3PY5A

Crystal structure of a beta-lactamase-like protein from brucella melitensis bound to amp
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
270
structure length
270
Chain Sequence
SPRNCLRFTLLGCGSSPGVPRINGDWGKCDPKNPKNRRRRASLLVERYDAEGNNTVVVIDTGPDFRMQMIDSGVHMLDAAVYTHPHADHIHGIDDLRTYVVDNGRLMDVYANRLTRNRLYDTFGYCFETPVGSSYPPILSMHDIAPETPFSIEGAGGAIRFEPFSQVHGDIESLGFRIGSVVYCTDVSAFPEQSLQYIKDADVLIIGALQYRPHPSHFSLGEALEWIEKLSPKRAILTHMHVPLDYETVMRETPHHVEPGYDGLRFEVAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase-like
publication title BrabA.11339.a: anomalous diffraction and ligand binding guide towards the elucidation of the function of a `putative beta-lactamase-like protein from Brucella melitensis.
pubmed doi rcsb
source organism Brucella melitensis biovar abortus
molecule tags Hydrolase
total genus 81
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2010-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3py5A00
2BC2A 2BG8A 5HH4A 2M5CA 2BG7A 3ZNBA 3R2UA 4EYFA 4UBQA 1DDKA 2BTNA 3SW3A 5HIOA 4O98A 1A8TA 1YCFA 4UWPB 4TZFA 1JT1A 3IOGA 5EV8A 2YCBA 3SPUA 2BG2A 1VJNA 4D1WA 3I0VA 3RKKA 2GMNA 2P18A 3PY5A 5LCFA 2YNVA 1X8HA 1DXKA 4D1TA 2OHJA 4NQ2A 4RL2A 5B3RA 2OHHA 3FCZA 1DD6A 4J5HA 5HH5A 3ZR9A 3P2UA 2WYLA 2FM6A 1VGNA 2BGAA 3A4YA 2YNVB 1ZNBA 4GCWA 5LCHA 2ZWRA 1P9EA 4AX0B 4WD6A 4KEPA 3IE0A 2QEDA 4C1EA 2OHIA 4V0HA 4C09A 5A87A 4RBSA 5EVBA 2NZFA 4RM5A 5LS3A 2QJSA 2FU8A 2BIBA 2H6AA 5KILA 4RL0A 2WHGA 2Y87A 3X30A 5LSCA 4D1UA 2YNWA 2DKFA 3MD7A 4TZBA 2YNUA 3DHAA 5EHTA 3ZQ4A 1E5DA 4NQ6A 3SRXA 4C1DA 4ZO3A 1X8GA 1BVTA 4D02A 3TP9A 2BMIA 2P1EA 5A0TA 2Y8BA 5IQKA 3DHBA 4D1VA 4EFZA 2Q42A 5ACUA 4XWTA 4AD9A 4C1CA 2XR1A 4DILA 5LMCA 4Z5ZA 3SD9A 3RKJA 2BG8B 4F6HA 3T9MA 1A7TA 4EXSA 4TZEA 2BG6A 3LVZA 4ZO2A 3IEMA 5FQAA 2QDTA 2BFZA 3IE1A 3AF5A 3X2XA 5AXOA 2XF4A 4EYLA 4AWZA 4ZNBA 2WRSA 1KO2A 2HB9A 5AHOA 4HL2A 3BC2A 3T3NA 4C1HA 2BFKA 2VW8A 1WW1A 3ZWFA 2BFZB 5A5ZA 4LE6A 5EVDA 4U4LA 3VQZA 4JO0A 2YZ3A 2I7TA 4ZEJA 3BV6A 4BP0A 1ZTCA 1K07A 3KL7A 3KNRA 5EV6A 5ACVA 4TYTA 2R2DA 4FR7A 5AXRA 5FQCA 5B15A 3T3OA 2P97A 3BK1A 5HISA 4CHLA 2A7MA 4GYUA 1X8IA 1YCHA 4TYFA 3Q6VA 2CBNA 4B87A 5B1UA 1MQOA 4AX1B 5ACWA 5AEBA 5ACTA 1YCGA 1XTOA 5LM6A 2WYMA 5EW0A 2QINA 1L9YA 5DPXA 3VPEA 3AF6A 5LCAA 2QDSA 4YSLA 3SBLA 4UWSB 4H0DA 1ZKPA 2BFLA 4UWRB 1WRAA 2I7XA 3I11A 2AZ4A 3IDZA 2GCUA 5KIKA 4EXYA 2ZNBA 2YNTA 1WUOA 5AHRA 2NZEA 2BR6A 2FU7A 4Z60A 3X2YA 4HKYA 3FAIA 3I13A 1KR3A 3DHCA 2YNTB 3PY6A 1BMCA 5EH9A 4NQ5A 2ZZIA 4UA4A 4P62A 5A0VA 5ACSA 2NXAA 4YSKA 4BZ3A 4EYBA 1HLKA 2GFJA 2Q9UA 4FEKA 5HH6A 2Q0JA 4Z7RA 1JJTA 4J5FA 5K4KA 4PVOA 1Y44A 1QH3A 4Z5YA 3IE2A 1KO3A 5ACQA 5ACPA 5FQBA 2AIOA 2M5DA 1SMLA 4PVTA 4Z67A 5HIPA 3DH8A 4Z6XA 4UWOB 4EY2A 3BK2A 3AJ3A 4TZ9A 2WYMC 3I14A 3ADRA 3PG4A 2I7VA 3SFPA 3X2ZA 2E7YA 2FHXA 3IOFA 4GYQA 3F9OA 3G1PA 3RPCA 4XUKA 4FSBA 5K0WA 2FU9A 5EVKA 5EWAA 3H3EA 5LE1A 2ZO4A 2Y8AA 4NQ4A 5AYAA 5ACRA 4UAMA 5LLDA 5ACXA 5K4MA 2FHXB 4F6ZA 1JJEA 2P4ZA 2FK6A 3IELA 2Q0IA 4RAMA 3WXCA 3JXPA 3IEKA 5K4NA 2GKLA 4YSBA 3KNSA 2FU6A 4RAWA 4HL1A 4C1GA 4AWYB 1XM8A 3I15A 5HIQA 1QH5A 4XWWA 1BC2A 4KEQA 4DIKA 1WUPA 2DOOA 1VMEA 2GFKA 3QH8A 4C1FA 3S0ZA 3ESHA 1M2XA 2NYPA 2UYXA 3L6NA
chains in the Genus database with same CATH superfamily
2BC2A 2BG8A 5HH4A 2M5CA 2BG7A 3ZNBA 3R2UA 4EYFA 4UBQA 1DDKA 2BTNA 3SW3A 5HIOA 4O98A 1A8TA 1YCFA 4UWPB 4TZFA 1JT1A 3IOGA 5EV8A 2YCBA 3SPUA 2BG2A 1VJNA 4D1WA 3I0VA 3RKKA 2GMNA 2P18A 3PY5A 5LCFA 2YNVA 1X8HA 1DXKA 4D1TA 2OHJA 4NQ2A 4RL2A 5B3RA 2OHHA 3FCZA 1DD6A 4J5HA 5HH5A 3ZR9A 3P2UA 2WYLA 2FM6A 1VGNA 2BGAA 3A4YA 2YNVB 1ZNBA 4GCWA 5LCHA 2ZWRA 1P9EA 4AX0B 4WD6A 4KEPA 3IE0A 2QEDA 4C1EA 2OHIA 4V0HA 4C09A 5AJLA 5A87A 4RBSA 5EVBA 2NZFA 4RM5A 5AIJA 5LS3A 2QJSA 2FU8A 2BIBA 2H6AA 5KILA 4NURA 4RL0A 2WHGA 2Y87A 3X30A 5LSCA 4D1UA 2YNWA 2DKFA 3MD7A 4TZBA 2YNUA 3DHAA 5EHTA 3ZQ4A 1E5DA 4NQ6A 3SRXA 4C1DA 4ZO3A 1X8GA 1BVTA 4D02A 3TP9A 2BMIA 2P1EA 5A0TA 2Y8BA 5IQKA 3DHBA 4D1VA 4EFZA 2Q42A 5ACUA 4XWTA 4AD9A 4C1CA 2XR1A 4DILA 5LMCA 4Z5ZA 3SD9A 3RKJA 2BG8B 4F6HA 3T9MA 1A7TA 4EXSA 4TZEA 2BG6A 3LVZA 4ZO2A 3IEMA 5FQAA 2QDTA 2BFZA 2CG2A 3IE1A 3AF5A 3X2XA 5AXOA 2XF4A 4EYLA 4AWZA 4ZNBA 2WRSA 1KO2A 2HB9A 5AHOA 4HL2A 3BC2A 3T3NA 4C1HA 2BFKA 2VW8A 1WW1A 3ZWFA 2BFZB 5A5ZA 4LE6A 5EVDA 4U4LA 3VQZA 4JO0A 2YZ3A 2I7TA 4ZEJA 2CFUA 3BV6A 4BP0A 1ZTCA 1K07A 3KL7A 3KNRA 5EV6A 5ACVA 4TYTA 2R2DA 4FR7A 5AXRA 2CG3A 5FQCA 5B15A 3T3OA 2P97A 3BK1A 5HISA 4CHLA 2A7MA 4GYUA 1X8IA 1YCHA 4TYFA 3Q6VA 2CBNA 4B87A 5B1UA 1MQOA 4AX1B 5ACWA 5AEBA 5ACTA 1YCGA 1XTOA 5LM6A 2WYMA 5EW0A 2QINA 1L9YA 5DPXA 3VPEA 4AXHA 3AF6A 5LCAA 2QDSA 4YSLA 3SBLA 4UWSB 4H0DA 1ZKPA 2BFLA 4UWRB 1WRAA 2I7XA 3I11A 2AZ4A 3IDZA 2GCUA 5KIKA 4EXYA 2ZNBA 2YNTA 1WUOA 5AHRA 2NZEA 2BR6A 2FU7A 4Z60A 3X2YA 4HKYA 3FAIA 3I13A 1KR3A 3DHCA 2YNTB 3PY6A 1BMCA 5EH9A 4NQ5A 2ZZIA 4UA4A 4P62A 5A0VA 5ACSA 2NXAA 4YSKA 4BZ3A 4EYBA 1HLKA 2GFJA 2Q9UA 4FEKA 5HH6A 2Q0JA 4Z7RA 1JJTA 4J5FA 5K4KA 4PVOA 1Y44A 2YHEA 1QH3A 4Z5YA 3IE2A 1KO3A 5ACQA 5ACPA 5FQBA 2AIOA 2M5DA 1SMLA 4PVTA 4Z67A 5HIPA 3DH8A 4Z6XA 4UWOB 4EY2A 3BK2A 3AJ3A 4TZ9A 2WYMC 3I14A 3ADRA 3PG4A 2I7VA 3SFPA 3X2ZA 2E7YA 2FHXA 3IOFA 4GYQA 3F9OA 2CFZA 3G1PA 3RPCA 4XUKA 4FSBA 5A23A 5K0WA 2FU9A 5EVKA 5EWAA 3H3EA 5LE1A 2ZO4A 2Y8AA 4NQ4A 5AYAA 5ACRA 4UAMA 5LLDA 5ACXA 5K4MA 2FHXB 4F6ZA 1JJEA 2P4ZA 2FK6A 3IELA 2Q0IA 4RAMA 3WXCA 3JXPA 3IEKA 5K4NA 2GKLA 4YSBA 3KNSA 2FU6A 4RAWA 4HL1A 4C1GA 4AWYB 1XM8A 3I15A 5HIQA 1QH5A 4XWWA 1BC2A 4KEQA 4AV7A 4DIKA 1WUPA 2DOOA 1VMEA 4PDXA 2GFKA 3QH8A 4C1FA 3S0ZA 3ESHA 1M2XA 2NYPA 2UYXA 3L6NA
chains in the Genus database with same CATH topology
2BC2A 2BG8A 5HH4A 2M5CA 2BG7A 3ZNBA 3R2UA 4EYFA 4UBQA 1DDKA 2BTNA 3SW3A 5HIOA 4O98A 1A8TA 1YCFA 4UWPB 4TZFA 1JT1A 3IOGA 5EV8A 2YCBA 3SPUA 2BG2A 1VJNA 4D1WA 3I0VA 3RKKA 2GMNA 2P18A 3PY5A 5LCFA 2YNVA 1X8HA 1DXKA 4D1TA 2OHJA 4NQ2A 4RL2A 5B3RA 2OHHA 3FCZA 1DD6A 4J5HA 5HH5A 3ZR9A 3P2UA 2WYLA 2FM6A 1VGNA 2BGAA 3A4YA 2YNVB 1ZNBA 4GCWA 5LCHA 2ZWRA 1P9EA 4AX0B 4WD6A 4KEPA 3IE0A 2QEDA 4C1EA 2OHIA 4V0HA 4C09A 5A87A 4RBSA 5EVBA 2NZFA 4RM5A 5LS3A 2QJSA 2FU8A 2BIBA 2H6AA 5KILA 4RL0A 2WHGA 2Y87A 3X30A 5LSCA 4D1UA 2YNWA 2DKFA 3MD7A 4TZBA 2YNUA 3DHAA 5EHTA 3ZQ4A 1E5DA 4NQ6A 3SRXA 4C1DA 4ZO3A 1X8GA 1BVTA 4D02A 3TP9A 2BMIA 2P1EA 5A0TA 2Y8BA 5IQKA 3DHBA 4D1VA 4EFZA 2Q42A 5ACUA 4XWTA 4AD9A 4C1CA 2XR1A 4DILA 5LMCA 4Z5ZA 3SD9A 3RKJA 2BG8B 4F6HA 3T9MA 1A7TA 4EXSA 4TZEA 2BG6A 3LVZA 4ZO2A 3IEMA 5FQAA 2QDTA 2BFZA 3IE1A 3AF5A 3X2XA 5AXOA 2XF4A 4EYLA 4AWZA 4ZNBA 2WRSA 1KO2A 2HB9A 5AHOA 4HL2A 3BC2A 3T3NA 4C1HA 2BFKA 2VW8A 1WW1A 3ZWFA 2BFZB 5A5ZA 4LE6A 5EVDA 4U4LA 3VQZA 4JO0A 2YZ3A 2I7TA 4ZEJA 3BV6A 4BP0A 1ZTCA 1K07A 3KL7A 3KNRA 5EV6A 5ACVA 4TYTA 2R2DA 4FR7A 5AXRA 5FQCA 5B15A 3T3OA 2P97A 3BK1A 5HISA 4CHLA 2A7MA 4GYUA 1X8IA 1YCHA 4TYFA 3Q6VA 2CBNA 4B87A 5B1UA 1MQOA 4AX1B 5ACWA 5AEBA 5ACTA 1YCGA 1XTOA 5LM6A 2WYMA 5EW0A 2QINA 1L9YA 5DPXA 3VPEA 3AF6A 5LCAA 2QDSA 4YSLA 3SBLA 4UWSB 4H0DA 1ZKPA 2BFLA 4UWRB 1WRAA 2I7XA 3I11A 2AZ4A 3IDZA 2GCUA 5KIKA 4EXYA 2ZNBA 2YNTA 1WUOA 5AHRA 2NZEA 2BR6A 2FU7A 4Z60A 3X2YA 4HKYA 3FAIA 3I13A 1KR3A 3DHCA 2YNTB 3PY6A 1BMCA 5EH9A 4NQ5A 2ZZIA 4UA4A 4P62A 5A0VA 5ACSA 2NXAA 4YSKA 4BZ3A 4EYBA 1HLKA 2GFJA 2Q9UA 4FEKA 5HH6A 2Q0JA 4Z7RA 1JJTA 4J5FA 5K4KA 4PVOA 1Y44A 1QH3A 4Z5YA 3IE2A 1KO3A 5ACQA 5ACPA 5FQBA 2AIOA 2M5DA 1SMLA 4PVTA 4Z67A 5HIPA 3DH8A 4Z6XA 4UWOB 4EY2A 3BK2A 3AJ3A 4TZ9A 2WYMC 3I14A 3ADRA 3PG4A 2I7VA 3SFPA 3X2ZA 2E7YA 2FHXA 3IOFA 4GYQA 3F9OA 3G1PA 3RPCA 4XUKA 4FSBA 5K0WA 2FU9A 5EVKA 5EWAA 3H3EA 5LE1A 2ZO4A 2Y8AA 4NQ4A 5AYAA 5ACRA 4UAMA 5LLDA 5ACXA 5K4MA 2FHXB 4F6ZA 1JJEA 2P4ZA 2FK6A 3IELA 2Q0IA 4RAMA 3WXCA 3JXPA 3IEKA 5K4NA 2GKLA 4YSBA 3KNSA 2FU6A 4RAWA 4HL1A 4C1GA 4AWYB 1XM8A 3I15A 5HIQA 1QH5A 4XWWA 1BC2A 4KEQA 4DIKA 1WUPA 2DOOA 1VMEA 2GFKA 3QH8A 4C1FA 3S0ZA 3ESHA 1M2XA 2NYPA 2UYXA 3L6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BC2 A;  2BG8 A;  5HH4 A;  2M5C A;  2BG7 A;  3ZNB A;  3R2U A;  4EYF A;  4UBQ A;  1DDK A;  2BTN A;  3SW3 A;  5HIO A;  4O98 A;  1A8T A;  1YCF A;  4UWP B;  4TZF A;  1JT1 A;  3IOG A;  5EV8 A;  2YCB A;  3SPU A;  2BG2 A;  1VJN A;  4D1W A;  3I0V A;  3RKK A;  2GMN A;  2P18 A;  3PY5 A;  5LCF A;  2YNV A;  1X8H A;  1DXK A;  4D1T A;  2OHJ A;  4NQ2 A;  4RL2 A;  5B3R A;  2OHH A;  3FCZ A;  1DD6 A;  4J5H A;  5HH5 A;  3ZR9 A;  3P2U A;  2WYL A;  2FM6 A;  1VGN A;  2BGA A;  3A4Y A;  2YNV B;  1ZNB A;  4GCW A;  5LCH A;  2ZWR A;  1P9E A;  4AX0 B;  4WD6 A;  4KEP A;  3IE0 A;  2QED A;  4C1E A;  2OHI A;  4V0H A;  4C09 A;  5A87 A;  4RBS A;  5EVB A;  2NZF A;  4RM5 A;  5LS3 A;  2QJS A;  2FU8 A;  2BIB A;  2H6A A;  5KIL A;  4RL0 A;  2WHG A;  2Y87 A;  3X30 A;  5LSC A;  4D1U A;  2YNW A;  2DKF A;  3MD7 A;  4TZB A;  2YNU A;  3DHA A;  5EHT A;  3ZQ4 A;  1E5D A;  4NQ6 A;  3SRX A;  4C1D A;  4ZO3 A;  1X8G A;  1BVT A;  4D02 A;  3TP9 A;  2BMI A;  2P1E A;  5A0T A;  2Y8B A;  5IQK A;  3DHB A;  4D1V A;  4EFZ A;  2Q42 A;  5ACU A;  4XWT A;  4AD9 A;  4C1C A;  2XR1 A;  4DIL A;  5LMC A;  4Z5Z A;  3SD9 A;  3RKJ A;  2BG8 B;  4F6H A;  3T9M A;  1A7T A;  4EXS A;  4TZE A;  2BG6 A;  3LVZ A;  4ZO2 A;  3IEM A;  5FQA A;  2QDT A;  2BFZ A;  3IE1 A;  3AF5 A;  3X2X A;  5AXO A;  2XF4 A;  4EYL A;  4AWZ A;  4ZNB A;  2WRS A;  1KO2 A;  2HB9 A;  5AHO A;  4HL2 A;  3BC2 A;  3T3N A;  4C1H A;  2BFK A;  2VW8 A;  1WW1 A;  3ZWF A;  2BFZ B;  5A5Z A;  4LE6 A;  5EVD A;  4U4L A;  3VQZ A;  4JO0 A;  2YZ3 A;  2I7T A;  4ZEJ A;  3BV6 A;  4BP0 A;  1ZTC A;  1K07 A;  3KL7 A;  3KNR A;  5EV6 A;  5ACV A;  4TYT A;  2R2D A;  4FR7 A;  5AXR A;  5FQC A;  5B15 A;  3T3O A;  2P97 A;  3BK1 A;  5HIS A;  4CHL A;  2A7M A;  4GYU A;  1X8I A;  1YCH A;  4TYF A;  3Q6V A;  2CBN A;  4B87 A;  5B1U A;  1MQO A;  4AX1 B;  5ACW A;  5AEB A;  5ACT A;  1YCG A;  1XTO A;  5LM6 A;  2WYM A;  5EW0 A;  2QIN A;  1L9Y A;  5DPX A;  3VPE A;  3AF6 A;  5LCA A;  2QDS A;  4YSL A;  3SBL A;  4UWS B;  4H0D A;  1ZKP A;  2BFL A;  4UWR B;  1WRA A;  2I7X A;  3I11 A;  2AZ4 A;  3IDZ A;  2GCU A;  5KIK A;  4EXY A;  2ZNB A;  2YNT A;  1WUO A;  5AHR A;  2NZE A;  2BR6 A;  2FU7 A;  4Z60 A;  3X2Y A;  4HKY A;  3FAI A;  3I13 A;  1KR3 A;  3DHC A;  2YNT B;  3PY6 A;  1BMC A;  5EH9 A;  4NQ5 A;  2ZZI A;  4UA4 A;  4P62 A;  5A0V A;  5ACS A;  2NXA A;  4YSK A;  4BZ3 A;  4EYB A;  1HLK A;  2GFJ A;  2Q9U A;  4FEK A;  5HH6 A;  2Q0J A;  4Z7R A;  1JJT A;  4J5F A;  5K4K A;  4PVO A;  1Y44 A;  1QH3 A;  4Z5Y A;  3IE2 A;  1KO3 A;  5ACQ A;  5ACP A;  5FQB A;  2AIO A;  2M5D A;  1SML A;  4PVT A;  4Z67 A;  5HIP A;  3DH8 A;  4Z6X A;  4UWO B;  4EY2 A;  3BK2 A;  3AJ3 A;  4TZ9 A;  2WYM C;  3I14 A;  3ADR A;  3PG4 A;  2I7V A;  3SFP A;  3X2Z A;  2E7Y A;  2FHX A;  3IOF A;  4GYQ A;  3F9O A;  3G1P A;  3RPC A;  4XUK A;  4FSB A;  5K0W A;  2FU9 A;  5EVK A;  5EWA A;  3H3E A;  5LE1 A;  2ZO4 A;  2Y8A A;  4NQ4 A;  5AYA A;  5ACR A;  4UAM A;  5LLD A;  5ACX A;  5K4M A;  2FHX B;  4F6Z A;  1JJE A;  2P4Z A;  2FK6 A;  3IEL A;  2Q0I A;  4RAM A;  3WXC A;  3JXP A;  3IEK A;  5K4N A;  2GKL A;  4YSB A;  3KNS A;  2FU6 A;  4RAW A;  4HL1 A;  4C1G A;  4AWY B;  1XM8 A;  3I15 A;  5HIQ A;  1QH5 A;  4XWW A;  1BC2 A;  4KEQ A;  4DIK A;  1WUP A;  2DOO A;  1VME A;  2GFK A;  3QH8 A;  4C1F A;  3S0Z A;  3ESH A;  1M2X A;  2NYP A;  2UYX A;  3L6N A; 
#chains in the Genus database with same CATH topology
 2BC2 A;  2BG8 A;  5HH4 A;  2M5C A;  2BG7 A;  3ZNB A;  3R2U A;  4EYF A;  4UBQ A;  1DDK A;  2BTN A;  3SW3 A;  5HIO A;  4O98 A;  1A8T A;  1YCF A;  4UWP B;  4TZF A;  1JT1 A;  3IOG A;  5EV8 A;  2YCB A;  3SPU A;  2BG2 A;  1VJN A;  4D1W A;  3I0V A;  3RKK A;  2GMN A;  2P18 A;  3PY5 A;  5LCF A;  2YNV A;  1X8H A;  1DXK A;  4D1T A;  2OHJ A;  4NQ2 A;  4RL2 A;  5B3R A;  2OHH A;  3FCZ A;  1DD6 A;  4J5H A;  5HH5 A;  3ZR9 A;  3P2U A;  2WYL A;  2FM6 A;  1VGN A;  2BGA A;  3A4Y A;  2YNV B;  1ZNB A;  4GCW A;  5LCH A;  2ZWR A;  1P9E A;  4AX0 B;  4WD6 A;  4KEP A;  3IE0 A;  2QED A;  4C1E A;  2OHI A;  4V0H A;  4C09 A;  5AJL A;  5A87 A;  4RBS A;  5EVB A;  2NZF A;  4RM5 A;  5AIJ A;  5LS3 A;  2QJS A;  2FU8 A;  2BIB A;  2H6A A;  5KIL A;  4NUR A;  4RL0 A;  2WHG A;  2Y87 A;  3X30 A;  5LSC A;  4D1U A;  2YNW A;  2DKF A;  3MD7 A;  4TZB A;  2YNU A;  3DHA A;  5EHT A;  3ZQ4 A;  1E5D A;  4NQ6 A;  3SRX A;  4C1D A;  4ZO3 A;  1X8G A;  1BVT A;  4D02 A;  3TP9 A;  2BMI A;  2P1E A;  5A0T A;  2Y8B A;  5IQK A;  3DHB A;  4D1V A;  4EFZ A;  2Q42 A;  5ACU A;  4XWT A;  4AD9 A;  4C1C A;  2XR1 A;  4DIL A;  5LMC A;  4Z5Z A;  3SD9 A;  3RKJ A;  2BG8 B;  4F6H A;  3T9M A;  1A7T A;  4EXS A;  4TZE A;  2BG6 A;  3LVZ A;  4ZO2 A;  3IEM A;  5FQA A;  2QDT A;  2BFZ A;  2CG2 A;  3IE1 A;  3AF5 A;  3X2X A;  5AXO A;  2XF4 A;  4EYL A;  4AWZ A;  4ZNB A;  2WRS A;  1KO2 A;  2HB9 A;  5AHO A;  4HL2 A;  3BC2 A;  3T3N A;  4C1H A;  2BFK A;  2VW8 A;  1WW1 A;  3ZWF A;  2BFZ B;  5A5Z A;  4LE6 A;  5EVD A;  4U4L A;  3VQZ A;  4JO0 A;  2YZ3 A;  2I7T A;  4ZEJ A;  2CFU A;  3BV6 A;  4BP0 A;  1ZTC A;  1K07 A;  3KL7 A;  3KNR A;  5EV6 A;  5ACV A;  4TYT A;  2R2D A;  4FR7 A;  5AXR A;  2CG3 A;  5FQC A;  5B15 A;  3T3O A;  2P97 A;  3BK1 A;  5HIS A;  4CHL A;  2A7M A;  4GYU A;  1X8I A;  1YCH A;  4TYF A;  3Q6V A;  2CBN A;  4B87 A;  5B1U A;  1MQO A;  4AX1 B;  5ACW A;  5AEB A;  5ACT A;  1YCG A;  1XTO A;  5LM6 A;  2WYM A;  5EW0 A;  2QIN A;  1L9Y A;  5DPX A;  3VPE A;  4AXH A;  3AF6 A;  5LCA A;  2QDS A;  4YSL A;  3SBL A;  4UWS B;  4H0D A;  1ZKP A;  2BFL A;  4UWR B;  1WRA A;  2I7X A;  3I11 A;  2AZ4 A;  3IDZ A;  2GCU A;  5KIK A;  4EXY A;  2ZNB A;  2YNT A;  1WUO A;  5AHR A;  2NZE A;  2BR6 A;  2FU7 A;  4Z60 A;  3X2Y A;  4HKY A;  3FAI A;  3I13 A;  1KR3 A;  3DHC A;  2YNT B;  3PY6 A;  1BMC A;  5EH9 A;  4NQ5 A;  2ZZI A;  4UA4 A;  4P62 A;  5A0V A;  5ACS A;  2NXA A;  4YSK A;  4BZ3 A;  4EYB A;  1HLK A;  2GFJ A;  2Q9U A;  4FEK A;  5HH6 A;  2Q0J A;  4Z7R A;  1JJT A;  4J5F A;  5K4K A;  4PVO A;  1Y44 A;  2YHE A;  1QH3 A;  4Z5Y A;  3IE2 A;  1KO3 A;  5ACQ A;  5ACP A;  5FQB A;  2AIO A;  2M5D A;  1SML A;  4PVT A;  4Z67 A;  5HIP A;  3DH8 A;  4Z6X A;  4UWO B;  4EY2 A;  3BK2 A;  3AJ3 A;  4TZ9 A;  2WYM C;  3I14 A;  3ADR A;  3PG4 A;  2I7V A;  3SFP A;  3X2Z A;  2E7Y A;  2FHX A;  3IOF A;  4GYQ A;  3F9O A;  2CFZ A;  3G1P A;  3RPC A;  4XUK A;  4FSB A;  5A23 A;  5K0W A;  2FU9 A;  5EVK A;  5EWA A;  3H3E A;  5LE1 A;  2ZO4 A;  2Y8A A;  4NQ4 A;  5AYA A;  5ACR A;  4UAM A;  5LLD A;  5ACX A;  5K4M A;  2FHX B;  4F6Z A;  1JJE A;  2P4Z A;  2FK6 A;  3IEL A;  2Q0I A;  4RAM A;  3WXC A;  3JXP A;  3IEK A;  5K4N A;  2GKL A;  4YSB A;  3KNS A;  2FU6 A;  4RAW A;  4HL1 A;  4C1G A;  4AWY B;  1XM8 A;  3I15 A;  5HIQ A;  1QH5 A;  4XWW A;  1BC2 A;  4KEQ A;  4AV7 A;  4DIK A;  1WUP A;  2DOO A;  1VME A;  4PDX A;  2GFK A;  3QH8 A;  4C1F A;  3S0Z A;  3ESH A;  1M2X A;  2NYP A;  2UYX A;  3L6N A; 
#chains in the Genus database with same CATH homology
 2BC2 A;  2BG8 A;  5HH4 A;  2M5C A;  2BG7 A;  3ZNB A;  3R2U A;  4EYF A;  4UBQ A;  1DDK A;  2BTN A;  3SW3 A;  5HIO A;  4O98 A;  1A8T A;  1YCF A;  4UWP B;  4TZF A;  1JT1 A;  3IOG A;  5EV8 A;  2YCB A;  3SPU A;  2BG2 A;  1VJN A;  4D1W A;  3I0V A;  3RKK A;  2GMN A;  2P18 A;  3PY5 A;  5LCF A;  2YNV A;  1X8H A;  1DXK A;  4D1T A;  2OHJ A;  4NQ2 A;  4RL2 A;  5B3R A;  2OHH A;  3FCZ A;  1DD6 A;  4J5H A;  5HH5 A;  3ZR9 A;  3P2U A;  2WYL A;  2FM6 A;  1VGN A;  2BGA A;  3A4Y A;  2YNV B;  1ZNB A;  4GCW A;  5LCH A;  2ZWR A;  1P9E A;  4AX0 B;  4WD6 A;  4KEP A;  3IE0 A;  2QED A;  4C1E A;  2OHI A;  4V0H A;  4C09 A;  5A87 A;  4RBS A;  5EVB A;  2NZF A;  4RM5 A;  5LS3 A;  2QJS A;  2FU8 A;  2BIB A;  2H6A A;  5KIL A;  4RL0 A;  2WHG A;  2Y87 A;  3X30 A;  5LSC A;  4D1U A;  2YNW A;  2DKF A;  3MD7 A;  4TZB A;  2YNU A;  3DHA A;  5EHT A;  3ZQ4 A;  1E5D A;  4NQ6 A;  3SRX A;  4C1D A;  4ZO3 A;  1X8G A;  1BVT A;  4D02 A;  3TP9 A;  2BMI A;  2P1E A;  5A0T A;  2Y8B A;  5IQK A;  3DHB A;  4D1V A;  4EFZ A;  2Q42 A;  5ACU A;  4XWT A;  4AD9 A;  4C1C A;  2XR1 A;  4DIL A;  5LMC A;  4Z5Z A;  3SD9 A;  3RKJ A;  2BG8 B;  4F6H A;  3T9M A;  1A7T A;  4EXS A;  4TZE A;  2BG6 A;  3LVZ A;  4ZO2 A;  3IEM A;  5FQA A;  2QDT A;  2BFZ A;  3IE1 A;  3AF5 A;  3X2X A;  5AXO A;  2XF4 A;  4EYL A;  4AWZ A;  4ZNB A;  2WRS A;  1KO2 A;  2HB9 A;  5AHO A;  4HL2 A;  3BC2 A;  3T3N A;  4C1H A;  2BFK A;  2VW8 A;  1WW1 A;  3ZWF A;  2BFZ B;  5A5Z A;  4LE6 A;  5EVD A;  4U4L A;  3VQZ A;  4JO0 A;  2YZ3 A;  2I7T A;  4ZEJ A;  3BV6 A;  4BP0 A;  1ZTC A;  1K07 A;  3KL7 A;  3KNR A;  5EV6 A;  5ACV A;  4TYT A;  2R2D A;  4FR7 A;  5AXR A;  5FQC A;  5B15 A;  3T3O A;  2P97 A;  3BK1 A;  5HIS A;  4CHL A;  2A7M A;  4GYU A;  1X8I A;  1YCH A;  4TYF A;  3Q6V A;  2CBN A;  4B87 A;  5B1U A;  1MQO A;  4AX1 B;  5ACW A;  5AEB A;  5ACT A;  1YCG A;  1XTO A;  5LM6 A;  2WYM A;  5EW0 A;  2QIN A;  1L9Y A;  5DPX A;  3VPE A;  3AF6 A;  5LCA A;  2QDS A;  4YSL A;  3SBL A;  4UWS B;  4H0D A;  1ZKP A;  2BFL A;  4UWR B;  1WRA A;  2I7X A;  3I11 A;  2AZ4 A;  3IDZ A;  2GCU A;  5KIK A;  4EXY A;  2ZNB A;  2YNT A;  1WUO A;  5AHR A;  2NZE A;  2BR6 A;  2FU7 A;  4Z60 A;  3X2Y A;  4HKY A;  3FAI A;  3I13 A;  1KR3 A;  3DHC A;  2YNT B;  3PY6 A;  1BMC A;  5EH9 A;  4NQ5 A;  2ZZI A;  4UA4 A;  4P62 A;  5A0V A;  5ACS A;  2NXA A;  4YSK A;  4BZ3 A;  4EYB A;  1HLK A;  2GFJ A;  2Q9U A;  4FEK A;  5HH6 A;  2Q0J A;  4Z7R A;  1JJT A;  4J5F A;  5K4K A;  4PVO A;  1Y44 A;  1QH3 A;  4Z5Y A;  3IE2 A;  1KO3 A;  5ACQ A;  5ACP A;  5FQB A;  2AIO A;  2M5D A;  1SML A;  4PVT A;  4Z67 A;  5HIP A;  3DH8 A;  4Z6X A;  4UWO B;  4EY2 A;  3BK2 A;  3AJ3 A;  4TZ9 A;  2WYM C;  3I14 A;  3ADR A;  3PG4 A;  2I7V A;  3SFP A;  3X2Z A;  2E7Y A;  2FHX A;  3IOF A;  4GYQ A;  3F9O A;  3G1P A;  3RPC A;  4XUK A;  4FSB A;  5K0W A;  2FU9 A;  5EVK A;  5EWA A;  3H3E A;  5LE1 A;  2ZO4 A;  2Y8A A;  4NQ4 A;  5AYA A;  5ACR A;  4UAM A;  5LLD A;  5ACX A;  5K4M A;  2FHX B;  4F6Z A;  1JJE A;  2P4Z A;  2FK6 A;  3IEL A;  2Q0I A;  4RAM A;  3WXC A;  3JXP A;  3IEK A;  5K4N A;  2GKL A;  4YSB A;  3KNS A;  2FU6 A;  4RAW A;  4HL1 A;  4C1G A;  4AWY B;  1XM8 A;  3I15 A;  5HIQ A;  1QH5 A;  4XWW A;  1BC2 A;  4KEQ A;  4DIK A;  1WUP A;  2DOO A;  1VME A;  2GFK A;  3QH8 A;  4C1F A;  3S0Z A;  3ESH A;  1M2X A;  2NYP A;  2UYX A;  3L6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...