4Z5YA

The 1.56-angstrom crystal structure of copper(ii)-bound pqqb from pseudomonas putida
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
308
structure length
308
Chain Sequence
MMYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIALSDDGVHWILCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLREGCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFPLRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLLVDGTLWEDDEMQRRGVGTRTGREMGHLAQNGPGGTLEVLDGFPRQRKVLIHINNTNPILDENSPERAEVLRRGVEVAFDGMSIELLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Coenzyme PQQ synthesis protein B
publication title Crystal structures reveal metal-binding plasticity at the active site of PqqB
rcsb
source organism Pseudomonas putida (strain kt2440)
total genus 100
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4z5yA00
5K4MA 3T3NA 1ZNBA 2YZ3A 2GCUA 4UAMA 5B3RA 5A5ZA 3P2UA 1KO3A 3I13A 5HIOA 2NZEA 2OHIA 4BZ3A 3X30A 5EHTA 3IE2A 4TZ9A 3IEKA 5FQCA 2FU8A 5KIKA 2YNUA 2GKLA 3BK2A 5A0VA 2BC2A 2HB9A 4F6HA 4WD6A 5DPXA 3ZR9A 4TZFA 3PY6A 4NQ5A 2BIBA 4Z67A 3Q6VA 2GFKA 3TP9A 2AZ4A 4UWOB 3AF6A 2R2DA 4RL0A 3AJ3A 5AEBA 2BFZB 3SRXA 5HIQA 3SBLA 5AXRA 1YCFA 4HKYA 4HL1A 3RKJA 2I7XA 3JXPA 1YCGA 2QDSA 5ACXA 1VGNA 4BP0A 2BFZA 5EH9A 3IOFA 4RAWA 2YNVA 3X2ZA 5B15A 2WYMC 2BMIA 3IE1A 2YNWA 1A7TA 3KNSA 5HISA 4RBSA 4EXYA 4ZEJA 3BK1A 1VMEA 2FHXB 4DILA 5B1UA 3VPEA 2NYPA 1WW1A 1WUPA 2P18A 5K4KA 4AD9A 5EVDA 3SD9A 3LVZA 4AWZA 2YCBA 3WXCA 2Q9UA 3KL7A 2WYMA 5ACQA 2FHXA 4C1CA 3MD7A 5EVKA 5AYAA 4J5FA 4YSBA 3S0ZA 1M2XA 5FQBA 1X8HA 5K0WA 5AXOA 2ZNBA 3SW3A 2BFLA 4EYBA 2BG8B 4C1HA 5EV8A 3ADRA 2Y8AA 1K07A 4FR7A 3X2YA 3SFPA 5LCFA 4C1DA 5A0TA 3T9MA 1L9YA 2BG8A 2FK6A 2DOOA 4GYQA 1P9EA 4HL2A 2BG7A 2QJSA 5EWAA 5FQAA 4RL2A 3A4YA 2Q42A 4PVOA 2FU9A 4GCWA 2Q0JA 3FAIA 3IE0A 2BGAA 2YNVB 4RAMA 2I7VA 5ACRA 4NQ2A 4NQ4A 4O98A 1X8GA 2NZFA 2OHJA 4UWSB 4UWRB 1DXKA 3DHCA 4AX1B 4XWTA 4D1TA 4TZEA 3ZQ4A 1DDKA 2WRSA 2BR6A 3PY5A 2VW8A 4Z60A 5HH6A 5HH5A 4EFZA 3IDZA 3I11A 2H6AA 4UBQA 2P97A 1BMCA 2ZZIA 1MQOA 4NQ6A 2BTNA 1KO2A 4P62A 2E7YA 3I0VA 3F9OA 2M5CA 2FU7A 4KEQA 3KNRA 4EY2A 1XTOA 4TZBA 1QH5A 3ZNBA 1YCHA 4Z7RA 5LE1A 1VJNA 5LCHA 4C09A 3RKKA 1ZKPA 4Z5YA 5LS3A 1KR3A 2WHGA 3ESHA 5LLDA 4UA4A 2UYXA 5HIPA 3FCZA 3G1PA 3R2UA 3DH8A 4ZO3A 3H3EA 4CHLA 1A8TA 4D02A 2YNTA 3IEMA 4AWYB 4AX0B 2BFKA 2FM6A 1WUOA 5ACVA 3L6NA 2P4ZA 4D1WA 3X2XA 5ACTA 4UWPB 2M5DA 5EVBA 3ZWFA 3IELA 2XF4A 1Y44A 4V0HA 5LMCA 3DHAA 2XR1A 5IQKA 4EYLA 5AHOA 1XM8A 5LCAA 4TYFA 2GFJA 5AHRA 2Y87A 4ZNBA 4KEPA 5EW0A 4D1VA 4Z6XA 2WYLA 1JJTA 4J5HA 5KILA 1JT1A 2P1EA 4GYUA 1BVTA 2QEDA 4C1EA 1E5DA 2BG2A 5LSCA 3AF5A 4FEKA 4PVTA 5K4NA 2BG6A 2Q0IA 1BC2A 2ZWRA 5ACWA 2AIOA 3I15A 3VQZA 4U4LA 4C1GA 3IOGA 4RM5A 3T3OA 3BV6A 2QDTA 3SPUA 2ZO4A 3QH8A 2NXAA 4LE6A 3DHBA 1ZTCA 3BC2A 2GMNA 1QH3A 2DKFA 4YSKA 4XUKA 3RPCA 2Y8BA 4FSBA 5HH4A 4XWWA 4D1UA 2A7MA 2QINA 1WRAA 4ZO2A 2OHHA 3I14A 2I7TA 4DIKA 2YNTB 4EYFA 5EV6A 4C1FA 2FU6A 1SMLA 5ACPA 5ACSA 4YSLA 1X8IA 4F6ZA 2CBNA 1DD6A 5ACUA 3PG4A 4H0DA 4Z5ZA 1JJEA 4JO0A 5A87A 4EXSA 4TYTA 4B87A 1HLKA 5LM6A
chains in the Genus database with same CATH superfamily
5K4MA 3T3NA 1ZNBA 2YZ3A 2GCUA 4UAMA 5B3RA 5A5ZA 3P2UA 1KO3A 3I13A 5HIOA 2NZEA 2OHIA 4BZ3A 3X30A 5EHTA 4NURA 3IE2A 4TZ9A 3IEKA 5FQCA 2FU8A 5KIKA 2YNUA 2GKLA 3BK2A 5A0VA 2BC2A 2HB9A 4F6HA 4WD6A 5DPXA 3ZR9A 4TZFA 3PY6A 4NQ5A 2BIBA 4Z67A 3Q6VA 2GFKA 3TP9A 2AZ4A 4UWOB 3AF6A 2R2DA 4RL0A 3AJ3A 5AEBA 2BFZB 3SRXA 5HIQA 3SBLA 5AXRA 1YCFA 4HKYA 4HL1A 3RKJA 2I7XA 3JXPA 1YCGA 2QDSA 5ACXA 1VGNA 4BP0A 2BFZA 5EH9A 3IOFA 4RAWA 2YNVA 3X2ZA 5B15A 2WYMC 2BMIA 3IE1A 2YNWA 1A7TA 3KNSA 5HISA 4RBSA 4EXYA 2CFUA 4ZEJA 3BK1A 1VMEA 2FHXB 4DILA 5B1UA 3VPEA 2NYPA 1WW1A 1WUPA 2P18A 5K4KA 4AD9A 5A23A 5EVDA 3SD9A 3LVZA 4PDXA 4AWZA 2YCBA 3WXCA 2Q9UA 3KL7A 2WYMA 5ACQA 2FHXA 4C1CA 3MD7A 5EVKA 5AYAA 4J5FA 4YSBA 3S0ZA 1M2XA 5FQBA 1X8HA 5K0WA 5AXOA 2ZNBA 3SW3A 2CG2A 2BFLA 4EYBA 2BG8B 4C1HA 5EV8A 3ADRA 2Y8AA 1K07A 4FR7A 3X2YA 3SFPA 5AIJA 5LCFA 4C1DA 5A0TA 3T9MA 1L9YA 2BG8A 2FK6A 2DOOA 4GYQA 1P9EA 2YHEA 4HL2A 2BG7A 2QJSA 5EWAA 5FQAA 4RL2A 3A4YA 2Q42A 4PVOA 2FU9A 4GCWA 2Q0JA 3FAIA 3IE0A 2BGAA 2YNVB 4RAMA 2I7VA 5ACRA 4NQ2A 4NQ4A 4O98A 1X8GA 2NZFA 2OHJA 4UWSB 4UWRB 1DXKA 3DHCA 4AX1B 4XWTA 4D1TA 4TZEA 3ZQ4A 1DDKA 2WRSA 2BR6A 3PY5A 2VW8A 4Z60A 5HH6A 5HH5A 4EFZA 3IDZA 3I11A 2H6AA 4UBQA 2P97A 1BMCA 2ZZIA 1MQOA 4NQ6A 2BTNA 1KO2A 4P62A 2E7YA 3I0VA 3F9OA 2M5CA 2FU7A 4KEQA 3KNRA 4EY2A 1XTOA 4TZBA 1QH5A 3ZNBA 1YCHA 4Z7RA 5LE1A 1VJNA 5LCHA 4C09A 3RKKA 1ZKPA 4Z5YA 5LS3A 1KR3A 2WHGA 3ESHA 5LLDA 4UA4A 2UYXA 5HIPA 3FCZA 3G1PA 3R2UA 3DH8A 4ZO3A 3H3EA 4CHLA 1A8TA 4D02A 2YNTA 3IEMA 4AWYB 4AV7A 4AX0B 2BFKA 2FM6A 1WUOA 5ACVA 3L6NA 2P4ZA 4D1WA 3X2XA 5ACTA 4UWPB 2M5DA 5EVBA 3ZWFA 3IELA 2XF4A 1Y44A 4V0HA 5LMCA 3DHAA 2XR1A 5IQKA 4EYLA 5AHOA 1XM8A 4AXHA 5LCAA 4TYFA 2GFJA 5AHRA 2CFZA 2Y87A 4ZNBA 4KEPA 5EW0A 4D1VA 4Z6XA 2WYLA 1JJTA 4J5HA 5KILA 1JT1A 2CG3A 2P1EA 4GYUA 1BVTA 2QEDA 4C1EA 1E5DA 2BG2A 5LSCA 3AF5A 4FEKA 4PVTA 5K4NA 2BG6A 2Q0IA 1BC2A 2ZWRA 5ACWA 2AIOA 3I15A 3VQZA 4U4LA 4C1GA 3IOGA 4RM5A 3T3OA 3BV6A 2QDTA 3SPUA 2ZO4A 3QH8A 2NXAA 4LE6A 3DHBA 1ZTCA 3BC2A 2GMNA 1QH3A 2DKFA 4YSKA 4XUKA 3RPCA 2Y8BA 4FSBA 5HH4A 4XWWA 4D1UA 2A7MA 2QINA 1WRAA 5AJLA 4ZO2A 2OHHA 3I14A 2I7TA 4DIKA 2YNTB 4EYFA 5EV6A 4C1FA 2FU6A 1SMLA 5ACPA 5ACSA 4YSLA 1X8IA 4F6ZA 2CBNA 1DD6A 5ACUA 3PG4A 4H0DA 4Z5ZA 1JJEA 4JO0A 5A87A 4EXSA 4TYTA 4B87A 1HLKA 5LM6A
chains in the Genus database with same CATH topology
5K4MA 3T3NA 1ZNBA 2YZ3A 2GCUA 4UAMA 5B3RA 5A5ZA 3P2UA 1KO3A 3I13A 5HIOA 2NZEA 2OHIA 4BZ3A 3X30A 5EHTA 3IE2A 4TZ9A 3IEKA 5FQCA 2FU8A 5KIKA 2YNUA 2GKLA 3BK2A 5A0VA 2BC2A 2HB9A 4F6HA 4WD6A 5DPXA 3ZR9A 4TZFA 3PY6A 4NQ5A 2BIBA 4Z67A 3Q6VA 2GFKA 3TP9A 2AZ4A 4UWOB 3AF6A 2R2DA 4RL0A 3AJ3A 5AEBA 2BFZB 3SRXA 5HIQA 3SBLA 5AXRA 1YCFA 4HKYA 4HL1A 3RKJA 2I7XA 3JXPA 1YCGA 2QDSA 5ACXA 1VGNA 4BP0A 2BFZA 5EH9A 3IOFA 4RAWA 2YNVA 3X2ZA 5B15A 2WYMC 2BMIA 3IE1A 2YNWA 1A7TA 3KNSA 5HISA 4RBSA 4EXYA 4ZEJA 3BK1A 1VMEA 2FHXB 4DILA 5B1UA 3VPEA 2NYPA 1WW1A 1WUPA 2P18A 5K4KA 4AD9A 5EVDA 3SD9A 3LVZA 4AWZA 2YCBA 3WXCA 2Q9UA 3KL7A 2WYMA 5ACQA 2FHXA 4C1CA 3MD7A 5EVKA 5AYAA 4J5FA 4YSBA 3S0ZA 1M2XA 5FQBA 1X8HA 5K0WA 5AXOA 2ZNBA 3SW3A 2BFLA 4EYBA 2BG8B 4C1HA 5EV8A 3ADRA 2Y8AA 1K07A 4FR7A 3X2YA 3SFPA 5LCFA 4C1DA 5A0TA 3T9MA 1L9YA 2BG8A 2FK6A 2DOOA 4GYQA 1P9EA 4HL2A 2BG7A 2QJSA 5EWAA 5FQAA 4RL2A 3A4YA 2Q42A 4PVOA 2FU9A 4GCWA 2Q0JA 3FAIA 3IE0A 2BGAA 2YNVB 4RAMA 2I7VA 5ACRA 4NQ2A 4NQ4A 4O98A 1X8GA 2NZFA 2OHJA 4UWSB 4UWRB 1DXKA 3DHCA 4AX1B 4XWTA 4D1TA 4TZEA 3ZQ4A 1DDKA 2WRSA 2BR6A 3PY5A 2VW8A 4Z60A 5HH6A 5HH5A 4EFZA 3IDZA 3I11A 2H6AA 4UBQA 2P97A 1BMCA 2ZZIA 1MQOA 4NQ6A 2BTNA 1KO2A 4P62A 2E7YA 3I0VA 3F9OA 2M5CA 2FU7A 4KEQA 3KNRA 4EY2A 1XTOA 4TZBA 1QH5A 3ZNBA 1YCHA 4Z7RA 5LE1A 1VJNA 5LCHA 4C09A 3RKKA 1ZKPA 4Z5YA 5LS3A 1KR3A 2WHGA 3ESHA 5LLDA 4UA4A 2UYXA 5HIPA 3FCZA 3G1PA 3R2UA 3DH8A 4ZO3A 3H3EA 4CHLA 1A8TA 4D02A 2YNTA 3IEMA 4AWYB 4AX0B 2BFKA 2FM6A 1WUOA 5ACVA 3L6NA 2P4ZA 4D1WA 3X2XA 5ACTA 4UWPB 2M5DA 5EVBA 3ZWFA 3IELA 2XF4A 1Y44A 4V0HA 5LMCA 3DHAA 2XR1A 5IQKA 4EYLA 5AHOA 1XM8A 5LCAA 4TYFA 2GFJA 5AHRA 2Y87A 4ZNBA 4KEPA 5EW0A 4D1VA 4Z6XA 2WYLA 1JJTA 4J5HA 5KILA 1JT1A 2P1EA 4GYUA 1BVTA 2QEDA 4C1EA 1E5DA 2BG2A 5LSCA 3AF5A 4FEKA 4PVTA 5K4NA 2BG6A 2Q0IA 1BC2A 2ZWRA 5ACWA 2AIOA 3I15A 3VQZA 4U4LA 4C1GA 3IOGA 4RM5A 3T3OA 3BV6A 2QDTA 3SPUA 2ZO4A 3QH8A 2NXAA 4LE6A 3DHBA 1ZTCA 3BC2A 2GMNA 1QH3A 2DKFA 4YSKA 4XUKA 3RPCA 2Y8BA 4FSBA 5HH4A 4XWWA 4D1UA 2A7MA 2QINA 1WRAA 4ZO2A 2OHHA 3I14A 2I7TA 4DIKA 2YNTB 4EYFA 5EV6A 4C1FA 2FU6A 1SMLA 5ACPA 5ACSA 4YSLA 1X8IA 4F6ZA 2CBNA 1DD6A 5ACUA 3PG4A 4H0DA 4Z5ZA 1JJEA 4JO0A 5A87A 4EXSA 4TYTA 4B87A 1HLKA 5LM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K4M A;  3T3N A;  1ZNB A;  2YZ3 A;  2GCU A;  4UAM A;  5B3R A;  5A5Z A;  3P2U A;  1KO3 A;  3I13 A;  5HIO A;  2NZE A;  2OHI A;  4BZ3 A;  3X30 A;  5EHT A;  3IE2 A;  4TZ9 A;  3IEK A;  5FQC A;  2FU8 A;  5KIK A;  2YNU A;  2GKL A;  3BK2 A;  5A0V A;  2BC2 A;  2HB9 A;  4F6H A;  4WD6 A;  5DPX A;  3ZR9 A;  4TZF A;  3PY6 A;  4NQ5 A;  2BIB A;  4Z67 A;  3Q6V A;  2GFK A;  3TP9 A;  2AZ4 A;  4UWO B;  3AF6 A;  2R2D A;  4RL0 A;  3AJ3 A;  5AEB A;  2BFZ B;  3SRX A;  5HIQ A;  3SBL A;  5AXR A;  1YCF A;  4HKY A;  4HL1 A;  3RKJ A;  2I7X A;  3JXP A;  1YCG A;  2QDS A;  5ACX A;  1VGN A;  4BP0 A;  2BFZ A;  5EH9 A;  3IOF A;  4RAW A;  2YNV A;  3X2Z A;  5B15 A;  2WYM C;  2BMI A;  3IE1 A;  2YNW A;  1A7T A;  3KNS A;  5HIS A;  4RBS A;  4EXY A;  4ZEJ A;  3BK1 A;  1VME A;  2FHX B;  4DIL A;  5B1U A;  3VPE A;  2NYP A;  1WW1 A;  1WUP A;  2P18 A;  5K4K A;  4AD9 A;  5EVD A;  3SD9 A;  3LVZ A;  4AWZ A;  2YCB A;  3WXC A;  2Q9U A;  3KL7 A;  2WYM A;  5ACQ A;  2FHX A;  4C1C A;  3MD7 A;  5EVK A;  5AYA A;  4J5F A;  4YSB A;  3S0Z A;  1M2X A;  5FQB A;  1X8H A;  5K0W A;  5AXO A;  2ZNB A;  3SW3 A;  2BFL A;  4EYB A;  2BG8 B;  4C1H A;  5EV8 A;  3ADR A;  2Y8A A;  1K07 A;  4FR7 A;  3X2Y A;  3SFP A;  5LCF A;  4C1D A;  5A0T A;  3T9M A;  1L9Y A;  2BG8 A;  2FK6 A;  2DOO A;  4GYQ A;  1P9E A;  4HL2 A;  2BG7 A;  2QJS A;  5EWA A;  5FQA A;  4RL2 A;  3A4Y A;  2Q42 A;  4PVO A;  2FU9 A;  4GCW A;  2Q0J A;  3FAI A;  3IE0 A;  2BGA A;  2YNV B;  4RAM A;  2I7V A;  5ACR A;  4NQ2 A;  4NQ4 A;  4O98 A;  1X8G A;  2NZF A;  2OHJ A;  4UWS B;  4UWR B;  1DXK A;  3DHC A;  4AX1 B;  4XWT A;  4D1T A;  4TZE A;  3ZQ4 A;  1DDK A;  2WRS A;  2BR6 A;  3PY5 A;  2VW8 A;  4Z60 A;  5HH6 A;  5HH5 A;  4EFZ A;  3IDZ A;  3I11 A;  2H6A A;  4UBQ A;  2P97 A;  1BMC A;  2ZZI A;  1MQO A;  4NQ6 A;  2BTN A;  1KO2 A;  4P62 A;  2E7Y A;  3I0V A;  3F9O A;  2M5C A;  2FU7 A;  4KEQ A;  3KNR A;  4EY2 A;  1XTO A;  4TZB A;  1QH5 A;  3ZNB A;  1YCH A;  4Z7R A;  5LE1 A;  1VJN A;  5LCH A;  4C09 A;  3RKK A;  1ZKP A;  4Z5Y A;  5LS3 A;  1KR3 A;  2WHG A;  3ESH A;  5LLD A;  4UA4 A;  2UYX A;  5HIP A;  3FCZ A;  3G1P A;  3R2U A;  3DH8 A;  4ZO3 A;  3H3E A;  4CHL A;  1A8T A;  4D02 A;  2YNT A;  3IEM A;  4AWY B;  4AX0 B;  2BFK A;  2FM6 A;  1WUO A;  5ACV A;  3L6N A;  2P4Z A;  4D1W A;  3X2X A;  5ACT A;  4UWP B;  2M5D A;  5EVB A;  3ZWF A;  3IEL A;  2XF4 A;  1Y44 A;  4V0H A;  5LMC A;  3DHA A;  2XR1 A;  5IQK A;  4EYL A;  5AHO A;  1XM8 A;  5LCA A;  4TYF A;  2GFJ A;  5AHR A;  2Y87 A;  4ZNB A;  4KEP A;  5EW0 A;  4D1V A;  4Z6X A;  2WYL A;  1JJT A;  4J5H A;  5KIL A;  1JT1 A;  2P1E A;  4GYU A;  1BVT A;  2QED A;  4C1E A;  1E5D A;  2BG2 A;  5LSC A;  3AF5 A;  4FEK A;  4PVT A;  5K4N A;  2BG6 A;  2Q0I A;  1BC2 A;  2ZWR A;  5ACW A;  2AIO A;  3I15 A;  3VQZ A;  4U4L A;  4C1G A;  3IOG A;  4RM5 A;  3T3O A;  3BV6 A;  2QDT A;  3SPU A;  2ZO4 A;  3QH8 A;  2NXA A;  4LE6 A;  3DHB A;  1ZTC A;  3BC2 A;  2GMN A;  1QH3 A;  2DKF A;  4YSK A;  4XUK A;  3RPC A;  2Y8B A;  4FSB A;  5HH4 A;  4XWW A;  4D1U A;  2A7M A;  2QIN A;  1WRA A;  4ZO2 A;  2OHH A;  3I14 A;  2I7T A;  4DIK A;  2YNT B;  4EYF A;  5EV6 A;  4C1F A;  2FU6 A;  1SML A;  5ACP A;  5ACS A;  4YSL A;  1X8I A;  4F6Z A;  2CBN A;  1DD6 A;  5ACU A;  3PG4 A;  4H0D A;  4Z5Z A;  1JJE A;  4JO0 A;  5A87 A;  4EXS A;  4TYT A;  4B87 A;  1HLK A;  5LM6 A; 
#chains in the Genus database with same CATH topology
 5K4M A;  3T3N A;  1ZNB A;  2YZ3 A;  2GCU A;  4UAM A;  5B3R A;  5A5Z A;  3P2U A;  1KO3 A;  3I13 A;  5HIO A;  2NZE A;  2OHI A;  4BZ3 A;  3X30 A;  5EHT A;  4NUR A;  3IE2 A;  4TZ9 A;  3IEK A;  5FQC A;  2FU8 A;  5KIK A;  2YNU A;  2GKL A;  3BK2 A;  5A0V A;  2BC2 A;  2HB9 A;  4F6H A;  4WD6 A;  5DPX A;  3ZR9 A;  4TZF A;  3PY6 A;  4NQ5 A;  2BIB A;  4Z67 A;  3Q6V A;  2GFK A;  3TP9 A;  2AZ4 A;  4UWO B;  3AF6 A;  2R2D A;  4RL0 A;  3AJ3 A;  5AEB A;  2BFZ B;  3SRX A;  5HIQ A;  3SBL A;  5AXR A;  1YCF A;  4HKY A;  4HL1 A;  3RKJ A;  2I7X A;  3JXP A;  1YCG A;  2QDS A;  5ACX A;  1VGN A;  4BP0 A;  2BFZ A;  5EH9 A;  3IOF A;  4RAW A;  2YNV A;  3X2Z A;  5B15 A;  2WYM C;  2BMI A;  3IE1 A;  2YNW A;  1A7T A;  3KNS A;  5HIS A;  4RBS A;  4EXY A;  2CFU A;  4ZEJ A;  3BK1 A;  1VME A;  2FHX B;  4DIL A;  5B1U A;  3VPE A;  2NYP A;  1WW1 A;  1WUP A;  2P18 A;  5K4K A;  4AD9 A;  5A23 A;  5EVD A;  3SD9 A;  3LVZ A;  4PDX A;  4AWZ A;  2YCB A;  3WXC A;  2Q9U A;  3KL7 A;  2WYM A;  5ACQ A;  2FHX A;  4C1C A;  3MD7 A;  5EVK A;  5AYA A;  4J5F A;  4YSB A;  3S0Z A;  1M2X A;  5FQB A;  1X8H A;  5K0W A;  5AXO A;  2ZNB A;  3SW3 A;  2CG2 A;  2BFL A;  4EYB A;  2BG8 B;  4C1H A;  5EV8 A;  3ADR A;  2Y8A A;  1K07 A;  4FR7 A;  3X2Y A;  3SFP A;  5AIJ A;  5LCF A;  4C1D A;  5A0T A;  3T9M A;  1L9Y A;  2BG8 A;  2FK6 A;  2DOO A;  4GYQ A;  1P9E A;  2YHE A;  4HL2 A;  2BG7 A;  2QJS A;  5EWA A;  5FQA A;  4RL2 A;  3A4Y A;  2Q42 A;  4PVO A;  2FU9 A;  4GCW A;  2Q0J A;  3FAI A;  3IE0 A;  2BGA A;  2YNV B;  4RAM A;  2I7V A;  5ACR A;  4NQ2 A;  4NQ4 A;  4O98 A;  1X8G A;  2NZF A;  2OHJ A;  4UWS B;  4UWR B;  1DXK A;  3DHC A;  4AX1 B;  4XWT A;  4D1T A;  4TZE A;  3ZQ4 A;  1DDK A;  2WRS A;  2BR6 A;  3PY5 A;  2VW8 A;  4Z60 A;  5HH6 A;  5HH5 A;  4EFZ A;  3IDZ A;  3I11 A;  2H6A A;  4UBQ A;  2P97 A;  1BMC A;  2ZZI A;  1MQO A;  4NQ6 A;  2BTN A;  1KO2 A;  4P62 A;  2E7Y A;  3I0V A;  3F9O A;  2M5C A;  2FU7 A;  4KEQ A;  3KNR A;  4EY2 A;  1XTO A;  4TZB A;  1QH5 A;  3ZNB A;  1YCH A;  4Z7R A;  5LE1 A;  1VJN A;  5LCH A;  4C09 A;  3RKK A;  1ZKP A;  4Z5Y A;  5LS3 A;  1KR3 A;  2WHG A;  3ESH A;  5LLD A;  4UA4 A;  2UYX A;  5HIP A;  3FCZ A;  3G1P A;  3R2U A;  3DH8 A;  4ZO3 A;  3H3E A;  4CHL A;  1A8T A;  4D02 A;  2YNT A;  3IEM A;  4AWY B;  4AV7 A;  4AX0 B;  2BFK A;  2FM6 A;  1WUO A;  5ACV A;  3L6N A;  2P4Z A;  4D1W A;  3X2X A;  5ACT A;  4UWP B;  2M5D A;  5EVB A;  3ZWF A;  3IEL A;  2XF4 A;  1Y44 A;  4V0H A;  5LMC A;  3DHA A;  2XR1 A;  5IQK A;  4EYL A;  5AHO A;  1XM8 A;  4AXH A;  5LCA A;  4TYF A;  2GFJ A;  5AHR A;  2CFZ A;  2Y87 A;  4ZNB A;  4KEP A;  5EW0 A;  4D1V A;  4Z6X A;  2WYL A;  1JJT A;  4J5H A;  5KIL A;  1JT1 A;  2CG3 A;  2P1E A;  4GYU A;  1BVT A;  2QED A;  4C1E A;  1E5D A;  2BG2 A;  5LSC A;  3AF5 A;  4FEK A;  4PVT A;  5K4N A;  2BG6 A;  2Q0I A;  1BC2 A;  2ZWR A;  5ACW A;  2AIO A;  3I15 A;  3VQZ A;  4U4L A;  4C1G A;  3IOG A;  4RM5 A;  3T3O A;  3BV6 A;  2QDT A;  3SPU A;  2ZO4 A;  3QH8 A;  2NXA A;  4LE6 A;  3DHB A;  1ZTC A;  3BC2 A;  2GMN A;  1QH3 A;  2DKF A;  4YSK A;  4XUK A;  3RPC A;  2Y8B A;  4FSB A;  5HH4 A;  4XWW A;  4D1U A;  2A7M A;  2QIN A;  1WRA A;  5AJL A;  4ZO2 A;  2OHH A;  3I14 A;  2I7T A;  4DIK A;  2YNT B;  4EYF A;  5EV6 A;  4C1F A;  2FU6 A;  1SML A;  5ACP A;  5ACS A;  4YSL A;  1X8I A;  4F6Z A;  2CBN A;  1DD6 A;  5ACU A;  3PG4 A;  4H0D A;  4Z5Z A;  1JJE A;  4JO0 A;  5A87 A;  4EXS A;  4TYT A;  4B87 A;  1HLK A;  5LM6 A; 
#chains in the Genus database with same CATH homology
 5K4M A;  3T3N A;  1ZNB A;  2YZ3 A;  2GCU A;  4UAM A;  5B3R A;  5A5Z A;  3P2U A;  1KO3 A;  3I13 A;  5HIO A;  2NZE A;  2OHI A;  4BZ3 A;  3X30 A;  5EHT A;  3IE2 A;  4TZ9 A;  3IEK A;  5FQC A;  2FU8 A;  5KIK A;  2YNU A;  2GKL A;  3BK2 A;  5A0V A;  2BC2 A;  2HB9 A;  4F6H A;  4WD6 A;  5DPX A;  3ZR9 A;  4TZF A;  3PY6 A;  4NQ5 A;  2BIB A;  4Z67 A;  3Q6V A;  2GFK A;  3TP9 A;  2AZ4 A;  4UWO B;  3AF6 A;  2R2D A;  4RL0 A;  3AJ3 A;  5AEB A;  2BFZ B;  3SRX A;  5HIQ A;  3SBL A;  5AXR A;  1YCF A;  4HKY A;  4HL1 A;  3RKJ A;  2I7X A;  3JXP A;  1YCG A;  2QDS A;  5ACX A;  1VGN A;  4BP0 A;  2BFZ A;  5EH9 A;  3IOF A;  4RAW A;  2YNV A;  3X2Z A;  5B15 A;  2WYM C;  2BMI A;  3IE1 A;  2YNW A;  1A7T A;  3KNS A;  5HIS A;  4RBS A;  4EXY A;  4ZEJ A;  3BK1 A;  1VME A;  2FHX B;  4DIL A;  5B1U A;  3VPE A;  2NYP A;  1WW1 A;  1WUP A;  2P18 A;  5K4K A;  4AD9 A;  5EVD A;  3SD9 A;  3LVZ A;  4AWZ A;  2YCB A;  3WXC A;  2Q9U A;  3KL7 A;  2WYM A;  5ACQ A;  2FHX A;  4C1C A;  3MD7 A;  5EVK A;  5AYA A;  4J5F A;  4YSB A;  3S0Z A;  1M2X A;  5FQB A;  1X8H A;  5K0W A;  5AXO A;  2ZNB A;  3SW3 A;  2BFL A;  4EYB A;  2BG8 B;  4C1H A;  5EV8 A;  3ADR A;  2Y8A A;  1K07 A;  4FR7 A;  3X2Y A;  3SFP A;  5LCF A;  4C1D A;  5A0T A;  3T9M A;  1L9Y A;  2BG8 A;  2FK6 A;  2DOO A;  4GYQ A;  1P9E A;  4HL2 A;  2BG7 A;  2QJS A;  5EWA A;  5FQA A;  4RL2 A;  3A4Y A;  2Q42 A;  4PVO A;  2FU9 A;  4GCW A;  2Q0J A;  3FAI A;  3IE0 A;  2BGA A;  2YNV B;  4RAM A;  2I7V A;  5ACR A;  4NQ2 A;  4NQ4 A;  4O98 A;  1X8G A;  2NZF A;  2OHJ A;  4UWS B;  4UWR B;  1DXK A;  3DHC A;  4AX1 B;  4XWT A;  4D1T A;  4TZE A;  3ZQ4 A;  1DDK A;  2WRS A;  2BR6 A;  3PY5 A;  2VW8 A;  4Z60 A;  5HH6 A;  5HH5 A;  4EFZ A;  3IDZ A;  3I11 A;  2H6A A;  4UBQ A;  2P97 A;  1BMC A;  2ZZI A;  1MQO A;  4NQ6 A;  2BTN A;  1KO2 A;  4P62 A;  2E7Y A;  3I0V A;  3F9O A;  2M5C A;  2FU7 A;  4KEQ A;  3KNR A;  4EY2 A;  1XTO A;  4TZB A;  1QH5 A;  3ZNB A;  1YCH A;  4Z7R A;  5LE1 A;  1VJN A;  5LCH A;  4C09 A;  3RKK A;  1ZKP A;  4Z5Y A;  5LS3 A;  1KR3 A;  2WHG A;  3ESH A;  5LLD A;  4UA4 A;  2UYX A;  5HIP A;  3FCZ A;  3G1P A;  3R2U A;  3DH8 A;  4ZO3 A;  3H3E A;  4CHL A;  1A8T A;  4D02 A;  2YNT A;  3IEM A;  4AWY B;  4AX0 B;  2BFK A;  2FM6 A;  1WUO A;  5ACV A;  3L6N A;  2P4Z A;  4D1W A;  3X2X A;  5ACT A;  4UWP B;  2M5D A;  5EVB A;  3ZWF A;  3IEL A;  2XF4 A;  1Y44 A;  4V0H A;  5LMC A;  3DHA A;  2XR1 A;  5IQK A;  4EYL A;  5AHO A;  1XM8 A;  5LCA A;  4TYF A;  2GFJ A;  5AHR A;  2Y87 A;  4ZNB A;  4KEP A;  5EW0 A;  4D1V A;  4Z6X A;  2WYL A;  1JJT A;  4J5H A;  5KIL A;  1JT1 A;  2P1E A;  4GYU A;  1BVT A;  2QED A;  4C1E A;  1E5D A;  2BG2 A;  5LSC A;  3AF5 A;  4FEK A;  4PVT A;  5K4N A;  2BG6 A;  2Q0I A;  1BC2 A;  2ZWR A;  5ACW A;  2AIO A;  3I15 A;  3VQZ A;  4U4L A;  4C1G A;  3IOG A;  4RM5 A;  3T3O A;  3BV6 A;  2QDT A;  3SPU A;  2ZO4 A;  3QH8 A;  2NXA A;  4LE6 A;  3DHB A;  1ZTC A;  3BC2 A;  2GMN A;  1QH3 A;  2DKF A;  4YSK A;  4XUK A;  3RPC A;  2Y8B A;  4FSB A;  5HH4 A;  4XWW A;  4D1U A;  2A7M A;  2QIN A;  1WRA A;  4ZO2 A;  2OHH A;  3I14 A;  2I7T A;  4DIK A;  2YNT B;  4EYF A;  5EV6 A;  4C1F A;  2FU6 A;  1SML A;  5ACP A;  5ACS A;  4YSL A;  1X8I A;  4F6Z A;  2CBN A;  1DD6 A;  5ACU A;  3PG4 A;  4H0D A;  4Z5Z A;  1JJE A;  4JO0 A;  5A87 A;  4EXS A;  4TYT A;  4B87 A;  1HLK A;  5LM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...