4F6HA

Mutagenesis of zinc ligand residue cys221 reveals plasticity in the imp-1 metallo-b-lactamase active site
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
233
structure length
223
Chain Sequence
LPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGGFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESHPQFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutagenesis of zinc ligand residue Cys221 reveals plasticity in the IMP-1 metallo-beta-lactamase active site
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords Beta-lactamase
total genus 57
structure length 223
sequence length 233
ec nomenclature
pdb deposition date 2012-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4f6hA00
2OHHA 4NQ6A 1VJNA 2GFJA 4TYTA 2QJSA 3RPCA 4C1DA 3FCZA 2FM6A 1DD6A 4BP0A 1BVTA 4V0HA 5LM6A 5ACSA 4LE6A 2BR6A 2FHXA 4PVOA 5KILA 3PY5A 5EWAA 4NQ5A 4AWYB 2AZ4A 4XUKA 5LSCA 4EYBA 2Y8AA 3R2UA 3IE1A 3L6NA 4UA4A 3AF6A 2QEDA 3A4YA 1ZNBA 3SBLA 2NYPA 5ACXA 5EV6A 4J5HA 5A87A 4F6ZA 4TZBA 2WYMA 1JJEA 5HH4A 4B87A 2WYLA 3FAIA 5LCAA 2QDSA 4UWOB 5B15A 3PG4A 2BG7A 2NZEA 5EVKA 5AYAA 2Y87A 2OHIA 4EY2A 4AD9A 2BG6A 3I14A 2YNTB 2Q9UA 2FU7A 4RL2A 1K07A 1L9YA 2BMIA 4NQ4A 2HB9A 3DHAA 5B1UA 4UAMA 3IELA 5ACTA 1VMEA 1X8HA 4WD6A 5FQCA 5HH6A 2A7MA 5ACRA 3KNSA 4UBQA 4PVTA 1KR3A 2DOOA 4RBSA 1WW1A 3IDZA 3AF5A 4FEKA 5EV8A 3LVZA 1QH5A 2WHGA 2BG8A 3BV6A 5K4NA 4GYUA 1XTOA 4TYFA 3QH8A 1XM8A 3DH8A 3ZNBA 2QDTA 2YZ3A 2YNTA 2VW8A 5HIPA 4AX0B 4P62A 1YCHA 1QH3A 4ZEJA 2FHXB 2I7VA 4ZO2A 4EXYA 4YSLA 4ZO3A 5ACVA 2FU8A 2BGAA 4DIKA 4HKYA 2YNVB 5LE1A 1ZTCA 4J5FA 3SPUA 4JO0A 4YSKA 3X2YA 3DHBA 4XWWA 5ACQA 4C1EA 5ACUA 3I15A 2I7TA 2DKFA 5HISA 5AHRA 4EYFA 2YNWA 1MQOA 2E7YA 4O98A 3BK2A 1ZKPA 1BC2A 1SMLA 3T3OA 2NZFA 3IE2A 4UWRB 5A5ZA 4TZEA 3IE0A 5EVBA 3DHCA 4Z6XA 2QINA 1X8IA 4C09A 2GCUA 5DPXA 5AEBA 5AXRA 1YCGA 2BIBA 2I7XA 2P4ZA 4Z60A 2WYMC 2H6AA 3X2XA 4C1CA 1WUOA 2AIOA 3JXPA 2M5DA 2R2DA 4GCWA 4AWZA 3VQZA 1JJTA 4EXSA 4RAWA 5LS3A 5ACWA 3T3NA 4YSBA 2XR1A 3ZR9A 4D1WA 3T9MA 3H3EA 2M5CA 1KO2A 2WRSA 2BTNA 4KEQA 3SFPA 4BZ3A 5FQBA 4CHLA 4C1GA 2P18A 2FU9A 5LCFA 2YCBA 2XF4A 3I13A 3IEKA 4C1FA 2ZWRA 2BG8B 2ZO4A 1HLKA 1Y44A 3KNRA 2BFZA 3IOGA 1M2XA 5A0TA 4FR7A 3IEMA 2P1EA 1E5DA 3Q6VA 4UWSB 2BG2A 4HL1A 1DDKA 2GKLA 3SRXA 3WXCA 4EFZA 3ESHA 3ZQ4A 2YNVA 3IOFA 5HIOA 5HIQA 5K0WA 1WRAA 1A8TA 1WUPA 2GFKA 3G1PA 1DXKA 3X2ZA 4F6HA 5EHTA 3I11A 4NQ2A 4TZFA 2Q0IA 3BC2A 4RAMA 3I0VA 5IQKA 4KEPA 2ZNBA 4XWTA 2UYXA 3PY6A 3RKJA 5K4KA 5LCHA 5AXOA 3X30A 4GYQA 3SW3A 3AJ3A 5EH9A 2Q42A 5ACPA 2BFLA 1YCFA 3TP9A 5LMCA 4D1VA 2Q0JA 4Z67A 3RKKA 4TZ9A 2BFZB 2Y8BA 4H0DA 1P9EA 4Z5YA 5FQAA 3S0ZA 3SD9A 2CBNA 4ZNBA 4RM5A 3ADRA 4U4LA 2NXAA 2OHJA 3BK1A 2P97A 1VGNA 4DILA 1X8GA 3F9OA 4FSBA 4EYLA 2FU6A 3P2UA 3KL7A 3VPEA 4UWPB 4D1UA 4AX1B 5LLDA 5A0VA 5AHOA 5KIKA 4D02A 4RL0A 3ZWFA 4D1TA 1A7TA 1JT1A 4C1HA 5EVDA 4Z5ZA 2YNUA 4HL2A 2ZZIA 5EW0A 3MD7A 1KO3A 2FK6A 4Z7RA 2GMNA 2BC2A 1BMCA 5HH5A 5B3RA 2BFKA 5K4MA
chains in the Genus database with same CATH superfamily
2OHHA 4NQ6A 1VJNA 5A23A 2GFJA 4TYTA 2QJSA 3RPCA 4C1DA 3FCZA 2FM6A 1DD6A 4BP0A 1BVTA 4V0HA 4NURA 5LM6A 5ACSA 4LE6A 2BR6A 2FHXA 4PVOA 3PY5A 5KILA 5EWAA 4NQ5A 4AWYB 2AZ4A 4XUKA 5LSCA 4EYBA 2Y8AA 3R2UA 3IE1A 3L6NA 4UA4A 3AF6A 2QEDA 3A4YA 1ZNBA 3SBLA 2NYPA 5ACXA 5EV6A 4J5HA 5A87A 4F6ZA 4TZBA 2WYMA 1JJEA 5HH4A 4B87A 2WYLA 3FAIA 5LCAA 2QDSA 4UWOB 5B15A 3PG4A 2BG7A 2CG2A 2NZEA 5EVKA 5AYAA 2Y87A 2OHIA 2CFZA 4EY2A 4AD9A 2BG6A 3I14A 2YNTB 2Q9UA 2FU7A 4RL2A 1K07A 1L9YA 2BMIA 4NQ4A 2HB9A 3DHAA 5B1UA 4UAMA 3IELA 5ACTA 1VMEA 1X8HA 4WD6A 5FQCA 5HH6A 2A7MA 5ACRA 3KNSA 4UBQA 4PVTA 1KR3A 2DOOA 4RBSA 1WW1A 3IDZA 3AF5A 4FEKA 5EV8A 3LVZA 1QH5A 2WHGA 2BG8A 3BV6A 5K4NA 4GYUA 1XTOA 4PDXA 4TYFA 3QH8A 1XM8A 3DH8A 3ZNBA 2QDTA 2YZ3A 2YNTA 2VW8A 5HIPA 4AX0B 4P62A 1YCHA 1QH3A 4ZEJA 2FHXB 2YHEA 2I7VA 4ZO2A 4EXYA 4YSLA 4ZO3A 5ACVA 2FU8A 2BGAA 4DIKA 4HKYA 2YNVB 5LE1A 1ZTCA 4J5FA 3SPUA 4JO0A 4YSKA 3X2YA 3DHBA 4XWWA 5ACQA 4C1EA 5ACUA 3I15A 2I7TA 2DKFA 5HISA 5AHRA 2CG3A 4EYFA 2YNWA 1MQOA 2E7YA 4O98A 3BK2A 1ZKPA 1BC2A 1SMLA 3T3OA 2NZFA 3IE2A 4UWRB 5A5ZA 4TZEA 3IE0A 5EVBA 3DHCA 4Z6XA 2QINA 1X8IA 4C09A 2GCUA 5DPXA 5AEBA 5AXRA 1YCGA 2BIBA 2I7XA 2P4ZA 4Z60A 2WYMC 2H6AA 3X2XA 4C1CA 1WUOA 2AIOA 3JXPA 2M5DA 2R2DA 4GCWA 4AWZA 3VQZA 1JJTA 4EXSA 4RAWA 5LS3A 5ACWA 3T3NA 4YSBA 2XR1A 3ZR9A 4D1WA 3T9MA 3H3EA 2M5CA 1KO2A 2WRSA 2BTNA 4KEQA 3SFPA 4BZ3A 5FQBA 4CHLA 4C1GA 2P18A 2FU9A 5LCFA 2YCBA 2XF4A 3I13A 3IEKA 4C1FA 2ZWRA 2BG8B 2ZO4A 1HLKA 1Y44A 3KNRA 2BFZA 3IOGA 1M2XA 5A0TA 4FR7A 3IEMA 2P1EA 1E5DA 3Q6VA 4UWSB 4AV7A 2BG2A 4HL1A 1DDKA 2GKLA 3SRXA 3WXCA 4EFZA 3ESHA 3ZQ4A 2YNVA 3IOFA 5HIOA 5HIQA 5K0WA 1WRAA 1A8TA 1WUPA 2GFKA 3G1PA 1DXKA 3X2ZA 4F6HA 5EHTA 3I11A 4NQ2A 4TZFA 2Q0IA 3BC2A 4RAMA 3I0VA 2CFUA 5IQKA 4KEPA 4AXHA 2ZNBA 4XWTA 2UYXA 3PY6A 3RKJA 5K4KA 5LCHA 5AXOA 3X30A 4GYQA 3SW3A 3AJ3A 5EH9A 2Q42A 5ACPA 5AIJA 2BFLA 1YCFA 3TP9A 5LMCA 4D1VA 2Q0JA 4Z67A 3RKKA 4TZ9A 2BFZB 2Y8BA 4H0DA 1P9EA 4Z5YA 5FQAA 3S0ZA 3SD9A 2CBNA 4ZNBA 4RM5A 3ADRA 4U4LA 2NXAA 2OHJA 3BK1A 2P97A 1VGNA 4DILA 1X8GA 3F9OA 4FSBA 4EYLA 2FU6A 3P2UA 3KL7A 3VPEA 4UWPB 4D1UA 4AX1B 5LLDA 5A0VA 5AHOA 5KIKA 4D02A 4RL0A 3ZWFA 4D1TA 1A7TA 1JT1A 5AJLA 4C1HA 5EVDA 4Z5ZA 2YNUA 4HL2A 2ZZIA 5EW0A 3MD7A 1KO3A 2FK6A 4Z7RA 2GMNA 2BC2A 1BMCA 5HH5A 5B3RA 2BFKA 5K4MA
chains in the Genus database with same CATH topology
2OHHA 4NQ6A 1VJNA 2GFJA 4TYTA 2QJSA 3RPCA 4C1DA 3FCZA 2FM6A 1DD6A 4BP0A 1BVTA 4V0HA 5LM6A 5ACSA 4LE6A 2BR6A 2FHXA 4PVOA 5KILA 3PY5A 5EWAA 4NQ5A 4AWYB 2AZ4A 4XUKA 5LSCA 4EYBA 2Y8AA 3R2UA 3IE1A 3L6NA 4UA4A 3AF6A 2QEDA 3A4YA 1ZNBA 3SBLA 2NYPA 5ACXA 5EV6A 4J5HA 5A87A 4F6ZA 4TZBA 2WYMA 1JJEA 5HH4A 4B87A 2WYLA 3FAIA 5LCAA 2QDSA 4UWOB 5B15A 3PG4A 2BG7A 2NZEA 5EVKA 5AYAA 2Y87A 2OHIA 4EY2A 4AD9A 2BG6A 3I14A 2YNTB 2Q9UA 2FU7A 4RL2A 1K07A 1L9YA 2BMIA 4NQ4A 2HB9A 3DHAA 5B1UA 4UAMA 3IELA 5ACTA 1VMEA 1X8HA 4WD6A 5FQCA 5HH6A 2A7MA 5ACRA 3KNSA 4UBQA 4PVTA 1KR3A 2DOOA 4RBSA 1WW1A 3IDZA 3AF5A 4FEKA 5EV8A 3LVZA 1QH5A 2WHGA 2BG8A 3BV6A 5K4NA 4GYUA 1XTOA 4TYFA 3QH8A 1XM8A 3DH8A 3ZNBA 2QDTA 2YZ3A 2YNTA 2VW8A 5HIPA 4AX0B 4P62A 1YCHA 1QH3A 4ZEJA 2FHXB 2I7VA 4ZO2A 4EXYA 4YSLA 4ZO3A 5ACVA 2FU8A 2BGAA 4DIKA 4HKYA 2YNVB 5LE1A 1ZTCA 4J5FA 3SPUA 4JO0A 4YSKA 3X2YA 3DHBA 4XWWA 5ACQA 4C1EA 5ACUA 3I15A 2I7TA 2DKFA 5HISA 5AHRA 4EYFA 2YNWA 1MQOA 2E7YA 4O98A 3BK2A 1ZKPA 1BC2A 1SMLA 3T3OA 2NZFA 3IE2A 4UWRB 5A5ZA 4TZEA 3IE0A 5EVBA 3DHCA 4Z6XA 2QINA 1X8IA 4C09A 2GCUA 5DPXA 5AEBA 5AXRA 1YCGA 2BIBA 2I7XA 2P4ZA 4Z60A 2WYMC 2H6AA 3X2XA 4C1CA 1WUOA 2AIOA 3JXPA 2M5DA 2R2DA 4GCWA 4AWZA 3VQZA 1JJTA 4EXSA 4RAWA 5LS3A 5ACWA 3T3NA 4YSBA 2XR1A 3ZR9A 4D1WA 3T9MA 3H3EA 2M5CA 1KO2A 2WRSA 2BTNA 4KEQA 3SFPA 4BZ3A 5FQBA 4CHLA 4C1GA 2P18A 2FU9A 5LCFA 2YCBA 2XF4A 3I13A 3IEKA 4C1FA 2ZWRA 2BG8B 2ZO4A 1HLKA 1Y44A 3KNRA 2BFZA 3IOGA 1M2XA 5A0TA 4FR7A 3IEMA 2P1EA 1E5DA 3Q6VA 4UWSB 2BG2A 4HL1A 1DDKA 2GKLA 3SRXA 3WXCA 4EFZA 3ESHA 3ZQ4A 2YNVA 3IOFA 5HIOA 5HIQA 5K0WA 1WRAA 1A8TA 1WUPA 2GFKA 3G1PA 1DXKA 3X2ZA 4F6HA 5EHTA 3I11A 4NQ2A 4TZFA 2Q0IA 3BC2A 4RAMA 3I0VA 5IQKA 4KEPA 2ZNBA 4XWTA 2UYXA 3PY6A 3RKJA 5K4KA 5LCHA 5AXOA 3X30A 4GYQA 3SW3A 3AJ3A 5EH9A 2Q42A 5ACPA 2BFLA 1YCFA 3TP9A 5LMCA 4D1VA 2Q0JA 4Z67A 3RKKA 4TZ9A 2BFZB 2Y8BA 4H0DA 1P9EA 4Z5YA 5FQAA 3S0ZA 3SD9A 2CBNA 4ZNBA 4RM5A 3ADRA 4U4LA 2NXAA 2OHJA 3BK1A 2P97A 1VGNA 4DILA 1X8GA 3F9OA 4FSBA 4EYLA 2FU6A 3P2UA 3KL7A 3VPEA 4UWPB 4D1UA 4AX1B 5LLDA 5A0VA 5AHOA 5KIKA 4D02A 4RL0A 3ZWFA 4D1TA 1A7TA 1JT1A 4C1HA 5EVDA 4Z5ZA 2YNUA 4HL2A 2ZZIA 5EW0A 3MD7A 1KO3A 2FK6A 4Z7RA 2GMNA 2BC2A 1BMCA 5HH5A 5B3RA 2BFKA 5K4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OHH A;  4NQ6 A;  1VJN A;  2GFJ A;  4TYT A;  2QJS A;  3RPC A;  4C1D A;  3FCZ A;  2FM6 A;  1DD6 A;  4BP0 A;  1BVT A;  4V0H A;  5LM6 A;  5ACS A;  4LE6 A;  2BR6 A;  2FHX A;  4PVO A;  5KIL A;  3PY5 A;  5EWA A;  4NQ5 A;  4AWY B;  2AZ4 A;  4XUK A;  5LSC A;  4EYB A;  2Y8A A;  3R2U A;  3IE1 A;  3L6N A;  4UA4 A;  3AF6 A;  2QED A;  3A4Y A;  1ZNB A;  3SBL A;  2NYP A;  5ACX A;  5EV6 A;  4J5H A;  5A87 A;  4F6Z A;  4TZB A;  2WYM A;  1JJE A;  5HH4 A;  4B87 A;  2WYL A;  3FAI A;  5LCA A;  2QDS A;  4UWO B;  5B15 A;  3PG4 A;  2BG7 A;  2NZE A;  5EVK A;  5AYA A;  2Y87 A;  2OHI A;  4EY2 A;  4AD9 A;  2BG6 A;  3I14 A;  2YNT B;  2Q9U A;  2FU7 A;  4RL2 A;  1K07 A;  1L9Y A;  2BMI A;  4NQ4 A;  2HB9 A;  3DHA A;  5B1U A;  4UAM A;  3IEL A;  5ACT A;  1VME A;  1X8H A;  4WD6 A;  5FQC A;  5HH6 A;  2A7M A;  5ACR A;  3KNS A;  4UBQ A;  4PVT A;  1KR3 A;  2DOO A;  4RBS A;  1WW1 A;  3IDZ A;  3AF5 A;  4FEK A;  5EV8 A;  3LVZ A;  1QH5 A;  2WHG A;  2BG8 A;  3BV6 A;  5K4N A;  4GYU A;  1XTO A;  4TYF A;  3QH8 A;  1XM8 A;  3DH8 A;  3ZNB A;  2QDT A;  2YZ3 A;  2YNT A;  2VW8 A;  5HIP A;  4AX0 B;  4P62 A;  1YCH A;  1QH3 A;  4ZEJ A;  2FHX B;  2I7V A;  4ZO2 A;  4EXY A;  4YSL A;  4ZO3 A;  5ACV A;  2FU8 A;  2BGA A;  4DIK A;  4HKY A;  2YNV B;  5LE1 A;  1ZTC A;  4J5F A;  3SPU A;  4JO0 A;  4YSK A;  3X2Y A;  3DHB A;  4XWW A;  5ACQ A;  4C1E A;  5ACU A;  3I15 A;  2I7T A;  2DKF A;  5HIS A;  5AHR A;  4EYF A;  2YNW A;  1MQO A;  2E7Y A;  4O98 A;  3BK2 A;  1ZKP A;  1BC2 A;  1SML A;  3T3O A;  2NZF A;  3IE2 A;  4UWR B;  5A5Z A;  4TZE A;  3IE0 A;  5EVB A;  3DHC A;  4Z6X A;  2QIN A;  1X8I A;  4C09 A;  2GCU A;  5DPX A;  5AEB A;  5AXR A;  1YCG A;  2BIB A;  2I7X A;  2P4Z A;  4Z60 A;  2WYM C;  2H6A A;  3X2X A;  4C1C A;  1WUO A;  2AIO A;  3JXP A;  2M5D A;  2R2D A;  4GCW A;  4AWZ A;  3VQZ A;  1JJT A;  4EXS A;  4RAW A;  5LS3 A;  5ACW A;  3T3N A;  4YSB A;  2XR1 A;  3ZR9 A;  4D1W A;  3T9M A;  3H3E A;  2M5C A;  1KO2 A;  2WRS A;  2BTN A;  4KEQ A;  3SFP A;  4BZ3 A;  5FQB A;  4CHL A;  4C1G A;  2P18 A;  2FU9 A;  5LCF A;  2YCB A;  2XF4 A;  3I13 A;  3IEK A;  4C1F A;  2ZWR A;  2BG8 B;  2ZO4 A;  1HLK A;  1Y44 A;  3KNR A;  2BFZ A;  3IOG A;  1M2X A;  5A0T A;  4FR7 A;  3IEM A;  2P1E A;  1E5D A;  3Q6V A;  4UWS B;  2BG2 A;  4HL1 A;  1DDK A;  2GKL A;  3SRX A;  3WXC A;  4EFZ A;  3ESH A;  3ZQ4 A;  2YNV A;  3IOF A;  5HIO A;  5HIQ A;  5K0W A;  1WRA A;  1A8T A;  1WUP A;  2GFK A;  3G1P A;  1DXK A;  3X2Z A;  4F6H A;  5EHT A;  3I11 A;  4NQ2 A;  4TZF A;  2Q0I A;  3BC2 A;  4RAM A;  3I0V A;  5IQK A;  4KEP A;  2ZNB A;  4XWT A;  2UYX A;  3PY6 A;  3RKJ A;  5K4K A;  5LCH A;  5AXO A;  3X30 A;  4GYQ A;  3SW3 A;  3AJ3 A;  5EH9 A;  2Q42 A;  5ACP A;  2BFL A;  1YCF A;  3TP9 A;  5LMC A;  4D1V A;  2Q0J A;  4Z67 A;  3RKK A;  4TZ9 A;  2BFZ B;  2Y8B A;  4H0D A;  1P9E A;  4Z5Y A;  5FQA A;  3S0Z A;  3SD9 A;  2CBN A;  4ZNB A;  4RM5 A;  3ADR A;  4U4L A;  2NXA A;  2OHJ A;  3BK1 A;  2P97 A;  1VGN A;  4DIL A;  1X8G A;  3F9O A;  4FSB A;  4EYL A;  2FU6 A;  3P2U A;  3KL7 A;  3VPE A;  4UWP B;  4D1U A;  4AX1 B;  5LLD A;  5A0V A;  5AHO A;  5KIK A;  4D02 A;  4RL0 A;  3ZWF A;  4D1T A;  1A7T A;  1JT1 A;  4C1H A;  5EVD A;  4Z5Z A;  2YNU A;  4HL2 A;  2ZZI A;  5EW0 A;  3MD7 A;  1KO3 A;  2FK6 A;  4Z7R A;  2GMN A;  2BC2 A;  1BMC A;  5HH5 A;  5B3R A;  2BFK A;  5K4M A; 
#chains in the Genus database with same CATH topology
 2OHH A;  4NQ6 A;  1VJN A;  5A23 A;  2GFJ A;  4TYT A;  2QJS A;  3RPC A;  4C1D A;  3FCZ A;  2FM6 A;  1DD6 A;  4BP0 A;  1BVT A;  4V0H A;  4NUR A;  5LM6 A;  5ACS A;  4LE6 A;  2BR6 A;  2FHX A;  4PVO A;  3PY5 A;  5KIL A;  5EWA A;  4NQ5 A;  4AWY B;  2AZ4 A;  4XUK A;  5LSC A;  4EYB A;  2Y8A A;  3R2U A;  3IE1 A;  3L6N A;  4UA4 A;  3AF6 A;  2QED A;  3A4Y A;  1ZNB A;  3SBL A;  2NYP A;  5ACX A;  5EV6 A;  4J5H A;  5A87 A;  4F6Z A;  4TZB A;  2WYM A;  1JJE A;  5HH4 A;  4B87 A;  2WYL A;  3FAI A;  5LCA A;  2QDS A;  4UWO B;  5B15 A;  3PG4 A;  2BG7 A;  2CG2 A;  2NZE A;  5EVK A;  5AYA A;  2Y87 A;  2OHI A;  2CFZ A;  4EY2 A;  4AD9 A;  2BG6 A;  3I14 A;  2YNT B;  2Q9U A;  2FU7 A;  4RL2 A;  1K07 A;  1L9Y A;  2BMI A;  4NQ4 A;  2HB9 A;  3DHA A;  5B1U A;  4UAM A;  3IEL A;  5ACT A;  1VME A;  1X8H A;  4WD6 A;  5FQC A;  5HH6 A;  2A7M A;  5ACR A;  3KNS A;  4UBQ A;  4PVT A;  1KR3 A;  2DOO A;  4RBS A;  1WW1 A;  3IDZ A;  3AF5 A;  4FEK A;  5EV8 A;  3LVZ A;  1QH5 A;  2WHG A;  2BG8 A;  3BV6 A;  5K4N A;  4GYU A;  1XTO A;  4PDX A;  4TYF A;  3QH8 A;  1XM8 A;  3DH8 A;  3ZNB A;  2QDT A;  2YZ3 A;  2YNT A;  2VW8 A;  5HIP A;  4AX0 B;  4P62 A;  1YCH A;  1QH3 A;  4ZEJ A;  2FHX B;  2YHE A;  2I7V A;  4ZO2 A;  4EXY A;  4YSL A;  4ZO3 A;  5ACV A;  2FU8 A;  2BGA A;  4DIK A;  4HKY A;  2YNV B;  5LE1 A;  1ZTC A;  4J5F A;  3SPU A;  4JO0 A;  4YSK A;  3X2Y A;  3DHB A;  4XWW A;  5ACQ A;  4C1E A;  5ACU A;  3I15 A;  2I7T A;  2DKF A;  5HIS A;  5AHR A;  2CG3 A;  4EYF A;  2YNW A;  1MQO A;  2E7Y A;  4O98 A;  3BK2 A;  1ZKP A;  1BC2 A;  1SML A;  3T3O A;  2NZF A;  3IE2 A;  4UWR B;  5A5Z A;  4TZE A;  3IE0 A;  5EVB A;  3DHC A;  4Z6X A;  2QIN A;  1X8I A;  4C09 A;  2GCU A;  5DPX A;  5AEB A;  5AXR A;  1YCG A;  2BIB A;  2I7X A;  2P4Z A;  4Z60 A;  2WYM C;  2H6A A;  3X2X A;  4C1C A;  1WUO A;  2AIO A;  3JXP A;  2M5D A;  2R2D A;  4GCW A;  4AWZ A;  3VQZ A;  1JJT A;  4EXS A;  4RAW A;  5LS3 A;  5ACW A;  3T3N A;  4YSB A;  2XR1 A;  3ZR9 A;  4D1W A;  3T9M A;  3H3E A;  2M5C A;  1KO2 A;  2WRS A;  2BTN A;  4KEQ A;  3SFP A;  4BZ3 A;  5FQB A;  4CHL A;  4C1G A;  2P18 A;  2FU9 A;  5LCF A;  2YCB A;  2XF4 A;  3I13 A;  3IEK A;  4C1F A;  2ZWR A;  2BG8 B;  2ZO4 A;  1HLK A;  1Y44 A;  3KNR A;  2BFZ A;  3IOG A;  1M2X A;  5A0T A;  4FR7 A;  3IEM A;  2P1E A;  1E5D A;  3Q6V A;  4UWS B;  4AV7 A;  2BG2 A;  4HL1 A;  1DDK A;  2GKL A;  3SRX A;  3WXC A;  4EFZ A;  3ESH A;  3ZQ4 A;  2YNV A;  3IOF A;  5HIO A;  5HIQ A;  5K0W A;  1WRA A;  1A8T A;  1WUP A;  2GFK A;  3G1P A;  1DXK A;  3X2Z A;  4F6H A;  5EHT A;  3I11 A;  4NQ2 A;  4TZF A;  2Q0I A;  3BC2 A;  4RAM A;  3I0V A;  2CFU A;  5IQK A;  4KEP A;  4AXH A;  2ZNB A;  4XWT A;  2UYX A;  3PY6 A;  3RKJ A;  5K4K A;  5LCH A;  5AXO A;  3X30 A;  4GYQ A;  3SW3 A;  3AJ3 A;  5EH9 A;  2Q42 A;  5ACP A;  5AIJ A;  2BFL A;  1YCF A;  3TP9 A;  5LMC A;  4D1V A;  2Q0J A;  4Z67 A;  3RKK A;  4TZ9 A;  2BFZ B;  2Y8B A;  4H0D A;  1P9E A;  4Z5Y A;  5FQA A;  3S0Z A;  3SD9 A;  2CBN A;  4ZNB A;  4RM5 A;  3ADR A;  4U4L A;  2NXA A;  2OHJ A;  3BK1 A;  2P97 A;  1VGN A;  4DIL A;  1X8G A;  3F9O A;  4FSB A;  4EYL A;  2FU6 A;  3P2U A;  3KL7 A;  3VPE A;  4UWP B;  4D1U A;  4AX1 B;  5LLD A;  5A0V A;  5AHO A;  5KIK A;  4D02 A;  4RL0 A;  3ZWF A;  4D1T A;  1A7T A;  1JT1 A;  5AJL A;  4C1H A;  5EVD A;  4Z5Z A;  2YNU A;  4HL2 A;  2ZZI A;  5EW0 A;  3MD7 A;  1KO3 A;  2FK6 A;  4Z7R A;  2GMN A;  2BC2 A;  1BMC A;  5HH5 A;  5B3R A;  2BFK A;  5K4M A; 
#chains in the Genus database with same CATH homology
 2OHH A;  4NQ6 A;  1VJN A;  2GFJ A;  4TYT A;  2QJS A;  3RPC A;  4C1D A;  3FCZ A;  2FM6 A;  1DD6 A;  4BP0 A;  1BVT A;  4V0H A;  5LM6 A;  5ACS A;  4LE6 A;  2BR6 A;  2FHX A;  4PVO A;  5KIL A;  3PY5 A;  5EWA A;  4NQ5 A;  4AWY B;  2AZ4 A;  4XUK A;  5LSC A;  4EYB A;  2Y8A A;  3R2U A;  3IE1 A;  3L6N A;  4UA4 A;  3AF6 A;  2QED A;  3A4Y A;  1ZNB A;  3SBL A;  2NYP A;  5ACX A;  5EV6 A;  4J5H A;  5A87 A;  4F6Z A;  4TZB A;  2WYM A;  1JJE A;  5HH4 A;  4B87 A;  2WYL A;  3FAI A;  5LCA A;  2QDS A;  4UWO B;  5B15 A;  3PG4 A;  2BG7 A;  2NZE A;  5EVK A;  5AYA A;  2Y87 A;  2OHI A;  4EY2 A;  4AD9 A;  2BG6 A;  3I14 A;  2YNT B;  2Q9U A;  2FU7 A;  4RL2 A;  1K07 A;  1L9Y A;  2BMI A;  4NQ4 A;  2HB9 A;  3DHA A;  5B1U A;  4UAM A;  3IEL A;  5ACT A;  1VME A;  1X8H A;  4WD6 A;  5FQC A;  5HH6 A;  2A7M A;  5ACR A;  3KNS A;  4UBQ A;  4PVT A;  1KR3 A;  2DOO A;  4RBS A;  1WW1 A;  3IDZ A;  3AF5 A;  4FEK A;  5EV8 A;  3LVZ A;  1QH5 A;  2WHG A;  2BG8 A;  3BV6 A;  5K4N A;  4GYU A;  1XTO A;  4TYF A;  3QH8 A;  1XM8 A;  3DH8 A;  3ZNB A;  2QDT A;  2YZ3 A;  2YNT A;  2VW8 A;  5HIP A;  4AX0 B;  4P62 A;  1YCH A;  1QH3 A;  4ZEJ A;  2FHX B;  2I7V A;  4ZO2 A;  4EXY A;  4YSL A;  4ZO3 A;  5ACV A;  2FU8 A;  2BGA A;  4DIK A;  4HKY A;  2YNV B;  5LE1 A;  1ZTC A;  4J5F A;  3SPU A;  4JO0 A;  4YSK A;  3X2Y A;  3DHB A;  4XWW A;  5ACQ A;  4C1E A;  5ACU A;  3I15 A;  2I7T A;  2DKF A;  5HIS A;  5AHR A;  4EYF A;  2YNW A;  1MQO A;  2E7Y A;  4O98 A;  3BK2 A;  1ZKP A;  1BC2 A;  1SML A;  3T3O A;  2NZF A;  3IE2 A;  4UWR B;  5A5Z A;  4TZE A;  3IE0 A;  5EVB A;  3DHC A;  4Z6X A;  2QIN A;  1X8I A;  4C09 A;  2GCU A;  5DPX A;  5AEB A;  5AXR A;  1YCG A;  2BIB A;  2I7X A;  2P4Z A;  4Z60 A;  2WYM C;  2H6A A;  3X2X A;  4C1C A;  1WUO A;  2AIO A;  3JXP A;  2M5D A;  2R2D A;  4GCW A;  4AWZ A;  3VQZ A;  1JJT A;  4EXS A;  4RAW A;  5LS3 A;  5ACW A;  3T3N A;  4YSB A;  2XR1 A;  3ZR9 A;  4D1W A;  3T9M A;  3H3E A;  2M5C A;  1KO2 A;  2WRS A;  2BTN A;  4KEQ A;  3SFP A;  4BZ3 A;  5FQB A;  4CHL A;  4C1G A;  2P18 A;  2FU9 A;  5LCF A;  2YCB A;  2XF4 A;  3I13 A;  3IEK A;  4C1F A;  2ZWR A;  2BG8 B;  2ZO4 A;  1HLK A;  1Y44 A;  3KNR A;  2BFZ A;  3IOG A;  1M2X A;  5A0T A;  4FR7 A;  3IEM A;  2P1E A;  1E5D A;  3Q6V A;  4UWS B;  2BG2 A;  4HL1 A;  1DDK A;  2GKL A;  3SRX A;  3WXC A;  4EFZ A;  3ESH A;  3ZQ4 A;  2YNV A;  3IOF A;  5HIO A;  5HIQ A;  5K0W A;  1WRA A;  1A8T A;  1WUP A;  2GFK A;  3G1P A;  1DXK A;  3X2Z A;  4F6H A;  5EHT A;  3I11 A;  4NQ2 A;  4TZF A;  2Q0I A;  3BC2 A;  4RAM A;  3I0V A;  5IQK A;  4KEP A;  2ZNB A;  4XWT A;  2UYX A;  3PY6 A;  3RKJ A;  5K4K A;  5LCH A;  5AXO A;  3X30 A;  4GYQ A;  3SW3 A;  3AJ3 A;  5EH9 A;  2Q42 A;  5ACP A;  2BFL A;  1YCF A;  3TP9 A;  5LMC A;  4D1V A;  2Q0J A;  4Z67 A;  3RKK A;  4TZ9 A;  2BFZ B;  2Y8B A;  4H0D A;  1P9E A;  4Z5Y A;  5FQA A;  3S0Z A;  3SD9 A;  2CBN A;  4ZNB A;  4RM5 A;  3ADR A;  4U4L A;  2NXA A;  2OHJ A;  3BK1 A;  2P97 A;  1VGN A;  4DIL A;  1X8G A;  3F9O A;  4FSB A;  4EYL A;  2FU6 A;  3P2U A;  3KL7 A;  3VPE A;  4UWP B;  4D1U A;  4AX1 B;  5LLD A;  5A0V A;  5AHO A;  5KIK A;  4D02 A;  4RL0 A;  3ZWF A;  4D1T A;  1A7T A;  1JT1 A;  4C1H A;  5EVD A;  4Z5Z A;  2YNU A;  4HL2 A;  2ZZI A;  5EW0 A;  3MD7 A;  1KO3 A;  2FK6 A;  4Z7R A;  2GMN A;  2BC2 A;  1BMC A;  5HH5 A;  5B3R A;  2BFK A;  5K4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...