A;  3LVZ A;  2YNV B;  3IEK A; 
#chains in the Genus database with same CATH homology
 4KEP A;  1BMC A;  5HH5 A;  1A7T A;  5ACX A;  2BMI A;  2GMN A;  3ADR A;  3IOF A;  2XR1 A;  4YSB A;  1YCF A;  4FR7 A;  4DIL A;  1ZKP A;  3S0Z A;  4EFZ A;  4C1C A;  1A8T A;  2BFZ B;  1MQO A;  3AJ3 A;  2AZ4 A;  4UWS B;  3PY6 A;  3I15 A;  3AF6 A;  3I14 A;  5ACQ A;  5HIP A;  3X2X A;  4D02 A;  4CHL A;  3TP9 A;  2BG8 A;  4ZO3 A;  5EHT A;  3IEM A;  1VME A;  4D1T A;  2OHI A;  3I11 A;  2BG6 A;  2I7T A;  3DHB A;  4TZ9 A;  3WXC A;  2Y8A A;  2P4Z A;  2Y8B A;  4YSL A;  5K0W A;  3DHA A;  2HB9 A;  3T3O A;  4NQ5 A;  3KNS A;  4RL0 A;  4KEQ A;  2M5D A;  3SRX A;  1WUP A;  5B1U A;  1JJE A;  1JT1 A;  4C1F A;  2GCU A;  4P62 A;  4EXY A;  5A5Z A;  1DD6 A;  1YCH A;  4HKY A;  2QIN A;  2QED A;  3IE0 A;  4YSK A;  3VQZ A;  1BC2 A;  5HIS A;  4RL2 A;  1WUO A;  4Z5Y A;  4GYQ A;  2FU9 A;  2QJS A;  2BG8 B;  3DHC A;  3BK1 A;  1X8G A;  5FQC A;  5K4K A;  1DDK A;  1SML A;  4AX0 B;  5A0T A;  3X30 A;  5LCA A;  2CBN A;  1BVT A;  5LCF A;  5ACW A;  4D1W A;  2NXA A;  5ACU A;  2YNT A;  5HIQ A;  3H3E A;  2ZO4 A;  3BV6 A;  3L6N A;  2OHJ A;  3IOG A;  4UA4 A;  3A4Y A;  4U4L A;  3R2U A;  4D1V A;  1KO3 A;  2FU7 A;  3ZR9 A;  4TYT A;  3RPC A;  4ZNB A;  2GFJ A;  4FSB A;  2VW8 A;  2P97 A;  4Z7R A;  4HL1 A;  4EYF A;  2WYM C;  2R2D A;  5ACR A;  2BC2 A;  1XTO A;  5AHR A;  2FU8 A;  3BC2 A;  2WRS A;  4Z5Z A;  4F6Z A;  2NYP A;  3ZNB A;  4HL2 A;  3G1P A;  5LM6 A;  4EYB A;  5ACP A;  1KO2 A;  2H6A A;  1L9Y A;  4NQ4 A;  4RAW A;  5B3R A;  4EYL A;  2YNW A;  5LMC A;  1QH5 A;  2BFK A;  4EY2 A;  2DKF A;  3PY5 A;  4BZ3 A;  3MD7 A;  2P18 A;  4C1G A;  3BK2 A;  5EVB A;  4RBS A;  3ESH A;  5A87 A;  4UBQ A;  2UYX A;  4NQ2 A;  4C1H A;  2QDT A;  3QH8 A;  2WHG A;  3X2Y A;  2FU6 A;  4C1E A;  1HLK A;  4TYF A;  4GCW A;  4Z67 A;  2FHX A;  4H0D A;  3RKK A;  3SFP A;  3X2Z A;  4C1D A;  5AEB A;  3F9O A;  2WYL A;  3FAI A;  5EVK A;  1K07 A;  1X8H A;  5ACT A;  2Q9U A;  4GYU A;  4F6H A;  4RM5 A;  4Z60 A;  1ZNB A;  2Q0I A;  4RAM A;  3VPE A;  2I7X A;  5A0V A;  4DIK A;  5LS3 A;  3IEL A;  5B15 A;  2YNU A;  4PVT A;  4XUK A;  1X8I A;  3DH8 A;  5HH4 A;  1KR3 A;  5LCH A;  2A7M A;  5ACV A;  5FQB A;  4J5H A;  1XM8 A;  3I0V A;  4PVO A;  5HIO A;  2M5C A;  3SPU A;  4AX1 B;  3IE1 A;  2QDS A;  5EWA A;  4B87 A;  5KIL A;  5FQA A;  2FHX B;  4ZEJ A;  5LE1 A;  2NZE A;  3IE2 A;  4AD9 A;  3JXP A;  2ZNB A;  5AXO A;  5EV6 A;  5K4M A;  3KL7 A;  2FM6 A;  1YCG A;  4AWY B;  3Q6V A;  3SW3 A;  2NZF A;  5AXR A;  2E7Y A;  5K4N A;  4J5F A;  3SD9 A;  2YNT B;  4UWR B;  2ZWR A;  1WW1 A;  3T3N A;  1P9E A;  4UWP B;  2BG2 A;  4V0H A;  5EH9 A;  3RKJ A;  1QH3 A;  2DOO A;  5EV8 A;  2WYM A;  2FK6 A;  2YCB A;  2BGA A;  3IDZ A;  3AF5 A;  4JO0 A;  3FCZ A;  1E5D A;  1ZTC A;  2Q0J A;  4TZB A;  4ZO2 A;  4TZF A;  3ZQ4 A;  2ZZI A;  4XWT A;  2YNV A;  3I13 A;  5EVD A;  4EXS A;  1VJN A;  5DPX A;  4Z6X A;  2GFK A;  4UAM A;  5AYA A;  5ACS A;  1M2X A;  2P1E A;  5LLD A;  1VGN A;  2BFZ A;  1JJT A;  3T9M A;  2I7V A;  1DXK A;  5EW0 A;  5AHO A;  2BG7 A;  2BFL A;  1WRA A;  2Q42 A;  5HH6 A;  4AWZ A;  4XWW A;  4BP0 A;  2YZ3 A;  2GKL A;  3P2U A;  4D1U A;  5IQK A;  2XF4 A;  5LSC A;  2OHH A;  2BTN A;  4UWO B;  3KNR A;  4NQ6 A;  4C09 A;  2AIO A;  2BIB A;  2Y87 A;  3ZWF A;  3SBL A;  4FEK A;  3PG4 A;  4LE6 A;  1Y44 A;  4O98 A;  4WD6 A;  2BR6 A;  5KIK A;  4TZE A;  3LVZ A;  2YNV B;  3IEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...