5AYAA

Crystal structure of metallo-beta-lactamase smb-1 bound to l-captopril
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
259
structure length
259
Chain Sequence
RDWSSPQQPFTIYGNTHYVGTGGISAVLLSSPQGHILVDGTTEKGAQVVAANIRAMGFKLSDVKYILSTHSHEDHAGGISAMQKLTGATVLAGAANVDTLRTGVSPKSDPQFGSLSNFPGSAKVRAVADGELVKLGPLAVKAHATPGHTEGGITWTWQSCEQGKCKDVVFADSLTAVSADSYRFSDHPEVVASLRGSFEAVEKLSCDIAIAAHPEVNDMWTRQQRAAKEGNSAYVDNGACRAIAAAGRKRLETRLASEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metallo-beta-lactamase
publication title Crystal Structure of Metallo-beta-Lactamase SMB-1 Bound to L-captopril
rcsb
source organism Serratia marcescens
molecule tags Hydrolase
total genus 84
structure length 259
sequence length 259
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5ayaA00
1E5DA 4C1EA 1VJNA 2Y8AA 4UBQA 4EXYA 2BG6A 4RM5A 4EYBA 3SPUA 3IOFA 2BIBA 1DXKA 5LSCA 2YNUA 4YSLA 3I14A 5LS3A 2P1EA 5AYAA 5HIQA 4D1UA 1P9EA 4Z7RA 4UWRB 2ZWRA 5EV8A 4HL1A 5AXOA 3BV6A 2YCBA 5A87A 5ACTA 2WHGA 2YNTB 3X2XA 4NQ5A 1BVTA 4O98A 3T3NA 5B3RA 5KILA 4TZ9A 4PVOA 5ACXA 2UYXA 2YNVA 4YSKA 5EVKA 4ZEJA 4AWYB 3ADRA 4C1GA 4EFZA 2AZ4A 1SMLA 3IDZA 3ZNBA 1ZNBA 4NQ2A 2BG7A 5ACPA 4Z60A 2NYPA 5EHTA 4GYQA 3S0ZA 3DHCA 4C1HA 2BMIA 4EYFA 3I0VA 4Z5YA 1WW1A 5HIOA 5ACUA 3AJ3A 5A0TA 1KO2A 4KEPA 4ZNBA 3RKJA 1JJEA 2ZNBA 5EVBA 4BZ3A 3F9OA 4UAMA 3SFPA 3IE2A 4NQ6A 3DHAA 4RL2A 5LCHA 4TZEA 3RKKA 2FHXB 4F6HA 1QH5A 1BC2A 4AD9A 4RBSA 2I7TA 4Z5ZA 2I7XA 4AX0B 1QH3A 2XF4A 3ESHA 3X2ZA 2BR6A 3Q6VA 2BFKA 5AEBA 2GMNA 4C1FA 4ZO2A 2FK6A 3WXCA 4Z6XA 5ACRA 5A0VA 2OHJA 5ACSA 1ZKPA 1DDKA 2I7VA 3VPEA 3IEKA 3X30A 2Y87A 1M2XA 5B1UA 5LM6A 2QEDA 4TZFA 2BG2A 5HIPA 4TYTA 5LCAA 3DH8A 3I11A 4LE6A 5LCFA 2DOOA 3MD7A 3TP9A 2WRSA 1ZTCA 3JXPA 1A8TA 2NZFA 2BC2A 2CBNA 2ZO4A 3PY6A 3IE1A 3ZR9A 5EW0A 4GCWA 2M5CA 4FR7A 3P2UA 4C1DA 4KEQA 2QDTA 2YNVB 3VQZA 4CHLA 2BFZA 5K4MA 3BK2A 2BFLA 4H0DA 5AHOA 1X8IA 1WRAA 4PVTA 2BGAA 3QH8A 4DILA 4AX1B 1YCGA 2VW8A 5FQBA 2E7YA 2FU9A 2OHIA 5A5ZA 2P4ZA 3AF6A 4GYUA 2DKFA 3I15A 4UWSB 2FU6A 2OHHA 4TYFA 5EVDA 2FU7A 2BG8A 2H6AA 4UWPB 4XWTA 1BMCA 4AWZA 4XUKA 5EWAA 4RL0A 2AIOA 4RAWA 3L6NA 3IOGA 5LLDA 2ZZIA 3ZWFA 3H3EA 2R2DA 4BP0A 5HH5A 4TZBA 3A4YA 3SW3A 1X8GA 5IQKA 5EV6A 3FAIA 5HISA 3R2UA 4B87A 2GCUA 2GFJA 3KNSA 2XR1A 4EY2A 4RAMA 1KO3A 1K07A 2QJSA 1HLKA 5KIKA 3FCZA 4UA4A 1JT1A 4D02A 2GKLA 3AF5A 3SBLA 5AHRA 3RPCA 1DD6A 5DPXA 5LMCA 4Z67A 2HB9A 4HKYA 1YCHA 4FEKA 3IELA 2WYMC 2BTNA 3G1PA 1XTOA 3SD9A 4V0HA 5HH6A 3LVZA 4DIKA 5LE1A 4D1WA 4C1CA 3KNRA 3T9MA 1X8HA 5ACWA 3IEMA 3SRXA 2BFZB 2NXAA 4FSBA 3KL7A 3I13A 2P97A 5AXRA 1JJTA 4J5FA 4JO0A 2NZEA 4WD6A 1KR3A 2Q0IA 2YNTA 4EYLA 5K0WA 2P18A 4U4LA 2FU8A 2WYLA 2Q9UA 4EXSA 3PY5A 3DHBA 5HH4A 3ZQ4A 2FM6A 3PG4A 4C09A 2BG8B 1YCFA 2QINA 1MQOA 5FQAA 2Y8BA 3BK1A 1L9YA 4F6ZA 1VMEA 4P62A 4NQ4A 3X2YA 1A7TA 5ACQA 2A7MA 2GFKA 2YZ3A 2Q0JA 3BC2A 5K4KA 4ZO3A 4XWWA 4J5HA 1WUOA 4UWOB 4YSBA 5B15A 1VGNA 5FQCA 5EH9A 1Y44A 4D1TA 3IE0A 5ACVA 2Q42A 1XM8A 4HL2A 4D1VA 2YNWA 3T3OA 2QDSA 2WYMA 1WUPA 5K4NA 2FHXA 2M5DA
chains in the Genus database with same CATH superfamily
1E5DA 4C1EA 1VJNA 2Y8AA 4UBQA 4EXYA 2BG6A 4RM5A 4EYBA 3SPUA 3IOFA 2BIBA 1DXKA 5LSCA 2YNUA 4YSLA 3I14A 5LS3A 2P1EA 5AYAA 5HIQA 4D1UA 1P9EA 4Z7RA 4UWRB 2ZWRA 5EV8A 2YHEA 4HL1A 5AXOA 3BV6A 2YCBA 5A87A 5AJLA 5ACTA 2WHGA 2YNTB 3X2XA 4NQ5A 1BVTA 4O98A 3T3NA 5B3RA 5KILA 4TZ9A 4PVOA 4AV7A 5ACXA 2UYXA 2YNVA 4YSKA 5EVKA 4ZEJA 4AWYB 3ADRA 4C1GA 4EFZA 2AZ4A 1SMLA 3IDZA 3ZNBA 1ZNBA 4NQ2A 2BG7A 5ACPA 4Z60A 2NYPA 5EHTA 4GYQA 3S0ZA 3DHCA 4C1HA 2BMIA 4EYFA 3I0VA 4Z5YA 1WW1A 5HIOA 4PDXA 5ACUA 3AJ3A 5A0TA 1KO2A 4KEPA 4ZNBA 3RKJA 1JJEA 2ZNBA 5EVBA 4BZ3A 3F9OA 4UAMA 3SFPA 3IE2A 4NQ6A 3DHAA 4RL2A 5LCHA 4TZEA 3RKKA 2FHXB 4F6HA 1QH5A 1BC2A 4AD9A 4RBSA 2I7TA 4Z5ZA 2I7XA 4AX0B 1QH3A 2CG2A 2XF4A 3ESHA 3X2ZA 2BR6A 3Q6VA 2BFKA 5AEBA 2GMNA 4C1FA 4ZO2A 2FK6A 3WXCA 4Z6XA 5ACRA 5A0VA 2OHJA 5ACSA 1ZKPA 1DDKA 2I7VA 3VPEA 3IEKA 3X30A 2Y87A 1M2XA 5B1UA 5LM6A 2QEDA 4TZFA 2BG2A 5HIPA 4TYTA 5LCAA 3DH8A 3I11A 4LE6A 5LCFA 2CFZA 2DOOA 3MD7A 3TP9A 2WRSA 1ZTCA 3JXPA 1A8TA 2NZFA 2BC2A 2CBNA 2ZO4A 4NURA 3PY6A 3IE1A 3ZR9A 5EW0A 4GCWA 2M5CA 4FR7A 3P2UA 4C1DA 4KEQA 2QDTA 2YNVB 3VQZA 4CHLA 2BFZA 5K4MA 3BK2A 2BFLA 4H0DA 5AHOA 1X8IA 1WRAA 4PVTA 2BGAA 3QH8A 4DILA 4AX1B 1YCGA 2VW8A 5FQBA 2E7YA 2FU9A 2OHIA 5A5ZA 2P4ZA 3AF6A 2CFUA 4GYUA 2DKFA 3I15A 4UWSB 2FU6A 2OHHA 4AXHA 4TYFA 5EVDA 2FU7A 2BG8A 2H6AA 4UWPB 4XWTA 1BMCA 2CG3A 4XUKA 5EWAA 4AWZA 4RL0A 2AIOA 4RAWA 3L6NA 3IOGA 5LLDA 2ZZIA 3ZWFA 3H3EA 2R2DA 4BP0A 5HH5A 4TZBA 3A4YA 3SW3A 1X8GA 5IQKA 5EV6A 3FAIA 5HISA 3R2UA 4B87A 2GCUA 2GFJA 3KNSA 2XR1A 4EY2A 4RAMA 1KO3A 1K07A 2QJSA 1HLKA 5KIKA 3FCZA 4UA4A 1JT1A 4D02A 2GKLA 3AF5A 3SBLA 5AHRA 3RPCA 1DD6A 5DPXA 5LMCA 4Z67A 2HB9A 4HKYA 1YCHA 4FEKA 3IELA 2WYMC 5AIJA 2BTNA 3G1PA 1XTOA 3SD9A 4V0HA 5HH6A 3LVZA 4DIKA 5LE1A 4D1WA 4C1CA 3KNRA 3T9MA 1X8HA 5ACWA 3IEMA 3SRXA 2BFZB 2NXAA 4FSBA 3KL7A 5A23A 3I13A 2P97A 5AXRA 1JJTA 4J5FA 4JO0A 2NZEA 4WD6A 1KR3A 2Q0IA 2YNTA 4EYLA 5K0WA 2P18A 4U4LA 2FU8A 2WYLA 2Q9UA 4EXSA 3PY5A 3DHBA 5HH4A 3ZQ4A 2FM6A 3PG4A 4C09A 2BG8B 1YCFA 2QINA 1MQOA 5FQAA 2Y8BA 3BK1A 1L9YA 4F6ZA 1VMEA 4P62A 4NQ4A 3X2YA 1A7TA 5ACQA 2A7MA 2GFKA 2YZ3A 2Q0JA 3BC2A 5K4KA 4ZO3A 4XWWA 4J5HA 1WUOA 4UWOB 4YSBA 5B15A 1VGNA 5FQCA 5EH9A 1Y44A 4D1TA 3IE0A 5ACVA 2Q42A 1XM8A 4HL2A 4D1VA 2YNWA 3T3OA 2QDSA 2WYMA 1WUPA 5K4NA 2FHXA 2M5DA
chains in the Genus database with same CATH topology
1E5DA 4C1EA 1VJNA 2Y8AA 4UBQA 4EXYA 2BG6A 4RM5A 4EYBA 3SPUA 3IOFA 2BIBA 1DXKA 5LSCA 2YNUA 4YSLA 3I14A 5LS3A 2P1EA 5AYAA 5HIQA 4D1UA 1P9EA 4Z7RA 4UWRB 2ZWRA 5EV8A 4HL1A 5AXOA 3BV6A 2YCBA 5A87A 5ACTA 2WHGA 2YNTB 3X2XA 4NQ5A 1BVTA 4O98A 3T3NA 5B3RA 5KILA 4TZ9A 4PVOA 5ACXA 2UYXA 2YNVA 4YSKA 5EVKA 4ZEJA 4AWYB 3ADRA 4C1GA 4EFZA 2AZ4A 1SMLA 3IDZA 3ZNBA 1ZNBA 4NQ2A 2BG7A 5ACPA 4Z60A 2NYPA 5EHTA 4GYQA 3S0ZA 3DHCA 4C1HA 2BMIA 4EYFA 3I0VA 4Z5YA 1WW1A 5HIOA 5ACUA 3AJ3A 5A0TA 1KO2A 4KEPA 4ZNBA 3RKJA 1JJEA 2ZNBA 5EVBA 4BZ3A 3F9OA 4UAMA 3SFPA 3IE2A 4NQ6A 3DHAA 4RL2A 5LCHA 4TZEA 3RKKA 2FHXB 4F6HA 1QH5A 1BC2A 4AD9A 4RBSA 2I7TA 4Z5ZA 2I7XA 4AX0B 1QH3A 2XF4A 3ESHA 3X2ZA 2BR6A 3Q6VA 2BFKA 5AEBA 2GMNA 4C1FA 4ZO2A 2FK6A 3WXCA 4Z6XA 5ACRA 5A0VA 2OHJA 5ACSA 1ZKPA 1DDKA 2I7VA 3VPEA 3IEKA 3X30A 2Y87A 1M2XA 5B1UA 5LM6A 2QEDA 4TZFA 2BG2A 5HIPA 4TYTA 5LCAA 3DH8A 3I11A 4LE6A 5LCFA 2DOOA 3MD7A 3TP9A 2WRSA 1ZTCA 3JXPA 1A8TA 2NZFA 2BC2A 2CBNA 2ZO4A 3PY6A 3IE1A 3ZR9A 5EW0A 4GCWA 2M5CA 4FR7A 3P2UA 4C1DA 4KEQA 2QDTA 2YNVB 3VQZA 4CHLA 2BFZA 5K4MA 3BK2A 2BFLA 4H0DA 5AHOA 1X8IA 1WRAA 4PVTA 2BGAA 3QH8A 4DILA 4AX1B 1YCGA 2VW8A 5FQBA 2E7YA 2FU9A 2OHIA 5A5ZA 2P4ZA 3AF6A 4GYUA 2DKFA 3I15A 4UWSB 2FU6A 2OHHA 4TYFA 5EVDA 2FU7A 2BG8A 2H6AA 4UWPB 4XWTA 1BMCA 4AWZA 4XUKA 5EWAA 4RL0A 2AIOA 4RAWA 3L6NA 3IOGA 5LLDA 2ZZIA 3ZWFA 3H3EA 2R2DA 4BP0A 5HH5A 4TZBA 3A4YA 3SW3A 1X8GA 5IQKA 5EV6A 3FAIA 5HISA 3R2UA 4B87A 2GCUA 2GFJA 3KNSA 2XR1A 4EY2A 4RAMA 1KO3A 1K07A 2QJSA 1HLKA 5KIKA 3FCZA 4UA4A 1JT1A 4D02A 2GKLA 3AF5A 3SBLA 5AHRA 3RPCA 1DD6A 5DPXA 5LMCA 4Z67A 2HB9A 4HKYA 1YCHA 4FEKA 3IELA 2WYMC 2BTNA 3G1PA 1XTOA 3SD9A 4V0HA 5HH6A 3LVZA 4DIKA 5LE1A 4D1WA 4C1CA 3KNRA 3T9MA 1X8HA 5ACWA 3IEMA 3SRXA 2BFZB 2NXAA 4FSBA 3KL7A 3I13A 2P97A 5AXRA 1JJTA 4J5FA 4JO0A 2NZEA 4WD6A 1KR3A 2Q0IA 2YNTA 4EYLA 5K0WA 2P18A 4U4LA 2FU8A 2WYLA 2Q9UA 4EXSA 3PY5A 3DHBA 5HH4A 3ZQ4A 2FM6A 3PG4A 4C09A 2BG8B 1YCFA 2QINA 1MQOA 5FQAA 2Y8BA 3BK1A 1L9YA 4F6ZA 1VMEA 4P62A 4NQ4A 3X2YA 1A7TA 5ACQA 2A7MA 2GFKA 2YZ3A 2Q0JA 3BC2A 5K4KA 4ZO3A 4XWWA 4J5HA 1WUOA 4UWOB 4YSBA 5B15A 1VGNA 5FQCA 5EH9A 1Y44A 4D1TA 3IE0A 5ACVA 2Q42A 1XM8A 4HL2A 4D1VA 2YNWA 3T3OA 2QDSA 2WYMA 1WUPA 5K4NA 2FHXA 2M5DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E5D A;  4C1E A;  1VJN A;  2Y8A A;  4UBQ A;  4EXY A;  2BG6 A;  4RM5 A;  4EYB A;  3SPU A;  3IOF A;  2BIB A;  1DXK A;  5LSC A;  2YNU A;  4YSL A;  3I14 A;  5LS3 A;  2P1E A;  5AYA A;  5HIQ A;  4D1U A;  1P9E A;  4Z7R A;  4UWR B;  2ZWR A;  5EV8 A;  4HL1 A;  5AXO A;  3BV6 A;  2YCB A;  5A87 A;  5ACT A;  2WHG A;  2YNT B;  3X2X A;  4NQ5 A;  1BVT A;  4O98 A;  3T3N A;  5B3R A;  5KIL A;  4TZ9 A;  4PVO A;  5ACX A;  2UYX A;  2YNV A;  4YSK A;  5EVK A;  4ZEJ A;  4AWY B;  3ADR A;  4C1G A;  4EFZ A;  2AZ4 A;  1SML A;  3IDZ A;  3ZNB A;  1ZNB A;  4NQ2 A;  2BG7 A;  5ACP A;  4Z60 A;  2NYP A;  5EHT A;  4GYQ A;  3S0Z A;  3DHC A;  4C1H A;  2BMI A;  4EYF A;  3I0V A;  4Z5Y A;  1WW1 A;  5HIO A;  5ACU A;  3AJ3 A;  5A0T A;  1KO2 A;  4KEP A;  4ZNB A;  3RKJ A;  1JJE A;  2ZNB A;  5EVB A;  4BZ3 A;  3F9O A;  4UAM A;  3SFP A;  3IE2 A;  4NQ6 A;  3DHA A;  4RL2 A;  5LCH A;  4TZE A;  3RKK A;  2FHX B;  4F6H A;  1QH5 A;  1BC2 A;  4AD9 A;  4RBS A;  2I7T A;  4Z5Z A;  2I7X A;  4AX0 B;  1QH3 A;  2XF4 A;  3ESH A;  3X2Z A;  2BR6 A;  3Q6V A;  2BFK A;  5AEB A;  2GMN A;  4C1F A;  4ZO2 A;  2FK6 A;  3WXC A;  4Z6X A;  5ACR A;  5A0V A;  2OHJ A;  5ACS A;  1ZKP A;  1DDK A;  2I7V A;  3VPE A;  3IEK A;  3X30 A;  2Y87 A;  1M2X A;  5B1U A;  5LM6 A;  2QED A;  4TZF A;  2BG2 A;  5HIP A;  4TYT A;  5LCA A;  3DH8 A;  3I11 A;  4LE6 A;  5LCF A;  2DOO A;  3MD7 A;  3TP9 A;  2WRS A;  1ZTC A;  3JXP A;  1A8T A;  2NZF A;  2BC2 A;  2CBN A;  2ZO4 A;  3PY6 A;  3IE1 A;  3ZR9 A;  5EW0 A;  4GCW A;  2M5C A;  4FR7 A;  3P2U A;  4C1D A;  4KEQ A;  2QDT A;  2YNV B;  3VQZ A;  4CHL A;  2BFZ A;  5K4M A;  3BK2 A;  2BFL A;  4H0D A;  5AHO A;  1X8I A;  1WRA A;  4PVT A;  2BGA A;  3QH8 A;  4DIL A;  4AX1 B;  1YCG A;  2VW8 A;  5FQB A;  2E7Y A;  2FU9 A;  2OHI A;  5A5Z A;  2P4Z A;  3AF6 A;  4GYU A;  2DKF A;  3I15 A;  4UWS B;  2FU6 A;  2OHH A;  4TYF A;  5EVD A;  2FU7 A;  2BG8 A;  2H6A A;  4UWP B;  4XWT A;  1BMC A;  4AWZ A;  4XUK A;  5EWA A;  4RL0 A;  2AIO A;  4RAW A;  3L6N A;  3IOG A;  5LLD A;  2ZZI A;  3ZWF A;  3H3E A;  2R2D A;  4BP0 A;  5HH5 A;  4TZB A;  3A4Y A;  3SW3 A;  1X8G A;  5IQK A;  5EV6 A;  3FAI A;  5HIS A;  3R2U A;  4B87 A;  2GCU A;  2GFJ A;  3KNS A;  2XR1 A;  4EY2 A;  4RAM A;  1KO3 A;  1K07 A;  2QJS A;  1HLK A;  5KIK A;  3FCZ A;  4UA4 A;  1JT1 A;  4D02 A;  2GKL A;  3AF5 A;  3SBL A;  5AHR A;  3RPC A;  1DD6 A;  5DPX A;  5LMC A;  4Z67 A;  2HB9 A;  4HKY A;  1YCH A;  4FEK A;  3IEL A;  2WYM C;  2BTN A;  3G1P A;  1XTO A;  3SD9 A;  4V0H A;  5HH6 A;  3LVZ A;  4DIK A;  5LE1 A;  4D1W A;  4C1C A;  3KNR A;  3T9M A;  1X8H A;  5ACW A;  3IEM A;  3SRX A;  2BFZ B;  2NXA A;  4FSB A;  3KL7 A;  3I13 A;  2P97 A;  5AXR A;  1JJT A;  4J5F A;  4JO0 A;  2NZE A;  4WD6 A;  1KR3 A;  2Q0I A;  2YNT A;  4EYL A;  5K0W A;  2P18 A;  4U4L A;  2FU8 A;  2WYL A;  2Q9U A;  4EXS A;  3PY5 A;  3DHB A;  5HH4 A;  3ZQ4 A;  2FM6 A;  3PG4 A;  4C09 A;  2BG8 B;  1YCF A;  2QIN A;  1MQO A;  5FQA A;  2Y8B A;  3BK1 A;  1L9Y A;  4F6Z A;  1VME A;  4P62 A;  4NQ4 A;  3X2Y A;  1A7T A;  5ACQ A;  2A7M A;  2GFK A;  2YZ3 A;  2Q0J A;  3BC2 A;  5K4K A;  4ZO3 A;  4XWW A;  4J5H A;  1WUO A;  4UWO B;  4YSB A;  5B15 A;  1VGN A;  5FQC A;  5EH9 A;  1Y44 A;  4D1T A;  3IE0 A;  5ACV A;  2Q42 A;  1XM8 A;  4HL2 A;  4D1V A;  2YNW A;  3T3O A;  2QDS A;  2WYM A;  1WUP A;  5K4N A;  2FHX A;  2M5D A; 
#chains in the Genus database with same CATH topology
 1E5D A;  4C1E A;  1VJN A;  2Y8A A;  4UBQ A;  4EXY A;  2BG6 A;  4RM5 A;  4EYB A;  3SPU A;  3IOF A;  2BIB A;  1DXK A;  5LSC A;  2YNU A;  4YSL A;  3I14 A;  5LS3 A;  2P1E A;  5AYA A;  5HIQ A;  4D1U A;  1P9E A;  4Z7R A;  4UWR B;  2ZWR A;  5EV8 A;  2YHE A;  4HL1 A;  5AXO A;  3BV6 A;  2YCB A;  5A87 A;  5AJL A;  5ACT A;  2WHG A;  2YNT B;  3X2X A;  4NQ5 A;  1BVT A;  4O98 A;  3T3N A;  5B3R A;  5KIL A;  4TZ9 A;  4PVO A;  4AV7 A;  5ACX A;  2UYX A;  2YNV A;  4YSK A;  5EVK A;  4ZEJ A;  4AWY B;  3ADR A;  4C1G A;  4EFZ A;  2AZ4 A;  1SML A;  3IDZ A;  3ZNB A;  1ZNB A;  4NQ2 A;  2BG7 A;  5ACP A;  4Z60 A;  2NYP A;  5EHT A;  4GYQ A;  3S0Z A;  3DHC A;  4C1H A;  2BMI A;  4EYF A;  3I0V A;  4Z5Y A;  1WW1 A;  5HIO A;  4PDX A;  5ACU A;  3AJ3 A;  5A0T A;  1KO2 A;  4KEP A;  4ZNB A;  3RKJ A;  1JJE A;  2ZNB A;  5EVB A;  4BZ3 A;  3F9O A;  4UAM A;  3SFP A;  3IE2 A;  4NQ6 A;  3DHA A;  4RL2 A;  5LCH A;  4TZE A;  3RKK A;  2FHX B;  4F6H A;  1QH5 A;  1BC2 A;  4AD9 A;  4RBS A;  2I7T A;  4Z5Z A;  2I7X A;  4AX0 B;  1QH3 A;  2CG2 A;  2XF4 A;  3ESH A;  3X2Z A;  2BR6 A;  3Q6V A;  2BFK A;  5AEB A;  2GMN A;  4C1F A;  4ZO2 A;  2FK6 A;  3WXC A;  4Z6X A;  5ACR A;  5A0V A;  2OHJ A;  5ACS A;  1ZKP A;  1DDK A;  2I7V A;  3VPE A;  3IEK A;  3X30 A;  2Y87 A;  1M2X A;  5B1U A;  5LM6 A;  2QED A;  4TZF A;  2BG2 A;  5HIP A;  4TYT A;  5LCA A;  3DH8 A;  3I11 A;  4LE6 A;  5LCF A;  2CFZ A;  2DOO A;  3MD7 A;  3TP9 A;  2WRS A;  1ZTC A;  3JXP A;  1A8T A;  2NZF A;  2BC2 A;  2CBN A;  2ZO4 A;  4NUR A;  3PY6 A;  3IE1 A;  3ZR9 A;  5EW0 A;  4GCW A;  2M5C A;  4FR7 A;  3P2U A;  4C1D A;  4KEQ A;  2QDT A;  2YNV B;  3VQZ A;  4CHL A;  2BFZ A;  5K4M A;  3BK2 A;  2BFL A;  4H0D A;  5AHO A;  1X8I A;  1WRA A;  4PVT A;  2BGA A;  3QH8 A;  4DIL A;  4AX1 B;  1YCG A;  2VW8 A;  5FQB A;  2E7Y A;  2FU9 A;  2OHI A;  5A5Z A;  2P4Z A;  3AF6 A;  2CFU A;  4GYU A;  2DKF A;  3I15 A;  4UWS B;  2FU6 A;  2OHH A;  4AXH A;  4TYF A;  5EVD A;  2FU7 A;  2BG8 A;  2H6A A;  4UWP B;  4XWT A;  1BMC A;  2CG3 A;  4XUK A;  5EWA A;  4AWZ A;  4RL0 A;  2AIO A;  4RAW A;  3L6N A;  3IOG A;  5LLD A;  2ZZI A;  3ZWF A;  3H3E A;  2R2D A;  4BP0 A;  5HH5 A;  4TZB A;  3A4Y A;  3SW3 A;  1X8G A;  5IQK A;  5EV6 A;  3FAI A;  5HIS A;  3R2U A;  4B87 A;  2GCU A;  2GFJ A;  3KNS A;  2XR1 A;  4EY2 A;  4RAM A;  1KO3 A;  1K07 A;  2QJS A;  1HLK A;  5KIK A;  3FCZ A;  4UA4 A;  1JT1 A;  4D02 A;  2GKL A;  3AF5 A;  3SBL A;  5AHR A;  3RPC A;  1DD6 A;  5DPX A;  5LMC A;  4Z67 A;  2HB9 A;  4HKY A;  1YCH A;  4FEK A;  3IEL A;  2WYM C;  5AIJ A;  2BTN A;  3G1P A;  1XTO A;  3SD9 A;  4V0H A;  5HH6 A;  3LVZ A;  4DIK A;  5LE1 A;  4D1W A;  4C1C A;  3KNR A;  3T9M A;  1X8H A;  5ACW A;  3IEM A;  3SRX A;  2BFZ B;  2NXA A;  4FSB A;  3KL7 A;  5A23 A;  3I13 A;  2P97 A;  5AXR A;  1JJT A;  4J5F A;  4JO0 A;  2NZE A;  4WD6 A;  1KR3 A;  2Q0I A;  2YNT A;  4EYL A;  5K0W A;  2P18 A;  4U4L A;  2FU8 A;  2WYL A;  2Q9U A;  4EXS A;  3PY5 A;  3DHB A;  5HH4 A;  3ZQ4 A;  2FM6 A;  3PG4 A;  4C09 A;  2BG8 B;  1YCF A;  2QIN A;  1MQO A;  5FQA A;  2Y8B A;  3BK1 A;  1L9Y A;  4F6Z A;  1VME A;  4P62 A;  4NQ4 A;  3X2Y A;  1A7T A;  5ACQ A;  2A7M A;  2GFK A;  2YZ3 A;  2Q0J A;  3BC2 A;  5K4K A;  4ZO3 A;  4XWW A;  4J5H A;  1WUO A;  4UWO B;  4YSB A;  5B15 A;  1VGN A;  5FQC A;  5EH9 A;  1Y44 A;  4D1T A;  3IE0 A;  5ACV A;  2Q42 A;  1XM8 A;  4HL2 A;  4D1V A;  2YNW A;  3T3O A;  2QDS A;  2WYM A;  1WUP A;  5K4N A;  2FHX A;  2M5D A; 
#chains in the Genus database with same CATH homology
 1E5D A;  4C1E A;  1VJN A;  2Y8A A;  4UBQ A;  4EXY A;  2BG6 A;  4RM5 A;  4EYB A;  3SPU A;  3IOF A;  2BIB A;  1DXK A;  5LSC A;  2YNU A;  4YSL A;  3I14 A;  5LS3 A;  2P1E A;  5AYA A;  5HIQ A;  4D1U A;  1P9E A;  4Z7R A;  4UWR B;  2ZWR A;  5EV8 A;  4HL1 A;  5AXO A;  3BV6 A;  2YCB A;  5A87 A;  5ACT A;  2WHG A;  2YNT B;  3X2X A;  4NQ5 A;  1BVT A;  4O98 A;  3T3N A;  5B3R A;  5KIL A;  4TZ9 A;  4PVO A;  5ACX A;  2UYX A;  2YNV A;  4YSK A;  5EVK A;  4ZEJ A;  4AWY B;  3ADR A;  4C1G A;  4EFZ A;  2AZ4 A;  1SML A;  3IDZ A;  3ZNB A;  1ZNB A;  4NQ2 A;  2BG7 A;  5ACP A;  4Z60 A;  2NYP A;  5EHT A;  4GYQ A;  3S0Z A;  3DHC A;  4C1H A;  2BMI A;  4EYF A;  3I0V A;  4Z5Y A;  1WW1 A;  5HIO A;  5ACU A;  3AJ3 A;  5A0T A;  1KO2 A;  4KEP A;  4ZNB A;  3RKJ A;  1JJE A;  2ZNB A;  5EVB A;  4BZ3 A;  3F9O A;  4UAM A;  3SFP A;  3IE2 A;  4NQ6 A;  3DHA A;  4RL2 A;  5LCH A;  4TZE A;  3RKK A;  2FHX B;  4F6H A;  1QH5 A;  1BC2 A;  4AD9 A;  4RBS A;  2I7T A;  4Z5Z A;  2I7X A;  4AX0 B;  1QH3 A;  2XF4 A;  3ESH A;  3X2Z A;  2BR6 A;  3Q6V A;  2BFK A;  5AEB A;  2GMN A;  4C1F A;  4ZO2 A;  2FK6 A;  3WXC A;  4Z6X A;  5ACR A;  5A0V A;  2OHJ A;  5ACS A;  1ZKP A;  1DDK A;  2I7V A;  3VPE A;  3IEK A;  3X30 A;  2Y87 A;  1M2X A;  5B1U A;  5LM6 A;  2QED A;  4TZF A;  2BG2 A;  5HIP A;  4TYT A;  5LCA A;  3DH8 A;  3I11 A;  4LE6 A;  5LCF A;  2DOO A;  3MD7 A;  3TP9 A;  2WRS A;  1ZTC A;  3JXP A;  1A8T A;  2NZF A;  2BC2 A;  2CBN A;  2ZO4 A;  3PY6 A;  3IE1 A;  3ZR9 A;  5EW0 A;  4GCW A;  2M5C A;  4FR7 A;  3P2U A;  4C1D A;  4KEQ A;  2QDT A;  2YNV B;  3VQZ A;  4CHL A;  2BFZ A;  5K4M A;  3BK2 A;  2BFL A;  4H0D A;  5AHO A;  1X8I A;  1WRA A;  4PVT A;  2BGA A;  3QH8 A;  4DIL A;  4AX1 B;  1YCG A;  2VW8 A;  5FQB A;  2E7Y A;  2FU9 A;  2OHI A;  5A5Z A;  2P4Z A;  3AF6 A;  4GYU A;  2DKF A;  3I15 A;  4UWS B;  2FU6 A;  2OHH A;  4TYF A;  5EVD A;  2FU7 A;  2BG8 A;  2H6A A;  4UWP B;  4XWT A;  1BMC A;  4AWZ A;  4XUK A;  5EWA A;  4RL0 A;  2AIO A;  4RAW A;  3L6N A;  3IOG A;  5LLD A;  2ZZI A;  3ZWF A;  3H3E A;  2R2D A;  4BP0 A;  5HH5 A;  4TZB A;  3A4Y A;  3SW3 A;  1X8G A;  5IQK A;  5EV6 A;  3FAI A;  5HIS A;  3R2U A;  4B87 A;  2GCU A;  2GFJ A;  3KNS A;  2XR1 A;  4EY2 A;  4RAM A;  1KO3 A;  1K07 A;  2QJS A;  1HLK A;  5KIK A;  3FCZ A;  4UA4 A;  1JT1 A;  4D02 A;  2GKL A;  3AF5 A;  3SBL A;  5AHR A;  3RPC A;  1DD6 A;  5DPX A;  5LMC A;  4Z67 A;  2HB9 A;  4HKY A;  1YCH A;  4FEK A;  3IEL A;  2WYM C;  2BTN A;  3G1P A;  1XTO A;  3SD9 A;  4V0H A;  5HH6 A;  3LVZ A;  4DIK A;  5LE1 A;  4D1W A;  4C1C A;  3KNR A;  3T9M A;  1X8H A;  5ACW A;  3IEM A;  3SRX A;  2BFZ B;  2NXA A;  4FSB A;  3KL7 A;  3I13 A;  2P97 A;  5AXR A;  1JJT A;  4J5F A;  4JO0 A;  2NZE A;  4WD6 A;  1KR3 A;  2Q0I A;  2YNT A;  4EYL A;  5K0W A;  2P18 A;  4U4L A;  2FU8 A;  2WYL A;  2Q9U A;  4EXS A;  3PY5 A;  3DHB A;  5HH4 A;  3ZQ4 A;  2FM6 A;  3PG4 A;  4C09 A;  2BG8 B;  1YCF A;  2QIN A;  1MQO A;  5FQA A;  2Y8B A;  3BK1 A;  1L9Y A;  4F6Z A;  1VME A;  4P62 A;  4NQ4 A;  3X2Y A;  1A7T A;  5ACQ A;  2A7M A;  2GFK A;  2YZ3 A;  2Q0J A;  3BC2 A;  5K4K A;  4ZO3 A;  4XWW A;  4J5H A;  1WUO A;  4UWO B;  4YSB A;  5B15 A;  1VGN A;  5FQC A;  5EH9 A;  1Y44 A;  4D1T A;  3IE0 A;  5ACV A;  2Q42 A;  1XM8 A;  4HL2 A;  4D1V A;  2YNW A;  3T3O A;  2QDS A;  2WYM A;  1WUP A;  5K4N A;  2FHX A;  2M5D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...