4BP0A

Crystal structure of the closed form of pseudomonas aeruginosa spm-1
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
246
structure length
246
Chain Sequence
SDHVDLPYNLTATKIDSDVFVVTDRDFYSSNVLVAKMLDGTVVIVSSPFENLGTQTLMDWVAKTMKPKKVVAINTHFHLDGTGGNEIYKKMGAETWSSDLTKQLRLEENKKDRIKAAEFYKNEDLKRRILSSHPVPADNVFDLKQGKVFSFSNELVEVSFPGPAHSPDNVVVYFPKKKLLFGGCMIKPKELGYLGDANVKAWPDSARRLKKFDAKIVIPGHGEWGGPEMVNKTIKVAEKAVGEMRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords METALLO-B-LACTAMASE
publication title Studying the active-site loop movement of the Sao Paolo metallo-beta-lactamase-1
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 87
structure length 246
sequence length 246
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4bp0A00
2A7MA 4JO0A 5HH6A 2DKFA 2ZWRA 4TZEA 2FU7A 2H6AA 2GMNA 2M5DA 2P97A 5KIKA 3L6NA 5EVBA 4BZ3A 2Q0JA 5LLDA 3X30A 2XF4A 3SBLA 4EYBA 5ACPA 1ZKPA 3I11A 2FK6A 4D02A 4H0DA 2BFZA 2BG2A 4EYLA 2P18A 4V0HA 1BVTA 2QDTA 3DHBA 2NYPA 4Z7RA 2GCUA 2QINA 1X8GA 3TP9A 3AJ3A 1HLKA 5LCHA 3IDZA 5B1UA 2GFJA 4UWSB 5EH9A 1P9EA 4UAMA 4UWRB 2BMIA 4AX0B 2OHHA 3IELA 2Q9UA 5ACQA 4LE6A 3FAIA 5EV6A 2BFLA 2BFKA 4UWPB 2VW8A 4ZNBA 2Q42A 4NQ4A 3BK2A 2OHJA 5HH4A 1DDKA 2FHXB 3X2YA 2I7XA 2HB9A 3SPUA 3QH8A 3I14A 4YSKA 4ZO2A 2Y8AA 4XUKA 2BR6A 3DH8A 4F6HA 4EY2A 4YSLA 1X8IA 2FU9A 4TZ9A 3IE2A 3RPCA 5EHTA 3WXCA 2YNUA 4PVOA 1A7TA 2FU6A 3DHCA 4C1FA 5HIPA 4TZFA 2FHXA 4Z60A 1SMLA 4CHLA 4C1GA 4RM5A 4AWYB 5EVDA 3RKJA 3X2XA 5EV8A 1ZTCA 5EVKA 3SD9A 3KNRA 2E7YA 4EXYA 2NZFA 2Y87A 2BC2A 1VGNA 5LM6A 5ACXA 1M2XA 2YZ3A 3PY6A 3RKKA 4P62A 3Q6VA 5AEBA 3IE0A 4TZBA 3SW3A 1DXKA 2UYXA 2FM6A 5LCFA 3AF5A 3T9MA 1X8HA 4RL0A 3S0ZA 3SFPA 4NQ6A 5ACRA 5ACUA 2AIOA 5A87A 3IEKA 4ZO3A 2QDSA 3IOFA 3PG4A 3AF6A 2YCBA 5HH5A 3ZR9A 3ZWFA 1VJNA 3SRXA 3JXPA 3H3EA 5ACTA 3F9OA 3ZQ4A 1KO2A 1XM8A 4D1TA 3BV6A 4Z5YA 2YNTB 1K07A 3PY5A 4XWWA 2ZO4A 2DOOA 3T3OA 4GCWA 4HL1A 3IOGA 2P4ZA 4F6ZA 5LMCA 3BC2A 1JJEA 1E5DA 1WUPA 4YSBA 3VPEA 3KNSA 2AZ4A 3I15A 4UA4A 1YCGA 4HKYA 2YNTA 5ACWA 4ZEJA 5AHRA 2WHGA 5ACSA 3I0VA 4FEKA 3MD7A 2QJSA 3R2UA 4EYFA 5HISA 2M5CA 4RBSA 2BGAA 4C1HA 4GYQA 1YCFA 4C1CA 2YNVB 4J5HA 5FQAA 5K4MA 2BG7A 5HIQA 2Y8BA 1BC2A 1QH5A 5KILA 2FU8A 4RL2A 2I7VA 1DD6A 4C09A 1ZNBA 3IE1A 4KEPA 2R2DA 3FCZA 4EXSA 1JT1A 1YCHA 2YNWA 2QEDA 4TYFA 4AX1B 5K0WA 2YNVA 5AXOA 3X2ZA 4EFZA 4HL2A 1L9YA 2WYLA 4RAWA 2GFKA 3VQZA 4BP0A 4UBQA 2XR1A 1JJTA 2I7TA 3ADRA 3I13A 4DIKA 3G1PA 3KL7A 1XTOA 5LE1A 4RAMA 4U4LA 5IQKA 2NXAA 1Y44A 3ZNBA 5DPXA 2OHIA 1KO3A 4GYUA 4D1VA 5A0TA 4NQ5A 4AWZA 3LVZA 5FQBA 3BK1A 5K4NA 3DHAA 2NZEA 4DILA 4D1UA 1WW1A 4KEQA 4WD6A 4D1WA 5FQCA 5ACVA 5LSCA 4C1DA 1WRAA 3A4YA 3ESHA 4NQ2A 2Q0IA 5EW0A 5AYAA 5B3RA 1A8TA 1KR3A 1BMCA 1WUOA 1MQOA 4PVTA 3IEMA 4Z6XA 5A0VA 4FR7A 2WYMC 2BG8B 4B87A 3P2UA 4FSBA 2BIBA 4C1EA 2ZZIA 2WYMA 3T3NA 5LS3A 1QH3A 1VMEA 2GKLA 5LCAA 2BTNA 4J5FA 2BG8A 2ZNBA 4AD9A 2CBNA 4Z67A 4O98A 4UWOB 5EWAA 2WRSA 5HIOA 2BG6A 4Z5ZA 4XWTA 5A5ZA 2P1EA 5AXRA 5B15A 5AHOA 5K4KA 2BFZB 4TYTA
chains in the Genus database with same CATH superfamily
2A7MA 4JO0A 5HH6A 2DKFA 2ZWRA 4TZEA 2FU7A 2H6AA 2GMNA 2M5DA 2P97A 5KIKA 3L6NA 5EVBA 4BZ3A 2Q0JA 5LLDA 3X30A 2XF4A 3SBLA 4EYBA 5ACPA 1ZKPA 3I11A 2FK6A 4D02A 4H0DA 2BFZA 2BG2A 4EYLA 2P18A 4V0HA 1BVTA 2QDTA 3DHBA 2NYPA 4Z7RA 2GCUA 2QINA 1X8GA 3TP9A 3AJ3A 1HLKA 5LCHA 3IDZA 5B1UA 2GFJA 4UWSB 5EH9A 1P9EA 4UAMA 4UWRB 2BMIA 4AX0B 2OHHA 3IELA 2Q9UA 5ACQA 4LE6A 3FAIA 5EV6A 2BFLA 2BFKA 4UWPB 2VW8A 4ZNBA 2Q42A 4NQ4A 3BK2A 2OHJA 5HH4A 1DDKA 2FHXB 3X2YA 2I7XA 2HB9A 3SPUA 3QH8A 3I14A 4YSKA 4ZO2A 2Y8AA 4XUKA 2BR6A 3DH8A 4F6HA 4EY2A 4YSLA 1X8IA 2FU9A 4TZ9A 3IE2A 3RPCA 5EHTA 3WXCA 4AV7A 2YNUA 4PVOA 1A7TA 5A23A 2FU6A 3DHCA 2YHEA 4C1FA 4PDXA 5HIPA 4TZFA 2FHXA 4Z60A 1SMLA 4CHLA 4C1GA 4RM5A 4AWYB 5EVDA 3RKJA 3X2XA 5EV8A 1ZTCA 5EVKA 3SD9A 3KNRA 2E7YA 4NURA 4EXYA 2NZFA 2Y87A 2BC2A 1VGNA 5LM6A 5ACXA 1M2XA 2YZ3A 3PY6A 3RKKA 4P62A 3Q6VA 5AEBA 3IE0A 4TZBA 3SW3A 1DXKA 2UYXA 2FM6A 5LCFA 3AF5A 3T9MA 1X8HA 4RL0A 3S0ZA 3SFPA 4NQ6A 5ACRA 5ACUA 2AIOA 5A87A 3IEKA 4ZO3A 2QDSA 3IOFA 3PG4A 3AF6A 2YCBA 5HH5A 3ZR9A 3ZWFA 1VJNA 3SRXA 4AXHA 3JXPA 3H3EA 5ACTA 3F9OA 2CG3A 3ZQ4A 1KO2A 1XM8A 4D1TA 5AIJA 3BV6A 4Z5YA 2YNTB 1K07A 3PY5A 4XWWA 2ZO4A 2DOOA 3T3OA 4GCWA 4HL1A 3IOGA 2P4ZA 4F6ZA 5LMCA 3BC2A 1JJEA 1E5DA 1WUPA 4YSBA 3VPEA 3KNSA 2AZ4A 3I15A 4UA4A 1YCGA 4HKYA 2YNTA 5ACWA 4ZEJA 5AHRA 2WHGA 5ACSA 3I0VA 4FEKA 3MD7A 2QJSA 3R2UA 4EYFA 5HISA 2M5CA 4RBSA 2BGAA 4C1HA 4GYQA 1YCFA 4C1CA 2YNVB 4J5HA 5FQAA 5K4MA 2BG7A 5HIQA 2Y8BA 1BC2A 1QH5A 2CFUA 5KILA 2FU8A 4RL2A 2I7VA 1DD6A 4C09A 1ZNBA 3IE1A 4KEPA 2R2DA 3FCZA 4EXSA 1JT1A 1YCHA 2YNWA 2QEDA 4TYFA 4AX1B 5K0WA 2YNVA 5AXOA 3X2ZA 4EFZA 4HL2A 1L9YA 2WYLA 4RAWA 2GFKA 3VQZA 4BP0A 4UBQA 2XR1A 1JJTA 2I7TA 3ADRA 3I13A 4DIKA 3G1PA 3KL7A 1XTOA 5LE1A 4RAMA 4U4LA 5IQKA 2NXAA 1Y44A 3ZNBA 5DPXA 2OHIA 1KO3A 4GYUA 4D1VA 5A0TA 4NQ5A 4AWZA 3LVZA 5FQBA 3BK1A 5K4NA 3DHAA 2NZEA 4DILA 4D1UA 1WW1A 4KEQA 4WD6A 4D1WA 5FQCA 5ACVA 5LSCA 4C1DA 1WRAA 3A4YA 3ESHA 4NQ2A 2Q0IA 5EW0A 5AYAA 5B3RA 1A8TA 1KR3A 1BMCA 1WUOA 1MQOA 2CFZA 4PVTA 3IEMA 4Z6XA 5A0VA 4FR7A 2WYMC 2BG8B 4B87A 3P2UA 4FSBA 2BIBA 4C1EA 2ZZIA 2WYMA 3T3NA 5LS3A 1QH3A 1VMEA 2GKLA 5LCAA 2BTNA 4J5FA 2BG8A 2ZNBA 4AD9A 2CBNA 4Z67A 4O98A 4UWOB 5EWAA 5AJLA 2WRSA 5HIOA 2BG6A 4Z5ZA 4XWTA 2CG2A 5A5ZA 2P1EA 5AXRA 5B15A 5AHOA 5K4KA 2BFZB 4TYTA
chains in the Genus database with same CATH topology
2A7MA 4JO0A 5HH6A 2DKFA 2ZWRA 4TZEA 2FU7A 2H6AA 2GMNA 2M5DA 2P97A 5KIKA 3L6NA 5EVBA 4BZ3A 2Q0JA 5LLDA 3X30A 2XF4A 3SBLA 4EYBA 5ACPA 1ZKPA 3I11A 2FK6A 4D02A 4H0DA 2BFZA 2BG2A 4EYLA 2P18A 4V0HA 1BVTA 2QDTA 3DHBA 2NYPA 4Z7RA 2GCUA 2QINA 1X8GA 3TP9A 3AJ3A 1HLKA 5LCHA 3IDZA 5B1UA 2GFJA 4UWSB 5EH9A 1P9EA 4UAMA 4UWRB 2BMIA 4AX0B 2OHHA 3IELA 2Q9UA 5ACQA 4LE6A 3FAIA 5EV6A 2BFLA 2BFKA 4UWPB 2VW8A 4ZNBA 2Q42A 4NQ4A 3BK2A 2OHJA 5HH4A 1DDKA 2FHXB 3X2YA 2I7XA 2HB9A 3SPUA 3QH8A 3I14A 4YSKA 4ZO2A 2Y8AA 4XUKA 2BR6A 3DH8A 4F6HA 4EY2A 4YSLA 1X8IA 2FU9A 4TZ9A 3IE2A 3RPCA 5EHTA 3WXCA 2YNUA 4PVOA 1A7TA 2FU6A 3DHCA 4C1FA 5HIPA 4TZFA 2FHXA 4Z60A 1SMLA 4CHLA 4C1GA 4RM5A 4AWYB 5EVDA 3RKJA 3X2XA 5EV8A 1ZTCA 5EVKA 3SD9A 3KNRA 2E7YA 4EXYA 2NZFA 2Y87A 2BC2A 1VGNA 5LM6A 5ACXA 1M2XA 2YZ3A 3PY6A 3RKKA 4P62A 3Q6VA 5AEBA 3IE0A 4TZBA 3SW3A 1DXKA 2UYXA 2FM6A 5LCFA 3AF5A 3T9MA 1X8HA 4RL0A 3S0ZA 3SFPA 4NQ6A 5ACRA 5ACUA 2AIOA 5A87A 3IEKA 4ZO3A 2QDSA 3IOFA 3PG4A 3AF6A 2YCBA 5HH5A 3ZR9A 3ZWFA 1VJNA 3SRXA 3JXPA 3H3EA 5ACTA 3F9OA 3ZQ4A 1KO2A 1XM8A 4D1TA 3BV6A 4Z5YA 2YNTB 1K07A 3PY5A 4XWWA 2ZO4A 2DOOA 3T3OA 4GCWA 4HL1A 3IOGA 2P4ZA 4F6ZA 5LMCA 3BC2A 1JJEA 1E5DA 1WUPA 4YSBA 3VPEA 3KNSA 2AZ4A 3I15A 4UA4A 1YCGA 4HKYA 2YNTA 5ACWA 4ZEJA 5AHRA 2WHGA 5ACSA 3I0VA 4FEKA 3MD7A 2QJSA 3R2UA 4EYFA 5HISA 2M5CA 4RBSA 2BGAA 4C1HA 4GYQA 1YCFA 4C1CA 2YNVB 4J5HA 5FQAA 5K4MA 2BG7A 5HIQA 2Y8BA 1BC2A 1QH5A 5KILA 2FU8A 4RL2A 2I7VA 1DD6A 4C09A 1ZNBA 3IE1A 4KEPA 2R2DA 3FCZA 4EXSA 1JT1A 1YCHA 2YNWA 2QEDA 4TYFA 4AX1B 5K0WA 2YNVA 5AXOA 3X2ZA 4EFZA 4HL2A 1L9YA 2WYLA 4RAWA 2GFKA 3VQZA 4BP0A 4UBQA 2XR1A 1JJTA 2I7TA 3ADRA 3I13A 4DIKA 3G1PA 3KL7A 1XTOA 5LE1A 4RAMA 4U4LA 5IQKA 2NXAA 1Y44A 3ZNBA 5DPXA 2OHIA 1KO3A 4GYUA 4D1VA 5A0TA 4NQ5A 4AWZA 3LVZA 5FQBA 3BK1A 5K4NA 3DHAA 2NZEA 4DILA 4D1UA 1WW1A 4KEQA 4WD6A 4D1WA 5FQCA 5ACVA 5LSCA 4C1DA 1WRAA 3A4YA 3ESHA 4NQ2A 2Q0IA 5EW0A 5AYAA 5B3RA 1A8TA 1KR3A 1BMCA 1WUOA 1MQOA 4PVTA 3IEMA 4Z6XA 5A0VA 4FR7A 2WYMC 2BG8B 4B87A 3P2UA 4FSBA 2BIBA 4C1EA 2ZZIA 2WYMA 3T3NA 5LS3A 1QH3A 1VMEA 2GKLA 5LCAA 2BTNA 4J5FA 2BG8A 2ZNBA 4AD9A 2CBNA 4Z67A 4O98A 4UWOB 5EWAA 2WRSA 5HIOA 2BG6A 4Z5ZA 4XWTA 5A5ZA 2P1EA 5AXRA 5B15A 5AHOA 5K4KA 2BFZB 4TYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A7M A;  4JO0 A;  5HH6 A;  2DKF A;  2ZWR A;  4TZE A;  2FU7 A;  2H6A A;  2GMN A;  2M5D A;  2P97 A;  5KIK A;  3L6N A;  5EVB A;  4BZ3 A;  2Q0J A;  5LLD A;  3X30 A;  2XF4 A;  3SBL A;  4EYB A;  5ACP A;  1ZKP A;  3I11 A;  2FK6 A;  4D02 A;  4H0D A;  2BFZ A;  2BG2 A;  4EYL A;  2P18 A;  4V0H A;  1BVT A;  2QDT A;  3DHB A;  2NYP A;  4Z7R A;  2GCU A;  2QIN A;  1X8G A;  3TP9 A;  3AJ3 A;  1HLK A;  5LCH A;  3IDZ A;  5B1U A;  2GFJ A;  4UWS B;  5EH9 A;  1P9E A;  4UAM A;  4UWR B;  2BMI A;  4AX0 B;  2OHH A;  3IEL A;  2Q9U A;  5ACQ A;  4LE6 A;  3FAI A;  5EV6 A;  2BFL A;  2BFK A;  4UWP B;  2VW8 A;  4ZNB A;  2Q42 A;  4NQ4 A;  3BK2 A;  2OHJ A;  5HH4 A;  1DDK A;  2FHX B;  3X2Y A;  2I7X A;  2HB9 A;  3SPU A;  3QH8 A;  3I14 A;  4YSK A;  4ZO2 A;  2Y8A A;  4XUK A;  2BR6 A;  3DH8 A;  4F6H A;  4EY2 A;  4YSL A;  1X8I A;  2FU9 A;  4TZ9 A;  3IE2 A;  3RPC A;  5EHT A;  3WXC A;  2YNU A;  4PVO A;  1A7T A;  2FU6 A;  3DHC A;  4C1F A;  5HIP A;  4TZF A;  2FHX A;  4Z60 A;  1SML A;  4CHL A;  4C1G A;  4RM5 A;  4AWY B;  5EVD A;  3RKJ A;  3X2X A;  5EV8 A;  1ZTC A;  5EVK A;  3SD9 A;  3KNR A;  2E7Y A;  4EXY A;  2NZF A;  2Y87 A;  2BC2 A;  1VGN A;  5LM6 A;  5ACX A;  1M2X A;  2YZ3 A;  3PY6 A;  3RKK A;  4P62 A;  3Q6V A;  5AEB A;  3IE0 A;  4TZB A;  3SW3 A;  1DXK A;  2UYX A;  2FM6 A;  5LCF A;  3AF5 A;  3T9M A;  1X8H A;  4RL0 A;  3S0Z A;  3SFP A;  4NQ6 A;  5ACR A;  5ACU A;  2AIO A;  5A87 A;  3IEK A;  4ZO3 A;  2QDS A;  3IOF A;  3PG4 A;  3AF6 A;  2YCB A;  5HH5 A;  3ZR9 A;  3ZWF A;  1VJN A;  3SRX A;  3JXP A;  3H3E A;  5ACT A;  3F9O A;  3ZQ4 A;  1KO2 A;  1XM8 A;  4D1T A;  3BV6 A;  4Z5Y A;  2YNT B;  1K07 A;  3PY5 A;  4XWW A;  2ZO4 A;  2DOO A;  3T3O A;  4GCW A;  4HL1 A;  3IOG A;  2P4Z A;  4F6Z A;  5LMC A;  3BC2 A;  1JJE A;  1E5D A;  1WUP A;  4YSB A;  3VPE A;  3KNS A;  2AZ4 A;  3I15 A;  4UA4 A;  1YCG A;  4HKY A;  2YNT A;  5ACW A;  4ZEJ A;  5AHR A;  2WHG A;  5ACS A;  3I0V A;  4FEK A;  3MD7 A;  2QJS A;  3R2U A;  4EYF A;  5HIS A;  2M5C A;  4RBS A;  2BGA A;  4C1H A;  4GYQ A;  1YCF A;  4C1C A;  2YNV B;  4J5H A;  5FQA A;  5K4M A;  2BG7 A;  5HIQ A;  2Y8B A;  1BC2 A;  1QH5 A;  5KIL A;  2FU8 A;  4RL2 A;  2I7V A;  1DD6 A;  4C09 A;  1ZNB A;  3IE1 A;  4KEP A;  2R2D A;  3FCZ A;  4EXS A;  1JT1 A;  1YCH A;  2YNW A;  2QED A;  4TYF A;  4AX1 B;  5K0W A;  2YNV A;  5AXO A;  3X2Z A;  4EFZ A;  4HL2 A;  1L9Y A;  2WYL A;  4RAW A;  2GFK A;  3VQZ A;  4BP0 A;  4UBQ A;  2XR1 A;  1JJT A;  2I7T A;  3ADR A;  3I13 A;  4DIK A;  3G1P A;  3KL7 A;  1XTO A;  5LE1 A;  4RAM A;  4U4L A;  5IQK A;  2NXA A;  1Y44 A;  3ZNB A;  5DPX A;  2OHI A;  1KO3 A;  4GYU A;  4D1V A;  5A0T A;  4NQ5 A;  4AWZ A;  3LVZ A;  5FQB A;  3BK1 A;  5K4N A;  3DHA A;  2NZE A;  4DIL A;  4D1U A;  1WW1 A;  4KEQ A;  4WD6 A;  4D1W A;  5FQC A;  5ACV A;  5LSC A;  4C1D A;  1WRA A;  3A4Y A;  3ESH A;  4NQ2 A;  2Q0I A;  5EW0 A;  5AYA A;  5B3R A;  1A8T A;  1KR3 A;  1BMC A;  1WUO A;  1MQO A;  4PVT A;  3IEM A;  4Z6X A;  5A0V A;  4FR7 A;  2WYM C;  2BG8 B;  4B87 A;  3P2U A;  4FSB A;  2BIB A;  4C1E A;  2ZZI A;  2WYM A;  3T3N A;  5LS3 A;  1QH3 A;  1VME A;  2GKL A;  5LCA A;  2BTN A;  4J5F A;  2BG8 A;  2ZNB A;  4AD9 A;  2CBN A;  4Z67 A;  4O98 A;  4UWO B;  5EWA A;  2WRS A;  5HIO A;  2BG6 A;  4Z5Z A;  4XWT A;  5A5Z A;  2P1E A;  5AXR A;  5B15 A;  5AHO A;  5K4K A;  2BFZ B;  4TYT A; 
#chains in the Genus database with same CATH topology
 2A7M A;  4JO0 A;  5HH6 A;  2DKF A;  2ZWR A;  4TZE A;  2FU7 A;  2H6A A;  2GMN A;  2M5D A;  2P97 A;  5KIK A;  3L6N A;  5EVB A;  4BZ3 A;  2Q0J A;  5LLD A;  3X30 A;  2XF4 A;  3SBL A;  4EYB A;  5ACP A;  1ZKP A;  3I11 A;  2FK6 A;  4D02 A;  4H0D A;  2BFZ A;  2BG2 A;  4EYL A;  2P18 A;  4V0H A;  1BVT A;  2QDT A;  3DHB A;  2NYP A;  4Z7R A;  2GCU A;  2QIN A;  1X8G A;  3TP9 A;  3AJ3 A;  1HLK A;  5LCH A;  3IDZ A;  5B1U A;  2GFJ A;  4UWS B;  5EH9 A;  1P9E A;  4UAM A;  4UWR B;  2BMI A;  4AX0 B;  2OHH A;  3IEL A;  2Q9U A;  5ACQ A;  4LE6 A;  3FAI A;  5EV6 A;  2BFL A;  2BFK A;  4UWP B;  2VW8 A;  4ZNB A;  2Q42 A;  4NQ4 A;  3BK2 A;  2OHJ A;  5HH4 A;  1DDK A;  2FHX B;  3X2Y A;  2I7X A;  2HB9 A;  3SPU A;  3QH8 A;  3I14 A;  4YSK A;  4ZO2 A;  2Y8A A;  4XUK A;  2BR6 A;  3DH8 A;  4F6H A;  4EY2 A;  4YSL A;  1X8I A;  2FU9 A;  4TZ9 A;  3IE2 A;  3RPC A;  5EHT A;  3WXC A;  4AV7 A;  2YNU A;  4PVO A;  1A7T A;  5A23 A;  2FU6 A;  3DHC A;  2YHE A;  4C1F A;  4PDX A;  5HIP A;  4TZF A;  2FHX A;  4Z60 A;  1SML A;  4CHL A;  4C1G A;  4RM5 A;  4AWY B;  5EVD A;  3RKJ A;  3X2X A;  5EV8 A;  1ZTC A;  5EVK A;  3SD9 A;  3KNR A;  2E7Y A;  4NUR A;  4EXY A;  2NZF A;  2Y87 A;  2BC2 A;  1VGN A;  5LM6 A;  5ACX A;  1M2X A;  2YZ3 A;  3PY6 A;  3RKK A;  4P62 A;  3Q6V A;  5AEB A;  3IE0 A;  4TZB A;  3SW3 A;  1DXK A;  2UYX A;  2FM6 A;  5LCF A;  3AF5 A;  3T9M A;  1X8H A;  4RL0 A;  3S0Z A;  3SFP A;  4NQ6 A;  5ACR A;  5ACU A;  2AIO A;  5A87 A;  3IEK A;  4ZO3 A;  2QDS A;  3IOF A;  3PG4 A;  3AF6 A;  2YCB A;  5HH5 A;  3ZR9 A;  3ZWF A;  1VJN A;  3SRX A;  4AXH A;  3JXP A;  3H3E A;  5ACT A;  3F9O A;  2CG3 A;  3ZQ4 A;  1KO2 A;  1XM8 A;  4D1T A;  5AIJ A;  3BV6 A;  4Z5Y A;  2YNT B;  1K07 A;  3PY5 A;  4XWW A;  2ZO4 A;  2DOO A;  3T3O A;  4GCW A;  4HL1 A;  3IOG A;  2P4Z A;  4F6Z A;  5LMC A;  3BC2 A;  1JJE A;  1E5D A;  1WUP A;  4YSB A;  3VPE A;  3KNS A;  2AZ4 A;  3I15 A;  4UA4 A;  1YCG A;  4HKY A;  2YNT A;  5ACW A;  4ZEJ A;  5AHR A;  2WHG A;  5ACS A;  3I0V A;  4FEK A;  3MD7 A;  2QJS A;  3R2U A;  4EYF A;  5HIS A;  2M5C A;  4RBS A;  2BGA A;  4C1H A;  4GYQ A;  1YCF A;  4C1C A;  2YNV B;  4J5H A;  5FQA A;  5K4M A;  2BG7 A;  5HIQ A;  2Y8B A;  1BC2 A;  1QH5 A;  2CFU A;  5KIL A;  2FU8 A;  4RL2 A;  2I7V A;  1DD6 A;  4C09 A;  1ZNB A;  3IE1 A;  4KEP A;  2R2D A;  3FCZ A;  4EXS A;  1JT1 A;  1YCH A;  2YNW A;  2QED A;  4TYF A;  4AX1 B;  5K0W A;  2YNV A;  5AXO A;  3X2Z A;  4EFZ A;  4HL2 A;  1L9Y A;  2WYL A;  4RAW A;  2GFK A;  3VQZ A;  4BP0 A;  4UBQ A;  2XR1 A;  1JJT A;  2I7T A;  3ADR A;  3I13 A;  4DIK A;  3G1P A;  3KL7 A;  1XTO A;  5LE1 A;  4RAM A;  4U4L A;  5IQK A;  2NXA A;  1Y44 A;  3ZNB A;  5DPX A;  2OHI A;  1KO3 A;  4GYU A;  4D1V A;  5A0T A;  4NQ5 A;  4AWZ A;  3LVZ A;  5FQB A;  3BK1 A;  5K4N A;  3DHA A;  2NZE A;  4DIL A;  4D1U A;  1WW1 A;  4KEQ A;  4WD6 A;  4D1W A;  5FQC A;  5ACV A;  5LSC A;  4C1D A;  1WRA A;  3A4Y A;  3ESH A;  4NQ2 A;  2Q0I A;  5EW0 A;  5AYA A;  5B3R A;  1A8T A;  1KR3 A;  1BMC A;  1WUO A;  1MQO A;  2CFZ A;  4PVT A;  3IEM A;  4Z6X A;  5A0V A;  4FR7 A;  2WYM C;  2BG8 B;  4B87 A;  3P2U A;  4FSB A;  2BIB A;  4C1E A;  2ZZI A;  2WYM A;  3T3N A;  5LS3 A;  1QH3 A;  1VME A;  2GKL A;  5LCA A;  2BTN A;  4J5F A;  2BG8 A;  2ZNB A;  4AD9 A;  2CBN A;  4Z67 A;  4O98 A;  4UWO B;  5EWA A;  5AJL A;  2WRS A;  5HIO A;  2BG6 A;  4Z5Z A;  4XWT A;  2CG2 A;  5A5Z A;  2P1E A;  5AXR A;  5B15 A;  5AHO A;  5K4K A;  2BFZ B;  4TYT A; 
#chains in the Genus database with same CATH homology
 2A7M A;  4JO0 A;  5HH6 A;  2DKF A;  2ZWR A;  4TZE A;  2FU7 A;  2H6A A;  2GMN A;  2M5D A;  2P97 A;  5KIK A;  3L6N A;  5EVB A;  4BZ3 A;  2Q0J A;  5LLD A;  3X30 A;  2XF4 A;  3SBL A;  4EYB A;  5ACP A;  1ZKP A;  3I11 A;  2FK6 A;  4D02 A;  4H0D A;  2BFZ A;  2BG2 A;  4EYL A;  2P18 A;  4V0H A;  1BVT A;  2QDT A;  3DHB A;  2NYP A;  4Z7R A;  2GCU A;  2QIN A;  1X8G A;  3TP9 A;  3AJ3 A;  1HLK A;  5LCH A;  3IDZ A;  5B1U A;  2GFJ A;  4UWS B;  5EH9 A;  1P9E A;  4UAM A;  4UWR B;  2BMI A;  4AX0 B;  2OHH A;  3IEL A;  2Q9U A;  5ACQ A;  4LE6 A;  3FAI A;  5EV6 A;  2BFL A;  2BFK A;  4UWP B;  2VW8 A;  4ZNB A;  2Q42 A;  4NQ4 A;  3BK2 A;  2OHJ A;  5HH4 A;  1DDK A;  2FHX B;  3X2Y A;  2I7X A;  2HB9 A;  3SPU A;  3QH8 A;  3I14 A;  4YSK A;  4ZO2 A;  2Y8A A;  4XUK A;  2BR6 A;  3DH8 A;  4F6H A;  4EY2 A;  4YSL A;  1X8I A;  2FU9 A;  4TZ9 A;  3IE2 A;  3RPC A;  5EHT A;  3WXC A;  2YNU A;  4PVO A;  1A7T A;  2FU6 A;  3DHC A;  4C1F A;  5HIP A;  4TZF A;  2FHX A;  4Z60 A;  1SML A;  4CHL A;  4C1G A;  4RM5 A;  4AWY B;  5EVD A;  3RKJ A;  3X2X A;  5EV8 A;  1ZTC A;  5EVK A;  3SD9 A;  3KNR A;  2E7Y A;  4EXY A;  2NZF A;  2Y87 A;  2BC2 A;  1VGN A;  5LM6 A;  5ACX A;  1M2X A;  2YZ3 A;  3PY6 A;  3RKK A;  4P62 A;  3Q6V A;  5AEB A;  3IE0 A;  4TZB A;  3SW3 A;  1DXK A;  2UYX A;  2FM6 A;  5LCF A;  3AF5 A;  3T9M A;  1X8H A;  4RL0 A;  3S0Z A;  3SFP A;  4NQ6 A;  5ACR A;  5ACU A;  2AIO A;  5A87 A;  3IEK A;  4ZO3 A;  2QDS A;  3IOF A;  3PG4 A;  3AF6 A;  2YCB A;  5HH5 A;  3ZR9 A;  3ZWF A;  1VJN A;  3SRX A;  3JXP A;  3H3E A;  5ACT A;  3F9O A;  3ZQ4 A;  1KO2 A;  1XM8 A;  4D1T A;  3BV6 A;  4Z5Y A;  2YNT B;  1K07 A;  3PY5 A;  4XWW A;  2ZO4 A;  2DOO A;  3T3O A;  4GCW A;  4HL1 A;  3IOG A;  2P4Z A;  4F6Z A;  5LMC A;  3BC2 A;  1JJE A;  1E5D A;  1WUP A;  4YSB A;  3VPE A;  3KNS A;  2AZ4 A;  3I15 A;  4UA4 A;  1YCG A;  4HKY A;  2YNT A;  5ACW A;  4ZEJ A;  5AHR A;  2WHG A;  5ACS A;  3I0V A;  4FEK A;  3MD7 A;  2QJS A;  3R2U A;  4EYF A;  5HIS A;  2M5C A;  4RBS A;  2BGA A;  4C1H A;  4GYQ A;  1YCF A;  4C1C A;  2YNV B;  4J5H A;  5FQA A;  5K4M A;  2BG7 A;  5HIQ A;  2Y8B A;  1BC2 A;  1QH5 A;  5KIL A;  2FU8 A;  4RL2 A;  2I7V A;  1DD6 A;  4C09 A;  1ZNB A;  3IE1 A;  4KEP A;  2R2D A;  3FCZ A;  4EXS A;  1JT1 A;  1YCH A;  2YNW A;  2QED A;  4TYF A;  4AX1 B;  5K0W A;  2YNV A;  5AXO A;  3X2Z A;  4EFZ A;  4HL2 A;  1L9Y A;  2WYL A;  4RAW A;  2GFK A;  3VQZ A;  4BP0 A;  4UBQ A;  2XR1 A;  1JJT A;  2I7T A;  3ADR A;  3I13 A;  4DIK A;  3G1P A;  3KL7 A;  1XTO A;  5LE1 A;  4RAM A;  4U4L A;  5IQK A;  2NXA A;  1Y44 A;  3ZNB A;  5DPX A;  2OHI A;  1KO3 A;  4GYU A;  4D1V A;  5A0T A;  4NQ5 A;  4AWZ A;  3LVZ A;  5FQB A;  3BK1 A;  5K4N A;  3DHA A;  2NZE A;  4DIL A;  4D1U A;  1WW1 A;  4KEQ A;  4WD6 A;  4D1W A;  5FQC A;  5ACV A;  5LSC A;  4C1D A;  1WRA A;  3A4Y A;  3ESH A;  4NQ2 A;  2Q0I A;  5EW0 A;  5AYA A;  5B3R A;  1A8T A;  1KR3 A;  1BMC A;  1WUO A;  1MQO A;  4PVT A;  3IEM A;  4Z6X A;  5A0V A;  4FR7 A;  2WYM C;  2BG8 B;  4B87 A;  3P2U A;  4FSB A;  2BIB A;  4C1E A;  2ZZI A;  2WYM A;  3T3N A;  5LS3 A;  1QH3 A;  1VME A;  2GKL A;  5LCA A;  2BTN A;  4J5F A;  2BG8 A;  2ZNB A;  4AD9 A;  2CBN A;  4Z67 A;  4O98 A;  4UWO B;  5EWA A;  2WRS A;  5HIO A;  2BG6 A;  4Z5Z A;  4XWT A;  5A5Z A;  2P1E A;  5AXR A;  5B15 A;  5AHO A;  5K4K A;  2BFZ B;  4TYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...