3PY5A

Crystal structure of a beta-lactamase-like protein from brucella melitensis bound to amp
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
270
structure length
270
Chain Sequence
SPRNCLRFTLLGCGSSPGVPRINGDWGKCDPKNPKNRRRRASLLVERYDAEGNNTVVVIDTGPDFRMQMIDSGVHMLDAAVYTHPHADHIHGIDDLRTYVVDNGRLMDVYANRLTRNRLYDTFGYCFETPVGSSYPPILSMHDIAPETPFSIEGAGGAIRFEPFSQVHGDIESLGFRIGSVVYCTDVSAFPEQSLQYIKDADVLIIGALQYRPHPSHFSLGEALEWIEKLSPKRAILTHMHVPLDYETVMRETPHHVEPGYDGLRFEVAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase-like
publication title BrabA.11339.a: anomalous diffraction and ligand binding guide towards the elucidation of the function of a `putative beta-lactamase-like protein from Brucella melitensis.
pubmed doi rcsb
source organism Brucella melitensis biovar abortus
total genus 81
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2010-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3py5A00
4C1GA 4ZNBA 1QH3A 3BC2A 2DKFA 5ACRA 4H0DA 4J5HA 3AJ3A 3I13A 2WYMA 2GCUA 4AX0B 3T3NA 4B87A 1ZKPA 4NQ6A 2NXAA 4C1HA 2BFZA 1M2XA 2P97A 5HH4A 4PVTA 2CBNA 3DHAA 2YNVA 3RKJA 4XWWA 1KR3A 4FR7A 4RL0A 1X8IA 4RAWA 2FM6A 2GMNA 2BG6A 3AF5A 1K07A 4AX1B 5HIQA 1DDKA 2VW8A 2FU7A 4TYFA 1QH5A 2AZ4A 3ADRA 3FAIA 4YSBA 5EV8A 3T9MA 3IOFA 2BG8A 5IQKA 1JJEA 4ZEJA 2WHGA 5EHTA 2QJSA 2R2DA 2M5DA 4TZEA 4D1VA 4EY2A 5LMCA 4UBQA 3A4YA 3L6NA 3KNRA 4V0HA 4AWYB 3H3EA 4EYLA 2QINA 2OHIA 1SMLA 2Q0IA 4U4LA 2E7YA 2FHXB 2XF4A 4F6ZA 3PY5A 3Q6VA 4XUKA 4NQ5A 5B1UA 5EVKA 2NZEA 2QDSA 2WYMC 2WYLA 2FK6A 5AHOA 2I7XA 4DIKA 3I15A 5EH9A 4YSLA 4BZ3A 2BGAA 4UWOB 4PVOA 4HL1A 5AYAA 3R2UA 2UYXA 3KL7A 1KO3A 3SD9A 2I7VA 3X2ZA 4EXYA 4NQ4A 5B3RA 4TZ9A 3SRXA 2AIOA 2FU9A 1VJNA 4ZO2A 3AF6A 5K0WA 3ZQ4A 3S0ZA 2OHJA 2YNWA 4C1CA 4RAMA 4HKYA 4D1WA 4AWZA 1HLKA 4UA4A 2OHHA 3DHBA 1YCHA 2BC2A 5K4NA 1MQOA 2BFLA 3DH8A 5KILA 4FEKA 4EFZA 2FU8A 4D1TA 3DHCA 3BV6A 2Q0JA 1BMCA 4UWRB 3X30A 3X2YA 3F9OA 1DD6A 5FQBA 4EYFA 5LCHA 5LCFA 3ZWFA 4Z60A 4DILA 1WUPA 2P18A 1DXKA 2DOOA 4RM5A 3SW3A 2XR1A 4TYTA 2Q9UA 2A7MA 4TZFA 5EV6A 5HH5A 1JT1A 1XTOA 1KO2A 4EXSA 3IDZA 2ZNBA 4UWSB 4Z67A 3WXCA 1XM8A 5AHRA 5KIKA 2YCBA 5LE1A 4O98A 3RPCA 2FHXA 3VPEA 3T3OA 2NZFA 2YNUA 2FU6A 4TZBA 3IOGA 5HH6A 5AXOA 3IE1A 5AXRA 4GYUA 2P4ZA 1A8TA 2WRSA 3SBLA 1ZTCA 2Y87A 4C1FA 3G1PA 3I11A 3TP9A 2I7TA 3PY6A 4Z5ZA 2ZO4A 2BTNA 4CHLA 5LCAA 4Z7RA 1Y44A 1X8HA 5EW0A 4Z5YA 1WW1A 2BG7A 3I14A 2BR6A 4LE6A 5LS3A 4KEQA 5ACWA 3X2XA 4NQ2A 2Y8AA 3FCZA 4D1UA 3P2UA 5A5ZA 5HIPA 4F6HA 4WD6A 3ZR9A 5ACPA 2Q42A 2ZZIA 1JJTA 4XWTA 3ESHA 5EVBA 5ACVA 2NYPA 5FQCA 5EWAA 5ACSA 1YCGA 4RL2A 4ZO3A 4JO0A 3ZNBA 4C1EA 2QEDA 3I0VA 5K4KA 1P9EA 2BG2A 4HL2A 3IEKA 5ACXA 4AD9A 1X8GA 2YZ3A 4YSKA 2GFJA 2BMIA 4GCWA 3BK2A 1L9YA 3PG4A 2P1EA 1VMEA 5AEBA 2BFZB 3SPUA 3RKKA 3IE0A 3MD7A 2HB9A 4EYBA 2GKLA 4FSBA 2YNVB 5B15A 4GYQA 1BC2A 3JXPA 1ZNBA 5HISA 4BP0A 4J5FA 1WUOA 5A0TA 3LVZA 5ACQA 1VGNA 5A87A 3IEMA 5EVDA 2QDTA 4UAMA 5DPXA 5ACUA 3VQZA 5LLDA 4D02A 5HIOA 2BG8B 3QH8A 1A7TA 4RBSA 1E5DA 4C1DA 5LM6A 2GFKA 3IE2A 4KEPA 5FQAA 5ACTA 4UWPB 5K4MA 1WRAA 1YCFA 2BIBA 5LSCA 3KNSA 3BK1A 2YNTA 2BFKA 2M5CA 2H6AA 2Y8BA 5A0VA 2YNTB 4C09A 4Z6XA 4P62A 3IELA 1BVTA 2ZWRA 3SFPA
chains in the Genus database with same CATH superfamily
4C1GA 4ZNBA 1QH3A 3BC2A 2DKFA 5ACRA 4H0DA 4J5HA 3AJ3A 3I13A 2WYMA 2GCUA 4AX0B 3T3NA 4B87A 1ZKPA 4NQ6A 2NXAA 4C1HA 2BFZA 1M2XA 2P97A 4AXHA 5HH4A 4PVTA 2CBNA 3DHAA 2YNVA 3RKJA 4XWWA 1KR3A 4FR7A 4RL0A 1X8IA 4RAWA 2FM6A 2GMNA 2BG6A 3AF5A 1K07A 4AX1B 2CG2A 5HIQA 1DDKA 2VW8A 2FU7A 4TYFA 5AJLA 1QH5A 2AZ4A 3ADRA 3FAIA 4YSBA 5EV8A 3T9MA 3IOFA 2BG8A 5IQKA 1JJEA 4ZEJA 2WHGA 5EHTA 2QJSA 2R2DA 2M5DA 4TZEA 4D1VA 4EY2A 5LMCA 4UBQA 3A4YA 4AV7A 3L6NA 4V0HA 3KNRA 4AWYB 3H3EA 4EYLA 2QINA 2OHIA 1SMLA 2Q0IA 2YHEA 4U4LA 2E7YA 2FHXB 2XF4A 4F6ZA 3PY5A 3Q6VA 4XUKA 4NQ5A 5B1UA 5EVKA 2NZEA 2QDSA 2WYMC 2WYLA 2FK6A 5AHOA 2I7XA 4DIKA 3I15A 5EH9A 4YSLA 4BZ3A 2BGAA 4UWOB 4PVOA 4HL1A 5AYAA 3R2UA 2UYXA 3KL7A 1KO3A 4NURA 3SD9A 2I7VA 3X2ZA 4EXYA 4NQ4A 5B3RA 4TZ9A 3SRXA 2AIOA 2FU9A 1VJNA 4ZO2A 3AF6A 5K0WA 3ZQ4A 3S0ZA 2OHJA 2YNWA 4C1CA 4RAMA 4HKYA 4D1WA 4AWZA 1HLKA 4UA4A 2OHHA 3DHBA 1YCHA 2BC2A 5K4NA 1MQOA 2BFLA 3DH8A 5KILA 4FEKA 4EFZA 2FU8A 4D1TA 3DHCA 3BV6A 2Q0JA 1BMCA 4UWRB 3X30A 3X2YA 3F9OA 1DD6A 5FQBA 4EYFA 5LCHA 5LCFA 3ZWFA 4Z60A 4DILA 1WUPA 2P18A 1DXKA 2DOOA 4RM5A 3SW3A 2XR1A 4TYTA 2Q9UA 2A7MA 4TZFA 5EV6A 5HH5A 1JT1A 1XTOA 1KO2A 4EXSA 3IDZA 2ZNBA 4UWSB 4Z67A 3WXCA 1XM8A 5AHRA 5KIKA 2YCBA 5LE1A 4O98A 3RPCA 2FHXA 3VPEA 3T3OA 2NZFA 2YNUA 2FU6A 4TZBA 3IOGA 5HH6A 5AXOA 3IE1A 5AXRA 4GYUA 2P4ZA 1A8TA 2WRSA 3SBLA 1ZTCA 2Y87A 4C1FA 3G1PA 3I11A 3TP9A 2I7TA 3PY6A 4Z5ZA 2ZO4A 2BTNA 4CHLA 5LCAA 4Z7RA 1Y44A 1X8HA 5EW0A 4Z5YA 1WW1A 2BG7A 5A23A 3I14A 2BR6A 4LE6A 5LS3A 4KEQA 5ACWA 3X2XA 4NQ2A 2Y8AA 3FCZA 4D1UA 3P2UA 5A5ZA 5HIPA 4F6HA 4WD6A 3ZR9A 5ACPA 2Q42A 2ZZIA 1JJTA 4XWTA 3ESHA 5EVBA 5ACVA 4PDXA 2NYPA 5FQCA 5EWAA 5ACSA 1YCGA 4RL2A 4ZO3A 4JO0A 3ZNBA 4C1EA 2QEDA 3I0VA 5K4KA 1P9EA 2CFZA 2BG2A 4HL2A 3IEKA 5ACXA 4AD9A 1X8GA 2YZ3A 4YSKA 2GFJA 2BMIA 4GCWA 3BK2A 1L9YA 2CFUA 3PG4A 2P1EA 1VMEA 5AEBA 2BFZB 3SPUA 3RKKA 3IE0A 3MD7A 2HB9A 4EYBA 2GKLA 4FSBA 2YNVB 5B15A 4GYQA 1BC2A 3JXPA 1ZNBA 5HISA 4BP0A 4J5FA 1WUOA 5A0TA 3LVZA 5ACQA 1VGNA 5A87A 3IEMA 5EVDA 2QDTA 4UAMA 5DPXA 5ACUA 3VQZA 5LLDA 4D02A 5HIOA 2BG8B 3QH8A 1A7TA 4RBSA 5AIJA 1E5DA 4C1DA 5LM6A 2GFKA 3IE2A 4KEPA 5FQAA 5ACTA 4UWPB 5K4MA 1WRAA 1YCFA 2BIBA 5LSCA 3KNSA 3BK1A 2YNTA 2BFKA 2M5CA 2H6AA 2Y8BA 2CG3A 5A0VA 2YNTB 4C09A 4Z6XA 4P62A 3IELA 1BVTA 2ZWRA 3SFPA
chains in the Genus database with same CATH topology
4C1GA 4ZNBA 1QH3A 3BC2A 2DKFA 5ACRA 4H0DA 4J5HA 3AJ3A 3I13A 2WYMA 2GCUA 4AX0B 3T3NA 4B87A 1ZKPA 4NQ6A 2NXAA 4C1HA 2BFZA 1M2XA 2P97A 5HH4A 4PVTA 2CBNA 3DHAA 2YNVA 3RKJA 4XWWA 1KR3A 4FR7A 4RL0A 1X8IA 4RAWA 2FM6A 2GMNA 2BG6A 3AF5A 1K07A 4AX1B 5HIQA 1DDKA 2VW8A 2FU7A 4TYFA 1QH5A 2AZ4A 3ADRA 3FAIA 4YSBA 5EV8A 3T9MA 3IOFA 2BG8A 5IQKA 1JJEA 4ZEJA 2WHGA 5EHTA 2QJSA 2R2DA 2M5DA 4TZEA 4D1VA 4EY2A 5LMCA 4UBQA 3A4YA 3L6NA 3KNRA 4V0HA 4AWYB 3H3EA 4EYLA 2QINA 2OHIA 1SMLA 2Q0IA 4U4LA 2E7YA 2FHXB 2XF4A 4F6ZA 3PY5A 3Q6VA 4XUKA 4NQ5A 5B1UA 5EVKA 2NZEA 2QDSA 2WYMC 2WYLA 2FK6A 5AHOA 2I7XA 4DIKA 3I15A 5EH9A 4YSLA 4BZ3A 2BGAA 4UWOB 4PVOA 4HL1A 5AYAA 3R2UA 2UYXA 3KL7A 1KO3A 3SD9A 2I7VA 3X2ZA 4EXYA 4NQ4A 5B3RA 4TZ9A 3SRXA 2AIOA 2FU9A 1VJNA 4ZO2A 3AF6A 5K0WA 3ZQ4A 3S0ZA 2OHJA 2YNWA 4C1CA 4RAMA 4HKYA 4D1WA 4AWZA 1HLKA 4UA4A 2OHHA 3DHBA 1YCHA 2BC2A 5K4NA 1MQOA 2BFLA 3DH8A 5KILA 4FEKA 4EFZA 2FU8A 4D1TA 3DHCA 3BV6A 2Q0JA 1BMCA 4UWRB 3X30A 3X2YA 3F9OA 1DD6A 5FQBA 4EYFA 5LCHA 5LCFA 3ZWFA 4Z60A 4DILA 1WUPA 2P18A 1DXKA 2DOOA 4RM5A 3SW3A 2XR1A 4TYTA 2Q9UA 2A7MA 4TZFA 5EV6A 5HH5A 1JT1A 1XTOA 1KO2A 4EXSA 3IDZA 2ZNBA 4UWSB 4Z67A 3WXCA 1XM8A 5AHRA 5KIKA 2YCBA 5LE1A 4O98A 3RPCA 2FHXA 3VPEA 3T3OA 2NZFA 2YNUA 2FU6A 4TZBA 3IOGA 5HH6A 5AXOA 3IE1A 5AXRA 4GYUA 2P4ZA 1A8TA 2WRSA 3SBLA 1ZTCA 2Y87A 4C1FA 3G1PA 3I11A 3TP9A 2I7TA 3PY6A 4Z5ZA 2ZO4A 2BTNA 4CHLA 5LCAA 4Z7RA 1Y44A 1X8HA 5EW0A 4Z5YA 1WW1A 2BG7A 3I14A 2BR6A 4LE6A 5LS3A 4KEQA 5ACWA 3X2XA 4NQ2A 2Y8AA 3FCZA 4D1UA 3P2UA 5A5ZA 5HIPA 4F6HA 4WD6A 3ZR9A 5ACPA 2Q42A 2ZZIA 1JJTA 4XWTA 3ESHA 5EVBA 5ACVA 2NYPA 5FQCA 5EWAA 5ACSA 1YCGA 4RL2A 4ZO3A 4JO0A 3ZNBA 4C1EA 2QEDA 3I0VA 5K4KA 1P9EA 2BG2A 4HL2A 3IEKA 5ACXA 4AD9A 1X8GA 2YZ3A 4YSKA 2GFJA 2BMIA 4GCWA 3BK2A 1L9YA 3PG4A 2P1EA 1VMEA 5AEBA 2BFZB 3SPUA 3RKKA 3IE0A 3MD7A 2HB9A 4EYBA 2GKLA 4FSBA 2YNVB 5B15A 4GYQA 1BC2A 3JXPA 1ZNBA 5HISA 4BP0A 4J5FA 1WUOA 5A0TA 3LVZA 5ACQA 1VGNA 5A87A 3IEMA 5EVDA 2QDTA 4UAMA 5DPXA 5ACUA 3VQZA 5LLDA 4D02A 5HIOA 2BG8B 3QH8A 1A7TA 4RBSA 1E5DA 4C1DA 5LM6A 2GFKA 3IE2A 4KEPA 5FQAA 5ACTA 4UWPB 5K4MA 1WRAA 1YCFA 2BIBA 5LSCA 3KNSA 3BK1A 2YNTA 2BFKA 2M5CA 2H6AA 2Y8BA 5A0VA 2YNTB 4C09A 4Z6XA 4P62A 3IELA 1BVTA 2ZWRA 3SFPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C1G A;  4ZNB A;  1QH3 A;  3BC2 A;  2DKF A;  5ACR A;  4H0D A;  4J5H A;  3AJ3 A;  3I13 A;  2WYM A;  2GCU A;  4AX0 B;  3T3N A;  4B87 A;  1ZKP A;  4NQ6 A;  2NXA A;  4C1H A;  2BFZ A;  1M2X A;  2P97 A;  5HH4 A;  4PVT A;  2CBN A;  3DHA A;  2YNV A;  3RKJ A;  4XWW A;  1KR3 A;  4FR7 A;  4RL0 A;  1X8I A;  4RAW A;  2FM6 A;  2GMN A;  2BG6 A;  3AF5 A;  1K07 A;  4AX1 B;  5HIQ A;  1DDK A;  2VW8 A;  2FU7 A;  4TYF A;  1QH5 A;  2AZ4 A;  3ADR A;  3FAI A;  4YSB A;  5EV8 A;  3T9M A;  3IOF A;  2BG8 A;  5IQK A;  1JJE A;  4ZEJ A;  2WHG A;  5EHT A;  2QJS A;  2R2D A;  2M5D A;  4TZE A;  4D1V A;  4EY2 A;  5LMC A;  4UBQ A;  3A4Y A;  3L6N A;  3KNR A;  4V0H A;  4AWY B;  3H3E A;  4EYL A;  2QIN A;  2OHI A;  1SML A;  2Q0I A;  4U4L A;  2E7Y A;  2FHX B;  2XF4 A;  4F6Z A;  3PY5 A;  3Q6V A;  4XUK A;  4NQ5 A;  5B1U A;  5EVK A;  2NZE A;  2QDS A;  2WYM C;  2WYL A;  2FK6 A;  5AHO A;  2I7X A;  4DIK A;  3I15 A;  5EH9 A;  4YSL A;  4BZ3 A;  2BGA A;  4UWO B;  4PVO A;  4HL1 A;  5AYA A;  3R2U A;  2UYX A;  3KL7 A;  1KO3 A;  3SD9 A;  2I7V A;  3X2Z A;  4EXY A;  4NQ4 A;  5B3R A;  4TZ9 A;  3SRX A;  2AIO A;  2FU9 A;  1VJN A;  4ZO2 A;  3AF6 A;  5K0W A;  3ZQ4 A;  3S0Z A;  2OHJ A;  2YNW A;  4C1C A;  4RAM A;  4HKY A;  4D1W A;  4AWZ A;  1HLK A;  4UA4 A;  2OHH A;  3DHB A;  1YCH A;  2BC2 A;  5K4N A;  1MQO A;  2BFL A;  3DH8 A;  5KIL A;  4FEK A;  4EFZ A;  2FU8 A;  4D1T A;  3DHC A;  3BV6 A;  2Q0J A;  1BMC A;  4UWR B;  3X30 A;  3X2Y A;  3F9O A;  1DD6 A;  5FQB A;  4EYF A;  5LCH A;  5LCF A;  3ZWF A;  4Z60 A;  4DIL A;  1WUP A;  2P18 A;  1DXK A;  2DOO A;  4RM5 A;  3SW3 A;  2XR1 A;  4TYT A;  2Q9U A;  2A7M A;  4TZF A;  5EV6 A;  5HH5 A;  1JT1 A;  1XTO A;  1KO2 A;  4EXS A;  3IDZ A;  2ZNB A;  4UWS B;  4Z67 A;  3WXC A;  1XM8 A;  5AHR A;  5KIK A;  2YCB A;  5LE1 A;  4O98 A;  3RPC A;  2FHX A;  3VPE A;  3T3O A;  2NZF A;  2YNU A;  2FU6 A;  4TZB A;  3IOG A;  5HH6 A;  5AXO A;  3IE1 A;  5AXR A;  4GYU A;  2P4Z A;  1A8T A;  2WRS A;  3SBL A;  1ZTC A;  2Y87 A;  4C1F A;  3G1P A;  3I11 A;  3TP9 A;  2I7T A;  3PY6 A;  4Z5Z A;  2ZO4 A;  2BTN A;  4CHL A;  5LCA A;  4Z7R A;  1Y44 A;  1X8H A;  5EW0 A;  4Z5Y A;  1WW1 A;  2BG7 A;  3I14 A;  2BR6 A;  4LE6 A;  5LS3 A;  4KEQ A;  5ACW A;  3X2X A;  4NQ2 A;  2Y8A A;  3FCZ A;  4D1U A;  3P2U A;  5A5Z A;  5HIP A;  4F6H A;  4WD6 A;  3ZR9 A;  5ACP A;  2Q42 A;  2ZZI A;  1JJT A;  4XWT A;  3ESH A;  5EVB A;  5ACV A;  2NYP A;  5FQC A;  5EWA A;  5ACS A;  1YCG A;  4RL2 A;  4ZO3 A;  4JO0 A;  3ZNB A;  4C1E A;  2QED A;  3I0V A;  5K4K A;  1P9E A;  2BG2 A;  4HL2 A;  3IEK A;  5ACX A;  4AD9 A;  1X8G A;  2YZ3 A;  4YSK A;  2GFJ A;  2BMI A;  4GCW A;  3BK2 A;  1L9Y A;  3PG4 A;  2P1E A;  1VME A;  5AEB A;  2BFZ B;  3SPU A;  3RKK A;  3IE0 A;  3MD7 A;  2HB9 A;  4EYB A;  2GKL A;  4FSB A;  2YNV B;  5B15 A;  4GYQ A;  1BC2 A;  3JXP A;  1ZNB A;  5HIS A;  4BP0 A;  4J5F A;  1WUO A;  5A0T A;  3LVZ A;  5ACQ A;  1VGN A;  5A87 A;  3IEM A;  5EVD A;  2QDT A;  4UAM A;  5DPX A;  5ACU A;  3VQZ A;  5LLD A;  4D02 A;  5HIO A;  2BG8 B;  3QH8 A;  1A7T A;  4RBS A;  1E5D A;  4C1D A;  5LM6 A;  2GFK A;  3IE2 A;  4KEP A;  5FQA A;  5ACT A;  4UWP B;  5K4M A;  1WRA A;  1YCF A;  2BIB A;  5LSC A;  3KNS A;  3BK1 A;  2YNT A;  2BFK A;  2M5C A;  2H6A A;  2Y8B A;  5A0V A;  2YNT B;  4C09 A;  4Z6X A;  4P62 A;  3IEL A;  1BVT A;  2ZWR A;  3SFP A; 
#chains in the Genus database with same CATH topology
 4C1G A;  4ZNB A;  1QH3 A;  3BC2 A;  2DKF A;  5ACR A;  4H0D A;  4J5H A;  3AJ3 A;  3I13 A;  2WYM A;  2GCU A;  4AX0 B;  3T3N A;  4B87 A;  1ZKP A;  4NQ6 A;  2NXA A;  4C1H A;  2BFZ A;  1M2X A;  2P97 A;  4AXH A;  5HH4 A;  4PVT A;  2CBN A;  3DHA A;  2YNV A;  3RKJ A;  4XWW A;  1KR3 A;  4FR7 A;  4RL0 A;  1X8I A;  4RAW A;  2FM6 A;  2GMN A;  2BG6 A;  3AF5 A;  1K07 A;  4AX1 B;  2CG2 A;  5HIQ A;  1DDK A;  2VW8 A;  2FU7 A;  4TYF A;  5AJL A;  1QH5 A;  2AZ4 A;  3ADR A;  3FAI A;  4YSB A;  5EV8 A;  3T9M A;  3IOF A;  2BG8 A;  5IQK A;  1JJE A;  4ZEJ A;  2WHG A;  5EHT A;  2QJS A;  2R2D A;  2M5D A;  4TZE A;  4D1V A;  4EY2 A;  5LMC A;  4UBQ A;  3A4Y A;  4AV7 A;  3L6N A;  4V0H A;  3KNR A;  4AWY B;  3H3E A;  4EYL A;  2QIN A;  2OHI A;  1SML A;  2Q0I A;  2YHE A;  4U4L A;  2E7Y A;  2FHX B;  2XF4 A;  4F6Z A;  3PY5 A;  3Q6V A;  4XUK A;  4NQ5 A;  5B1U A;  5EVK A;  2NZE A;  2QDS A;  2WYM C;  2WYL A;  2FK6 A;  5AHO A;  2I7X A;  4DIK A;  3I15 A;  5EH9 A;  4YSL A;  4BZ3 A;  2BGA A;  4UWO B;  4PVO A;  4HL1 A;  5AYA A;  3R2U A;  2UYX A;  3KL7 A;  1KO3 A;  4NUR A;  3SD9 A;  2I7V A;  3X2Z A;  4EXY A;  4NQ4 A;  5B3R A;  4TZ9 A;  3SRX A;  2AIO A;  2FU9 A;  1VJN A;  4ZO2 A;  3AF6 A;  5K0W A;  3ZQ4 A;  3S0Z A;  2OHJ A;  2YNW A;  4C1C A;  4RAM A;  4HKY A;  4D1W A;  4AWZ A;  1HLK A;  4UA4 A;  2OHH A;  3DHB A;  1YCH A;  2BC2 A;  5K4N A;  1MQO A;  2BFL A;  3DH8 A;  5KIL A;  4FEK A;  4EFZ A;  2FU8 A;  4D1T A;  3DHC A;  3BV6 A;  2Q0J A;  1BMC A;  4UWR B;  3X30 A;  3X2Y A;  3F9O A;  1DD6 A;  5FQB A;  4EYF A;  5LCH A;  5LCF A;  3ZWF A;  4Z60 A;  4DIL A;  1WUP A;  2P18 A;  1DXK A;  2DOO A;  4RM5 A;  3SW3 A;  2XR1 A;  4TYT A;  2Q9U A;  2A7M A;  4TZF A;  5EV6 A;  5HH5 A;  1JT1 A;  1XTO A;  1KO2 A;  4EXS A;  3IDZ A;  2ZNB A;  4UWS B;  4Z67 A;  3WXC A;  1XM8 A;  5AHR A;  5KIK A;  2YCB A;  5LE1 A;  4O98 A;  3RPC A;  2FHX A;  3VPE A;  3T3O A;  2NZF A;  2YNU A;  2FU6 A;  4TZB A;  3IOG A;  5HH6 A;  5AXO A;  3IE1 A;  5AXR A;  4GYU A;  2P4Z A;  1A8T A;  2WRS A;  3SBL A;  1ZTC A;  2Y87 A;  4C1F A;  3G1P A;  3I11 A;  3TP9 A;  2I7T A;  3PY6 A;  4Z5Z A;  2ZO4 A;  2BTN A;  4CHL A;  5LCA A;  4Z7R A;  1Y44 A;  1X8H A;  5EW0 A;  4Z5Y A;  1WW1 A;  2BG7 A;  5A23 A;  3I14 A;  2BR6 A;  4LE6 A;  5LS3 A;  4KEQ A;  5ACW A;  3X2X A;  4NQ2 A;  2Y8A A;  3FCZ A;  4D1U A;  3P2U A;  5A5Z A;  5HIP A;  4F6H A;  4WD6 A;  3ZR9 A;  5ACP A;  2Q42 A;  2ZZI A;  1JJT A;  4XWT A;  3ESH A;  5EVB A;  5ACV A;  4PDX A;  2NYP A;  5FQC A;  5EWA A;  5ACS A;  1YCG A;  4RL2 A;  4ZO3 A;  4JO0 A;  3ZNB A;  4C1E A;  2QED A;  3I0V A;  5K4K A;  1P9E A;  2CFZ A;  2BG2 A;  4HL2 A;  3IEK A;  5ACX A;  4AD9 A;  1X8G A;  2YZ3 A;  4YSK A;  2GFJ A;  2BMI A;  4GCW A;  3BK2 A;  1L9Y A;  2CFU A;  3PG4 A;  2P1E A;  1VME A;  5AEB A;  2BFZ B;  3SPU A;  3RKK A;  3IE0 A;  3MD7 A;  2HB9 A;  4EYB A;  2GKL A;  4FSB A;  2YNV B;  5B15 A;  4GYQ A;  1BC2 A;  3JXP A;  1ZNB A;  5HIS A;  4BP0 A;  4J5F A;  1WUO A;  5A0T A;  3LVZ A;  5ACQ A;  1VGN A;  5A87 A;  3IEM A;  5EVD A;  2QDT A;  4UAM A;  5DPX A;  5ACU A;  3VQZ A;  5LLD A;  4D02 A;  5HIO A;  2BG8 B;  3QH8 A;  1A7T A;  4RBS A;  5AIJ A;  1E5D A;  4C1D A;  5LM6 A;  2GFK A;  3IE2 A;  4KEP A;  5FQA A;  5ACT A;  4UWP B;  5K4M A;  1WRA A;  1YCF A;  2BIB A;  5LSC A;  3KNS A;  3BK1 A;  2YNT A;  2BFK A;  2M5C A;  2H6A A;  2Y8B A;  2CG3 A;  5A0V A;  2YNT B;  4C09 A;  4Z6X A;  4P62 A;  3IEL A;  1BVT A;  2ZWR A;  3SFP A; 
#chains in the Genus database with same CATH homology
 4C1G A;  4ZNB A;  1QH3 A;  3BC2 A;  2DKF A;  5ACR A;  4H0D A;  4J5H A;  3AJ3 A;  3I13 A;  2WYM A;  2GCU A;  4AX0 B;  3T3N A;  4B87 A;  1ZKP A;  4NQ6 A;  2NXA A;  4C1H A;  2BFZ A;  1M2X A;  2P97 A;  5HH4 A;  4PVT A;  2CBN A;  3DHA A;  2YNV A;  3RKJ A;  4XWW A;  1KR3 A;  4FR7 A;  4RL0 A;  1X8I A;  4RAW A;  2FM6 A;  2GMN A;  2BG6 A;  3AF5 A;  1K07 A;  4AX1 B;  5HIQ A;  1DDK A;  2VW8 A;  2FU7 A;  4TYF A;  1QH5 A;  2AZ4 A;  3ADR A;  3FAI A;  4YSB A;  5EV8 A;  3T9M A;  3IOF A;  2BG8 A;  5IQK A;  1JJE A;  4ZEJ A;  2WHG A;  5EHT A;  2QJS A;  2R2D A;  2M5D A;  4TZE A;  4D1V A;  4EY2 A;  5LMC A;  4UBQ A;  3A4Y A;  3L6N A;  3KNR A;  4V0H A;  4AWY B;  3H3E A;  4EYL A;  2QIN A;  2OHI A;  1SML A;  2Q0I A;  4U4L A;  2E7Y A;  2FHX B;  2XF4 A;  4F6Z A;  3PY5 A;  3Q6V A;  4XUK A;  4NQ5 A;  5B1U A;  5EVK A;  2NZE A;  2QDS A;  2WYM C;  2WYL A;  2FK6 A;  5AHO A;  2I7X A;  4DIK A;  3I15 A;  5EH9 A;  4YSL A;  4BZ3 A;  2BGA A;  4UWO B;  4PVO A;  4HL1 A;  5AYA A;  3R2U A;  2UYX A;  3KL7 A;  1KO3 A;  3SD9 A;  2I7V A;  3X2Z A;  4EXY A;  4NQ4 A;  5B3R A;  4TZ9 A;  3SRX A;  2AIO A;  2FU9 A;  1VJN A;  4ZO2 A;  3AF6 A;  5K0W A;  3ZQ4 A;  3S0Z A;  2OHJ A;  2YNW A;  4C1C A;  4RAM A;  4HKY A;  4D1W A;  4AWZ A;  1HLK A;  4UA4 A;  2OHH A;  3DHB A;  1YCH A;  2BC2 A;  5K4N A;  1MQO A;  2BFL A;  3DH8 A;  5KIL A;  4FEK A;  4EFZ A;  2FU8 A;  4D1T A;  3DHC A;  3BV6 A;  2Q0J A;  1BMC A;  4UWR B;  3X30 A;  3X2Y A;  3F9O A;  1DD6 A;  5FQB A;  4EYF A;  5LCH A;  5LCF A;  3ZWF A;  4Z60 A;  4DIL A;  1WUP A;  2P18 A;  1DXK A;  2DOO A;  4RM5 A;  3SW3 A;  2XR1 A;  4TYT A;  2Q9U A;  2A7M A;  4TZF A;  5EV6 A;  5HH5 A;  1JT1 A;  1XTO A;  1KO2 A;  4EXS A;  3IDZ A;  2ZNB A;  4UWS B;  4Z67 A;  3WXC A;  1XM8 A;  5AHR A;  5KIK A;  2YCB A;  5LE1 A;  4O98 A;  3RPC A;  2FHX A;  3VPE A;  3T3O A;  2NZF A;  2YNU A;  2FU6 A;  4TZB A;  3IOG A;  5HH6 A;  5AXO A;  3IE1 A;  5AXR A;  4GYU A;  2P4Z A;  1A8T A;  2WRS A;  3SBL A;  1ZTC A;  2Y87 A;  4C1F A;  3G1P A;  3I11 A;  3TP9 A;  2I7T A;  3PY6 A;  4Z5Z A;  2ZO4 A;  2BTN A;  4CHL A;  5LCA A;  4Z7R A;  1Y44 A;  1X8H A;  5EW0 A;  4Z5Y A;  1WW1 A;  2BG7 A;  3I14 A;  2BR6 A;  4LE6 A;  5LS3 A;  4KEQ A;  5ACW A;  3X2X A;  4NQ2 A;  2Y8A A;  3FCZ A;  4D1U A;  3P2U A;  5A5Z A;  5HIP A;  4F6H A;  4WD6 A;  3ZR9 A;  5ACP A;  2Q42 A;  2ZZI A;  1JJT A;  4XWT A;  3ESH A;  5EVB A;  5ACV A;  2NYP A;  5FQC A;  5EWA A;  5ACS A;  1YCG A;  4RL2 A;  4ZO3 A;  4JO0 A;  3ZNB A;  4C1E A;  2QED A;  3I0V A;  5K4K A;  1P9E A;  2BG2 A;  4HL2 A;  3IEK A;  5ACX A;  4AD9 A;  1X8G A;  2YZ3 A;  4YSK A;  2GFJ A;  2BMI A;  4GCW A;  3BK2 A;  1L9Y A;  3PG4 A;  2P1E A;  1VME A;  5AEB A;  2BFZ B;  3SPU A;  3RKK A;  3IE0 A;  3MD7 A;  2HB9 A;  4EYB A;  2GKL A;  4FSB A;  2YNV B;  5B15 A;  4GYQ A;  1BC2 A;  3JXP A;  1ZNB A;  5HIS A;  4BP0 A;  4J5F A;  1WUO A;  5A0T A;  3LVZ A;  5ACQ A;  1VGN A;  5A87 A;  3IEM A;  5EVD A;  2QDT A;  4UAM A;  5DPX A;  5ACU A;  3VQZ A;  5LLD A;  4D02 A;  5HIO A;  2BG8 B;  3QH8 A;  1A7T A;  4RBS A;  1E5D A;  4C1D A;  5LM6 A;  2GFK A;  3IE2 A;  4KEP A;  5FQA A;  5ACT A;  4UWP B;  5K4M A;  1WRA A;  1YCF A;  2BIB A;  5LSC A;  3KNS A;  3BK1 A;  2YNT A;  2BFK A;  2M5C A;  2H6A A;  2Y8B A;  5A0V A;  2YNT B;  4C09 A;  4Z6X A;  4P62 A;  3IEL A;  1BVT A;  2ZWR A;  3SFP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...