4F6HA

Mutagenesis of zinc ligand residue cys221 reveals plasticity in the imp-1 metallo-b-lactamase active site
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
233
structure length
223
Chain Sequence
LPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGGFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESHPQFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Mutagenesis of zinc ligand residue Cys221 reveals plasticity in the IMP-1 metallo-beta-lactamase active site
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 57
structure length 223
sequence length 233
ec nomenclature
pdb deposition date 2012-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4f6hA00
4Z7RA 3ZWFA 4XWWA 4AD9A 5LMCA 1VJNA 4NQ2A 4UWOB 4ZNBA 4Z67A 5K0WA 3ADRA 3X2YA 2Q42A 3ZQ4A 3X30A 1E5DA 2Y8BA 3IE1A 4EXYA 4ZEJA 2GKLA 4BP0A 2YNUA 3IEKA 2I7VA 3I13A 3IDZA 4RL0A 2GFKA 2WHGA 3P2UA 4J5FA 5ACWA 5HISA 3I0VA 4JO0A 2OHHA 1JJTA 3RKJA 4EYLA 1K07A 2XF4A 2E7YA 5ACVA 2ZWRA 3T3NA 2M5CA 4XWTA 1XTOA 1WUPA 5AHOA 2QEDA 5AXRA 4O98A 4Z5YA 3JXPA 1WW1A 3BK1A 1YCHA 3TP9A 5LS3A 3Q6VA 1P9EA 2OHJA 2VW8A 4Z6XA 3DHAA 3KNSA 3R2UA 3LVZA 4U4LA 5FQAA 3AF6A 2I7XA 5LM6A 2QINA 2WYMC 2YCBA 4C1FA 4V0HA 4F6HA 1M2XA 5AXOA 3AJ3A 4C1EA 3X2ZA 4RM5A 2P1EA 2ZO4A 1MQOA 3VQZA 2Q9UA 3RPCA 1DXKA 4FSBA 4AWYB 4TYFA 4XUKA 1X8HA 5KILA 3H3EA 2CBNA 3ESHA 3S0ZA 3F9OA 3KL7A 2GMNA 3PY5A 3IE0A 3IOGA 5B15A 2BC2A 2QJSA 4TZEA 4H0DA 2M5DA 2Q0JA 4HKYA 2YNWA 1VMEA 4DIKA 4GYQA 4WD6A 4UBQA 5EVBA 3WXCA 3I11A 2FK6A 1VGNA 4GCWA 3ZR9A 1DDKA 4RAMA 3FAIA 3RKKA 5K4KA 5LLDA 5FQCA 1BC2A 2ZZIA 4EYBA 1DD6A 1JT1A 2DOOA 2YNTA 4YSBA 4F6ZA 5ACUA 2YZ3A 1ZNBA 3T3OA 5ACPA 4UWPB 3T9MA 4Z60A 5A5ZA 5EWAA 5AHRA 5K4MA 2BMIA 3DHBA 3DH8A 5KIKA 5HIQA 2A7MA 4C1DA 2NXAA 2BG8A 3KNRA 1KO2A 4AX1B 2BG8B 2ZNBA 3SPUA 2YNVA 4D02A 2Q0IA 3BC2A 5FQBA 5EW0A 2NZFA 2FU6A 1Y44A 5A87A 2DKFA 4ZO2A 1ZKPA 5EVKA 1YCFA 5HIPA 3G1PA 3SD9A 4J5HA 2BFZA 4TZBA 5HIOA 5K4NA 2P97A 2Y8AA 4D1UA 3DHCA 5EV8A 4FEKA 3I14A 3SBLA 2NZEA 1SMLA 2NYPA 5EVDA 4HL2A 5B1UA 4YSKA 5LE1A 4B87A 4NQ5A 3IEMA 2FM6A 2HB9A 2OHIA 2UYXA 5HH6A 4EFZA 4EYFA 1JJEA 5IQKA 4AX0B 1KO3A 1HLKA 2FU7A 2BTNA 4C1GA 4PVOA 5DPXA 2P4ZA 2FU8A 4PVTA 2GFJA 3SFPA 3X2XA 4C1HA 2XR1A 3IE2A 4RL2A 5ACXA 4UAMA 1BVTA 3BV6A 3PG4A 1X8GA 2Y87A 4UA4A 4D1WA 4YSLA 5ACSA 5HH4A 4KEQA 1KR3A 2AZ4A 2I7TA 5A0VA 2BG6A 4Z5ZA 3L6NA 4P62A 4BZ3A 2QDTA 2YNTB 1L9YA 4EXSA 1QH3A 5B3RA 4HL1A 4LE6A 5EHTA 2FHXA 2FHXB 2WRSA 1A7TA 2H6AA 4RAWA 3BK2A 3ZNBA 4GYUA 4C09A 3I15A 4AWZA 2YNVB 3IOFA 5AYAA 1A8TA 2BFLA 2BG2A 4UWRB 3SW3A 4D1TA 4FR7A 1QH5A 4KEPA 2GCUA 2BFZB 5LCHA 5LSCA 5EH9A 2WYMA 3MD7A 4NQ4A 5EV6A 2BR6A 2P18A 4ZO3A 1ZTCA 2R2DA 1WRAA 2BGAA 5HH5A 3QH8A 5ACQA 1XM8A 4C1CA 4NQ6A 4TZ9A 1BMCA 2FU9A 2BIBA 5ACTA 2QDSA 5A0TA 1X8IA 3PY6A 5LCFA 2WYLA 4UWSB 2BFKA 5AEBA 3FCZA 2AIOA 4EY2A 3A4YA 4D1VA 3VPEA 4TYTA 4CHLA 4TZFA 3AF5A 5ACRA 4DILA 4RBSA 3SRXA 1WUOA 5LCAA 2BG7A 1YCGA 3IELA
chains in the Genus database with same CATH superfamily
4Z7RA 3ZWFA 4XWWA 4AD9A 5LMCA 1VJNA 4NQ2A 4UWOB 4ZNBA 4Z67A 5K0WA 3ADRA 3X2YA 5AIJA 2Q42A 3ZQ4A 3X30A 1E5DA 2Y8BA 3IE1A 5A23A 4EXYA 4ZEJA 2GKLA 4BP0A 2YNUA 3IEKA 2I7VA 3I13A 3IDZA 4RL0A 2GFKA 2WHGA 3P2UA 4J5FA 5ACWA 5HISA 3I0VA 4JO0A 2OHHA 1JJTA 3RKJA 4EYLA 1K07A 2XF4A 2E7YA 5ACVA 2ZWRA 3T3NA 2M5CA 4XWTA 1XTOA 1WUPA 5AHOA 2QEDA 5AXRA 4O98A 4Z5YA 3JXPA 1WW1A 3BK1A 1YCHA 3TP9A 5LS3A 3Q6VA 1P9EA 2OHJA 2VW8A 4Z6XA 3DHAA 3KNSA 3R2UA 3LVZA 4U4LA 5FQAA 3AF6A 2I7XA 5LM6A 2QINA 2WYMC 5AJLA 2YCBA 4C1FA 4V0HA 4F6HA 1M2XA 5AXOA 3AJ3A 4C1EA 3X2ZA 4RM5A 2P1EA 2ZO4A 1MQOA 4NURA 3VQZA 2Q9UA 3RPCA 1DXKA 4FSBA 4AWYB 4TYFA 4XUKA 4AXHA 1X8HA 5KILA 3H3EA 2CBNA 3ESHA 3S0ZA 3F9OA 3KL7A 2GMNA 3PY5A 4AV7A 3IE0A 3IOGA 5B15A 2BC2A 2QJSA 4TZEA 4H0DA 2M5DA 2Q0JA 4HKYA 2YNWA 1VMEA 4DIKA 4GYQA 4WD6A 4UBQA 5EVBA 3WXCA 3I11A 2FK6A 1VGNA 4GCWA 3ZR9A 1DDKA 4RAMA 3FAIA 3RKKA 5K4KA 5LLDA 5FQCA 1BC2A 2ZZIA 4EYBA 1DD6A 1JT1A 2DOOA 2YNTA 4YSBA 4F6ZA 5ACUA 2YZ3A 1ZNBA 3T3OA 5ACPA 4UWPB 3T9MA 4Z60A 5A5ZA 5EWAA 5AHRA 5K4MA 2BMIA 3DHBA 3DH8A 5KIKA 5HIQA 2A7MA 4C1DA 2NXAA 2BG8A 3KNRA 1KO2A 4AX1B 2BG8B 2ZNBA 3SPUA 2YNVA 4D02A 2Q0IA 3BC2A 5FQBA 5EW0A 2NZFA 2FU6A 2CFUA 1Y44A 5A87A 2DKFA 4ZO2A 1ZKPA 2CG2A 5EVKA 1YCFA 5HIPA 3G1PA 3SD9A 4J5HA 2BFZA 4TZBA 5HIOA 5K4NA 2P97A 2Y8AA 4D1UA 3DHCA 5EV8A 4FEKA 3I14A 3SBLA 2NZEA 1SMLA 2NYPA 5EVDA 4HL2A 5B1UA 4YSKA 5LE1A 4B87A 4NQ5A 3IEMA 2FM6A 2HB9A 2OHIA 2UYXA 5HH6A 4EFZA 4EYFA 1JJEA 5IQKA 4AX0B 1KO3A 1HLKA 2FU7A 2BTNA 4C1GA 4PVOA 5DPXA 2P4ZA 2FU8A 4PVTA 2YHEA 2GFJA 3SFPA 3X2XA 4C1HA 2XR1A 3IE2A 4RL2A 5ACXA 4PDXA 4UAMA 1BVTA 3BV6A 3PG4A 1X8GA 2Y87A 4UA4A 4D1WA 4YSLA 5ACSA 5HH4A 4KEQA 1KR3A 2AZ4A 2CG3A 2I7TA 5A0VA 2BG6A 4Z5ZA 3L6NA 4P62A 4BZ3A 2QDTA 2YNTB 1L9YA 4EXSA 1QH3A 5B3RA 4HL1A 4LE6A 5EHTA 2FHXA 2FHXB 2WRSA 1A7TA 2H6AA 4RAWA 3BK2A 3ZNBA 4GYUA 4C09A 3I15A 4AWZA 2YNVB 3IOFA 5AYAA 1A8TA 2BFLA 2BG2A 4UWRB 3SW3A 4D1TA 4FR7A 1QH5A 4KEPA 2GCUA 2BFZB 5LCHA 5LSCA 5EH9A 2WYMA 3MD7A 4NQ4A 5EV6A 2BR6A 2P18A 4ZO3A 1ZTCA 2R2DA 1WRAA 2BGAA 5HH5A 3QH8A 2CFZA 5ACQA 1XM8A 4C1CA 4NQ6A 4TZ9A 1BMCA 2FU9A 2BIBA 5ACTA 2QDSA 5A0TA 1X8IA 3PY6A 5LCFA 2WYLA 4UWSB 2BFKA 5AEBA 3FCZA 2AIOA 4EY2A 3A4YA 4D1VA 3VPEA 4TYTA 4CHLA 4TZFA 3AF5A 5ACRA 4DILA 4RBSA 3SRXA 1WUOA 5LCAA 2BG7A 1YCGA 3IELA
chains in the Genus database with same CATH topology
4Z7RA 3ZWFA 4XWWA 4AD9A 5LMCA 1VJNA 4NQ2A 4UWOB 4ZNBA 4Z67A 5K0WA 3ADRA 3X2YA 2Q42A 3ZQ4A 3X30A 1E5DA 2Y8BA 3IE1A 4EXYA 4ZEJA 2GKLA 4BP0A 2YNUA 3IEKA 2I7VA 3I13A 3IDZA 4RL0A 2GFKA 2WHGA 3P2UA 4J5FA 5ACWA 5HISA 3I0VA 4JO0A 2OHHA 1JJTA 3RKJA 4EYLA 1K07A 2XF4A 2E7YA 5ACVA 2ZWRA 3T3NA 2M5CA 4XWTA 1XTOA 1WUPA 5AHOA 2QEDA 5AXRA 4O98A 4Z5YA 3JXPA 1WW1A 3BK1A 1YCHA 3TP9A 5LS3A 3Q6VA 1P9EA 2OHJA 2VW8A 4Z6XA 3DHAA 3KNSA 3R2UA 3LVZA 4U4LA 5FQAA 3AF6A 2I7XA 5LM6A 2QINA 2WYMC 2YCBA 4C1FA 4V0HA 4F6HA 1M2XA 5AXOA 3AJ3A 4C1EA 3X2ZA 4RM5A 2P1EA 2ZO4A 1MQOA 3VQZA 2Q9UA 3RPCA 1DXKA 4FSBA 4AWYB 4TYFA 4XUKA 1X8HA 5KILA 3H3EA 2CBNA 3ESHA 3S0ZA 3F9OA 3KL7A 2GMNA 3PY5A 3IE0A 3IOGA 5B15A 2BC2A 2QJSA 4TZEA 4H0DA 2M5DA 2Q0JA 4HKYA 2YNWA 1VMEA 4DIKA 4GYQA 4WD6A 4UBQA 5EVBA 3WXCA 3I11A 2FK6A 1VGNA 4GCWA 3ZR9A 1DDKA 4RAMA 3FAIA 3RKKA 5K4KA 5LLDA 5FQCA 1BC2A 2ZZIA 4EYBA 1DD6A 1JT1A 2DOOA 2YNTA 4YSBA 4F6ZA 5ACUA 2YZ3A 1ZNBA 3T3OA 5ACPA 4UWPB 3T9MA 4Z60A 5A5ZA 5EWAA 5AHRA 5K4MA 2BMIA 3DHBA 3DH8A 5KIKA 5HIQA 2A7MA 4C1DA 2NXAA 2BG8A 3KNRA 1KO2A 4AX1B 2BG8B 2ZNBA 3SPUA 2YNVA 4D02A 2Q0IA 3BC2A 5FQBA 5EW0A 2NZFA 2FU6A 1Y44A 5A87A 2DKFA 4ZO2A 1ZKPA 5EVKA 1YCFA 5HIPA 3G1PA 3SD9A 4J5HA 2BFZA 4TZBA 5HIOA 5K4NA 2P97A 2Y8AA 4D1UA 3DHCA 5EV8A 4FEKA 3I14A 3SBLA 2NZEA 1SMLA 2NYPA 5EVDA 4HL2A 5B1UA 4YSKA 5LE1A 4B87A 4NQ5A 3IEMA 2FM6A 2HB9A 2OHIA 2UYXA 5HH6A 4EFZA 4EYFA 1JJEA 5IQKA 4AX0B 1KO3A 1HLKA 2FU7A 2BTNA 4C1GA 4PVOA 5DPXA 2P4ZA 2FU8A 4PVTA 2GFJA 3SFPA 3X2XA 4C1HA 2XR1A 3IE2A 4RL2A 5ACXA 4UAMA 1BVTA 3BV6A 3PG4A 1X8GA 2Y87A 4UA4A 4D1WA 4YSLA 5ACSA 5HH4A 4KEQA 1KR3A 2AZ4A 2I7TA 5A0VA 2BG6A 4Z5ZA 3L6NA 4P62A 4BZ3A 2QDTA 2YNTB 1L9YA 4EXSA 1QH3A 5B3RA 4HL1A 4LE6A 5EHTA 2FHXA 2FHXB 2WRSA 1A7TA 2H6AA 4RAWA 3BK2A 3ZNBA 4GYUA 4C09A 3I15A 4AWZA 2YNVB 3IOFA 5AYAA 1A8TA 2BFLA 2BG2A 4UWRB 3SW3A 4D1TA 4FR7A 1QH5A 4KEPA 2GCUA 2BFZB 5LCHA 5LSCA 5EH9A 2WYMA 3MD7A 4NQ4A 5EV6A 2BR6A 2P18A 4ZO3A 1ZTCA 2R2DA 1WRAA 2BGAA 5HH5A 3QH8A 5ACQA 1XM8A 4C1CA 4NQ6A 4TZ9A 1BMCA 2FU9A 2BIBA 5ACTA 2QDSA 5A0TA 1X8IA 3PY6A 5LCFA 2WYLA 4UWSB 2BFKA 5AEBA 3FCZA 2AIOA 4EY2A 3A4YA 4D1VA 3VPEA 4TYTA 4CHLA 4TZFA 3AF5A 5ACRA 4DILA 4RBSA 3SRXA 1WUOA 5LCAA 2BG7A 1YCGA 3IELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z7R A;  3ZWF A;  4XWW A;  4AD9 A;  5LMC A;  1VJN A;  4NQ2 A;  4UWO B;  4ZNB A;  4Z67 A;  5K0W A;  3ADR A;  3X2Y A;  2Q42 A;  3ZQ4 A;  3X30 A;  1E5D A;  2Y8B A;  3IE1 A;  4EXY A;  4ZEJ A;  2GKL A;  4BP0 A;  2YNU A;  3IEK A;  2I7V A;  3I13 A;  3IDZ A;  4RL0 A;  2GFK A;  2WHG A;  3P2U A;  4J5F A;  5ACW A;  5HIS A;  3I0V A;  4JO0 A;  2OHH A;  1JJT A;  3RKJ A;  4EYL A;  1K07 A;  2XF4 A;  2E7Y A;  5ACV A;  2ZWR A;  3T3N A;  2M5C A;  4XWT A;  1XTO A;  1WUP A;  5AHO A;  2QED A;  5AXR A;  4O98 A;  4Z5Y A;  3JXP A;  1WW1 A;  3BK1 A;  1YCH A;  3TP9 A;  5LS3 A;  3Q6V A;  1P9E A;  2OHJ A;  2VW8 A;  4Z6X A;  3DHA A;  3KNS A;  3R2U A;  3LVZ A;  4U4L A;  5FQA A;  3AF6 A;  2I7X A;  5LM6 A;  2QIN A;  2WYM C;  2YCB A;  4C1F A;  4V0H A;  4F6H A;  1M2X A;  5AXO A;  3AJ3 A;  4C1E A;  3X2Z A;  4RM5 A;  2P1E A;  2ZO4 A;  1MQO A;  3VQZ A;  2Q9U A;  3RPC A;  1DXK A;  4FSB A;  4AWY B;  4TYF A;  4XUK A;  1X8H A;  5KIL A;  3H3E A;  2CBN A;  3ESH A;  3S0Z A;  3F9O A;  3KL7 A;  2GMN A;  3PY5 A;  3IE0 A;  3IOG A;  5B15 A;  2BC2 A;  2QJS A;  4TZE A;  4H0D A;  2M5D A;  2Q0J A;  4HKY A;  2YNW A;  1VME A;  4DIK A;  4GYQ A;  4WD6 A;  4UBQ A;  5EVB A;  3WXC A;  3I11 A;  2FK6 A;  1VGN A;  4GCW A;  3ZR9 A;  1DDK A;  4RAM A;  3FAI A;  3RKK A;  5K4K A;  5LLD A;  5FQC A;  1BC2 A;  2ZZI A;  4EYB A;  1DD6 A;  1JT1 A;  2DOO A;  2YNT A;  4YSB A;  4F6Z A;  5ACU A;  2YZ3 A;  1ZNB A;  3T3O A;  5ACP A;  4UWP B;  3T9M A;  4Z60 A;  5A5Z A;  5EWA A;  5AHR A;  5K4M A;  2BMI A;  3DHB A;  3DH8 A;  5KIK A;  5HIQ A;  2A7M A;  4C1D A;  2NXA A;  2BG8 A;  3KNR A;  1KO2 A;  4AX1 B;  2BG8 B;  2ZNB A;  3SPU A;  2YNV A;  4D02 A;  2Q0I A;  3BC2 A;  5FQB A;  5EW0 A;  2NZF A;  2FU6 A;  1Y44 A;  5A87 A;  2DKF A;  4ZO2 A;  1ZKP A;  5EVK A;  1YCF A;  5HIP A;  3G1P A;  3SD9 A;  4J5H A;  2BFZ A;  4TZB A;  5HIO A;  5K4N A;  2P97 A;  2Y8A A;  4D1U A;  3DHC A;  5EV8 A;  4FEK A;  3I14 A;  3SBL A;  2NZE A;  1SML A;  2NYP A;  5EVD A;  4HL2 A;  5B1U A;  4YSK A;  5LE1 A;  4B87 A;  4NQ5 A;  3IEM A;  2FM6 A;  2HB9 A;  2OHI A;  2UYX A;  5HH6 A;  4EFZ A;  4EYF A;  1JJE A;  5IQK A;  4AX0 B;  1KO3 A;  1HLK A;  2FU7 A;  2BTN A;  4C1G A;  4PVO A;  5DPX A;  2P4Z A;  2FU8 A;  4PVT A;  2GFJ A;  3SFP A;  3X2X A;  4C1H A;  2XR1 A;  3IE2 A;  4RL2 A;  5ACX A;  4UAM A;  1BVT A;  3BV6 A;  3PG4 A;  1X8G A;  2Y87 A;  4UA4 A;  4D1W A;  4YSL A;  5ACS A;  5HH4 A;  4KEQ A;  1KR3 A;  2AZ4 A;  2I7T A;  5A0V A;  2BG6 A;  4Z5Z A;  3L6N A;  4P62 A;  4BZ3 A;  2QDT A;  2YNT B;  1L9Y A;  4EXS A;  1QH3 A;  5B3R A;  4HL1 A;  4LE6 A;  5EHT A;  2FHX A;  2FHX B;  2WRS A;  1A7T A;  2H6A A;  4RAW A;  3BK2 A;  3ZNB A;  4GYU A;  4C09 A;  3I15 A;  4AWZ A;  2YNV B;  3IOF A;  5AYA A;  1A8T A;  2BFL A;  2BG2 A;  4UWR B;  3SW3 A;  4D1T A;  4FR7 A;  1QH5 A;  4KEP A;  2GCU A;  2BFZ B;  5LCH A;  5LSC A;  5EH9 A;  2WYM A;  3MD7 A;  4NQ4 A;  5EV6 A;  2BR6 A;  2P18 A;  4ZO3 A;  1ZTC A;  2R2D A;  1WRA A;  2BGA A;  5HH5 A;  3QH8 A;  5ACQ A;  1XM8 A;  4C1C A;  4NQ6 A;  4TZ9 A;  1BMC A;  2FU9 A;  2BIB A;  5ACT A;  2QDS A;  5A0T A;  1X8I A;  3PY6 A;  5LCF A;  2WYL A;  4UWS B;  2BFK A;  5AEB A;  3FCZ A;  2AIO A;  4EY2 A;  3A4Y A;  4D1V A;  3VPE A;  4TYT A;  4CHL A;  4TZF A;  3AF5 A;  5ACR A;  4DIL A;  4RBS A;  3SRX A;  1WUO A;  5LCA A;  2BG7 A;  1YCG A;  3IEL A; 
#chains in the Genus database with same CATH topology
 4Z7R A;  3ZWF A;  4XWW A;  4AD9 A;  5LMC A;  1VJN A;  4NQ2 A;  4UWO B;  4ZNB A;  4Z67 A;  5K0W A;  3ADR A;  3X2Y A;  5AIJ A;  2Q42 A;  3ZQ4 A;  3X30 A;  1E5D A;  2Y8B A;  3IE1 A;  5A23 A;  4EXY A;  4ZEJ A;  2GKL A;  4BP0 A;  2YNU A;  3IEK A;  2I7V A;  3I13 A;  3IDZ A;  4RL0 A;  2GFK A;  2WHG A;  3P2U A;  4J5F A;  5ACW A;  5HIS A;  3I0V A;  4JO0 A;  2OHH A;  1JJT A;  3RKJ A;  4EYL A;  1K07 A;  2XF4 A;  2E7Y A;  5ACV A;  2ZWR A;  3T3N A;  2M5C A;  4XWT A;  1XTO A;  1WUP A;  5AHO A;  2QED A;  5AXR A;  4O98 A;  4Z5Y A;  3JXP A;  1WW1 A;  3BK1 A;  1YCH A;  3TP9 A;  5LS3 A;  3Q6V A;  1P9E A;  2OHJ A;  2VW8 A;  4Z6X A;  3DHA A;  3KNS A;  3R2U A;  3LVZ A;  4U4L A;  5FQA A;  3AF6 A;  2I7X A;  5LM6 A;  2QIN A;  2WYM C;  5AJL A;  2YCB A;  4C1F A;  4V0H A;  4F6H A;  1M2X A;  5AXO A;  3AJ3 A;  4C1E A;  3X2Z A;  4RM5 A;  2P1E A;  2ZO4 A;  1MQO A;  4NUR A;  3VQZ A;  2Q9U A;  3RPC A;  1DXK A;  4FSB A;  4AWY B;  4TYF A;  4XUK A;  4AXH A;  1X8H A;  5KIL A;  3H3E A;  2CBN A;  3ESH A;  3S0Z A;  3F9O A;  3KL7 A;  2GMN A;  3PY5 A;  4AV7 A;  3IE0 A;  3IOG A;  5B15 A;  2BC2 A;  2QJS A;  4TZE A;  4H0D A;  2M5D A;  2Q0J A;  4HKY A;  2YNW A;  1VME A;  4DIK A;  4GYQ A;  4WD6 A;  4UBQ A;  5EVB A;  3WXC A;  3I11 A;  2FK6 A;  1VGN A;  4GCW A;  3ZR9 A;  1DDK A;  4RAM A;  3FAI A;  3RKK A;  5K4K A;  5LLD A;  5FQC A;  1BC2 A;  2ZZI A;  4EYB A;  1DD6 A;  1JT1 A;  2DOO A;  2YNT A;  4YSB A;  4F6Z A;  5ACU A;  2YZ3 A;  1ZNB A;  3T3O A;  5ACP A;  4UWP B;  3T9M A;  4Z60 A;  5A5Z A;  5EWA A;  5AHR A;  5K4M A;  2BMI A;  3DHB A;  3DH8 A;  5KIK A;  5HIQ A;  2A7M A;  4C1D A;  2NXA A;  2BG8 A;  3KNR A;  1KO2 A;  4AX1 B;  2BG8 B;  2ZNB A;  3SPU A;  2YNV A;  4D02 A;  2Q0I A;  3BC2 A;  5FQB A;  5EW0 A;  2NZF A;  2FU6 A;  2CFU A;  1Y44 A;  5A87 A;  2DKF A;  4ZO2 A;  1ZKP A;  2CG2 A;  5EVK A;  1YCF A;  5HIP A;  3G1P A;  3SD9 A;  4J5H A;  2BFZ A;  4TZB A;  5HIO A;  5K4N A;  2P97 A;  2Y8A A;  4D1U A;  3DHC A;  5EV8 A;  4FEK A;  3I14 A;  3SBL A;  2NZE A;  1SML A;  2NYP A;  5EVD A;  4HL2 A;  5B1U A;  4YSK A;  5LE1 A;  4B87 A;  4NQ5 A;  3IEM A;  2FM6 A;  2HB9 A;  2OHI A;  2UYX A;  5HH6 A;  4EFZ A;  4EYF A;  1JJE A;  5IQK A;  4AX0 B;  1KO3 A;  1HLK A;  2FU7 A;  2BTN A;  4C1G A;  4PVO A;  5DPX A;  2P4Z A;  2FU8 A;  4PVT A;  2YHE A;  2GFJ A;  3SFP A;  3X2X A;  4C1H A;  2XR1 A;  3IE2 A;  4RL2 A;  5ACX A;  4PDX A;  4UAM A;  1BVT A;  3BV6 A;  3PG4 A;  1X8G A;  2Y87 A;  4UA4 A;  4D1W A;  4YSL A;  5ACS A;  5HH4 A;  4KEQ A;  1KR3 A;  2AZ4 A;  2CG3 A;  2I7T A;  5A0V A;  2BG6 A;  4Z5Z A;  3L6N A;  4P62 A;  4BZ3 A;  2QDT A;  2YNT B;  1L9Y A;  4EXS A;  1QH3 A;  5B3R A;  4HL1 A;  4LE6 A;  5EHT A;  2FHX A;  2FHX B;  2WRS A;  1A7T A;  2H6A A;  4RAW A;  3BK2 A;  3ZNB A;  4GYU A;  4C09 A;  3I15 A;  4AWZ A;  2YNV B;  3IOF A;  5AYA A;  1A8T A;  2BFL A;  2BG2 A;  4UWR B;  3SW3 A;  4D1T A;  4FR7 A;  1QH5 A;  4KEP A;  2GCU A;  2BFZ B;  5LCH A;  5LSC A;  5EH9 A;  2WYM A;  3MD7 A;  4NQ4 A;  5EV6 A;  2BR6 A;  2P18 A;  4ZO3 A;  1ZTC A;  2R2D A;  1WRA A;  2BGA A;  5HH5 A;  3QH8 A;  2CFZ A;  5ACQ A;  1XM8 A;  4C1C A;  4NQ6 A;  4TZ9 A;  1BMC A;  2FU9 A;  2BIB A;  5ACT A;  2QDS A;  5A0T A;  1X8I A;  3PY6 A;  5LCF A;  2WYL A;  4UWS B;  2BFK A;  5AEB A;  3FCZ A;  2AIO A;  4EY2 A;  3A4Y A;  4D1V A;  3VPE A;  4TYT A;  4CHL A;  4TZF A;  3AF5 A;  5ACR A;  4DIL A;  4RBS A;  3SRX A;  1WUO A;  5LCA A;  2BG7 A;  1YCG A;  3IEL A; 
#chains in the Genus database with same CATH homology
 4Z7R A;  3ZWF A;  4XWW A;  4AD9 A;  5LMC A;  1VJN A;  4NQ2 A;  4UWO B;  4ZNB A;  4Z67 A;  5K0W A;  3ADR A;  3X2Y A;  2Q42 A;  3ZQ4 A;  3X30 A;  1E5D A;  2Y8B A;  3IE1 A;  4EXY A;  4ZEJ A;  2GKL A;  4BP0 A;  2YNU A;  3IEK A;  2I7V A;  3I13 A;  3IDZ A;  4RL0 A;  2GFK A;  2WHG A;  3P2U A;  4J5F A;  5ACW A;  5HIS A;  3I0V A;  4JO0 A;  2OHH A;  1JJT A;  3RKJ A;  4EYL A;  1K07 A;  2XF4 A;  2E7Y A;  5ACV A;  2ZWR A;  3T3N A;  2M5C A;  4XWT A;  1XTO A;  1WUP A;  5AHO A;  2QED A;  5AXR A;  4O98 A;  4Z5Y A;  3JXP A;  1WW1 A;  3BK1 A;  1YCH A;  3TP9 A;  5LS3 A;  3Q6V A;  1P9E A;  2OHJ A;  2VW8 A;  4Z6X A;  3DHA A;  3KNS A;  3R2U A;  3LVZ A;  4U4L A;  5FQA A;  3AF6 A;  2I7X A;  5LM6 A;  2QIN A;  2WYM C;  2YCB A;  4C1F A;  4V0H A;  4F6H A;  1M2X A;  5AXO A;  3AJ3 A;  4C1E A;  3X2Z A;  4RM5 A;  2P1E A;  2ZO4 A;  1MQO A;  3VQZ A;  2Q9U A;  3RPC A;  1DXK A;  4FSB A;  4AWY B;  4TYF A;  4XUK A;  1X8H A;  5KIL A;  3H3E A;  2CBN A;  3ESH A;  3S0Z A;  3F9O A;  3KL7 A;  2GMN A;  3PY5 A;  3IE0 A;  3IOG A;  5B15 A;  2BC2 A;  2QJS A;  4TZE A;  4H0D A;  2M5D A;  2Q0J A;  4HKY A;  2YNW A;  1VME A;  4DIK A;  4GYQ A;  4WD6 A;  4UBQ A;  5EVB A;  3WXC A;  3I11 A;  2FK6 A;  1VGN A;  4GCW A;  3ZR9 A;  1DDK A;  4RAM A;  3FAI A;  3RKK A;  5K4K A;  5LLD A;  5FQC A;  1BC2 A;  2ZZI A;  4EYB A;  1DD6 A;  1JT1 A;  2DOO A;  2YNT A;  4YSB A;  4F6Z A;  5ACU A;  2YZ3 A;  1ZNB A;  3T3O A;  5ACP A;  4UWP B;  3T9M A;  4Z60 A;  5A5Z A;  5EWA A;  5AHR A;  5K4M A;  2BMI A;  3DHB A;  3DH8 A;  5KIK A;  5HIQ A;  2A7M A;  4C1D A;  2NXA A;  2BG8 A;  3KNR A;  1KO2 A;  4AX1 B;  2BG8 B;  2ZNB A;  3SPU A;  2YNV A;  4D02 A;  2Q0I A;  3BC2 A;  5FQB A;  5EW0 A;  2NZF A;  2FU6 A;  1Y44 A;  5A87 A;  2DKF A;  4ZO2 A;  1ZKP A;  5EVK A;  1YCF A;  5HIP A;  3G1P A;  3SD9 A;  4J5H A;  2BFZ A;  4TZB A;  5HIO A;  5K4N A;  2P97 A;  2Y8A A;  4D1U A;  3DHC A;  5EV8 A;  4FEK A;  3I14 A;  3SBL A;  2NZE A;  1SML A;  2NYP A;  5EVD A;  4HL2 A;  5B1U A;  4YSK A;  5LE1 A;  4B87 A;  4NQ5 A;  3IEM A;  2FM6 A;  2HB9 A;  2OHI A;  2UYX A;  5HH6 A;  4EFZ A;  4EYF A;  1JJE A;  5IQK A;  4AX0 B;  1KO3 A;  1HLK A;  2FU7 A;  2BTN A;  4C1G A;  4PVO A;  5DPX A;  2P4Z A;  2FU8 A;  4PVT A;  2GFJ A;  3SFP A;  3X2X A;  4C1H A;  2XR1 A;  3IE2 A;  4RL2 A;  5ACX A;  4UAM A;  1BVT A;  3BV6 A;  3PG4 A;  1X8G A;  2Y87 A;  4UA4 A;  4D1W A;  4YSL A;  5ACS A;  5HH4 A;  4KEQ A;  1KR3 A;  2AZ4 A;  2I7T A;  5A0V A;  2BG6 A;  4Z5Z A;  3L6N A;  4P62 A;  4BZ3 A;  2QDT A;  2YNT B;  1L9Y A;  4EXS A;  1QH3 A;  5B3R A;  4HL1 A;  4LE6 A;  5EHT A;  2FHX A;  2FHX B;  2WRS A;  1A7T A;  2H6A A;  4RAW A;  3BK2 A;  3ZNB A;  4GYU A;  4C09 A;  3I15 A;  4AWZ A;  2YNV B;  3IOF A;  5AYA A;  1A8T A;  2BFL A;  2BG2 A;  4UWR B;  3SW3 A;  4D1T A;  4FR7 A;  1QH5 A;  4KEP A;  2GCU A;  2BFZ B;  5LCH A;  5LSC A;  5EH9 A;  2WYM A;  3MD7 A;  4NQ4 A;  5EV6 A;  2BR6 A;  2P18 A;  4ZO3 A;  1ZTC A;  2R2D A;  1WRA A;  2BGA A;  5HH5 A;  3QH8 A;  5ACQ A;  1XM8 A;  4C1C A;  4NQ6 A;  4TZ9 A;  1BMC A;  2FU9 A;  2BIB A;  5ACT A;  2QDS A;  5A0T A;  1X8I A;  3PY6 A;  5LCF A;  2WYL A;  4UWS B;  2BFK A;  5AEB A;  3FCZ A;  2AIO A;  4EY2 A;  3A4Y A;  4D1V A;  3VPE A;  4TYT A;  4CHL A;  4TZF A;  3AF5 A;  5ACR A;  4DIL A;  4RBS A;  3SRX A;  1WUO A;  5LCA A;  2BG7 A;  1YCG A;  3IEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...