5HH4A

Crystal structure of metallo-beta-lactamase imp-1 in complex with a phosphonate-based inhibitor
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
218
structure length
218
Chain Sequence
SLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Kinetic Studies of the Potent Inhibition of Metallo-beta-lactamases by 6-Phosphonomethylpyridine-2-carboxylates.
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Hydrolase
molecule keywords Beta-lactamase IMP-1
total genus 61
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5hh4A00
2GFKA 3PY6A 4BZ3A 4ZEJA 4UWRB 2YNVB 4C1HA 2Q0JA 1ZKPA 2NZEA 5DPXA 2FU8A 2FU9A 1ZTCA 4J5HA 1BC2A 3MD7A 5AXOA 1K07A 5A0TA 2BFZA 3I13A 3I11A 2OHJA 1DXKA 2FU7A 2GCUA 1WUPA 5ACQA 4YSKA 3KNRA 1BMCA 5LM6A 3X30A 2DKFA 2BG8B 1VGNA 3T3OA 1SMLA 4EY2A 4XUKA 2YNTB 2UYXA 2A7MA 4XWWA 2AIOA 2E7YA 3FAIA 2Q0IA 2YNVA 2GKLA 5K4NA 1MQOA 5IQKA 1XM8A 4UA4A 3RKKA 4D02A 3IE2A 2WHGA 2NYPA 2Y87A 2ZWRA 4FEKA 3TP9A 2NXAA 1M2XA 3BC2A 3VPEA 3AJ3A 4ZO2A 5B15A 2OHIA 1QH5A 2BFLA 2BMIA 4BP0A 4Z6XA 3PY5A 4AWYB 4RL2A 3DHBA 1KO3A 2M5CA 5B3RA 4NQ2A 2BG8A 5ACUA 2P18A 4GCWA 4ZO3A 2WYLA 2BFKA 4D1WA 2FK6A 4TYFA 1L9YA 3X2XA 4RM5A 5ACWA 3SW3A 3ADRA 2OHHA 2P97A 3LVZA 3AF6A 2BIBA 4NQ6A 5A87A 5AHRA 4TZEA 5HIQA 1P9EA 1QH3A 3ZQ4A 1DD6A 3FCZA 2QJSA 3SFPA 2BC2A 4O98A 4U4LA 4V0HA 1JT1A 3IOFA 1WW1A 2Y8AA 5FQBA 4D1TA 3P2UA 5K4MA 3BV6A 3I15A 3VQZA 2FM6A 5LCFA 5KILA 3X2YA 4UWPB 1JJEA 4ZNBA 4JO0A 5EVBA 4EYBA 2H6AA 2BFZB 2YCBA 4FR7A 2R2DA 2I7VA 4PVTA 3RKJA 4CHLA 2BGAA 4C1FA 5HIOA 4GYUA 4WD6A 4C1EA 1XTOA 3SD9A 4KEQA 3DHCA 3RPCA 3IE1A 5AXRA 2Q42A 4XWTA 5ACPA 4GYQA 5ACTA 2QINA 5AYAA 3I14A 1Y44A 3KL7A 2BG7A 4YSBA 3ZWFA 2XR1A 1ZNBA 2ZNBA 4C1GA 5EV6A 5LMCA 4HL1A 4H0DA 3QH8A 2VW8A 4C1CA 4Z7RA 4NQ4A 2BR6A 5LCAA 5ACXA 5LLDA 4UWOB 1X8HA 1HLKA 4AX1B 4TZBA 5K4KA 1BVTA 2BTNA 4EXSA 1WUOA 3IEMA 5EVDA 2QDSA 4J5FA 3H3EA 2HB9A 3IELA 4RL0A 2ZO4A 2P4ZA 2QEDA 1VJNA 4AWZA 4EXYA 4YSLA 1YCHA 1YCFA 4Z5YA 2WRSA 5EH9A 5EHTA 5ACRA 4F6ZA 3WXCA 4KEPA 4DILA 4TZ9A 3SRXA 2YZ3A 3ESHA 2YNTA 3IOGA 4DIKA 4Z67A 4TYTA 3I0VA 5K0WA 2ZZIA 4RBSA 4EFZA 4RAWA 5ACSA 4HKYA 4PVOA 5HIPA 5FQAA 4F6HA 4C09A 2I7TA 3BK2A 3AF5A 1X8GA 3L6NA 3BK1A 3DH8A 3X2ZA 2GMNA 4UWSB 1A7TA 4Z5ZA 2P1EA 5ACVA 3T3NA 5HH4A 2AZ4A 2FHXB 3JXPA 1A8TA 5HISA 2WYMC 4LE6A 2M5DA 2DOOA 4UAMA 1JJTA 5EV8A 3ZR9A 2Q9UA 2BG2A 3T9MA 1YCGA 3KNSA 5LE1A 2CBNA 4AD9A 3IEKA 2I7XA 5LS3A 4Z60A 2YNUA 3IE0A 3F9OA 5KIKA 2YNWA 4NQ5A 5AHOA 4EYLA 5EVKA 4D1UA 2XF4A 3SBLA 2FHXA 4D1VA 2BG6A 2GFJA 3ZNBA 2Y8BA 4TZFA 3DHAA 3Q6VA 3S0ZA 5A0VA 4UBQA 4C1DA 1X8IA 1KO2A 3PG4A 1E5DA 2FU6A 2NZFA 3R2UA 4B87A 1KR3A 3G1PA 2WYMA 3IDZA 5FQCA 5HH6A 5B1UA 5AEBA 3SPUA 1DDKA 5EWAA 4RAMA 1WRAA 5HH5A 5LCHA 2QDTA 4HL2A 3A4YA 4AX0B 4P62A 1VMEA 5EW0A 4FSBA 5LSCA 5A5ZA 4EYFA
chains in the Genus database with same CATH superfamily
2GFKA 3PY6A 4BZ3A 4ZEJA 4UWRB 2YNVB 4C1HA 2Q0JA 1ZKPA 2NZEA 5DPXA 2FU8A 2FU9A 1ZTCA 4J5HA 1BC2A 3MD7A 5AXOA 1K07A 5A0TA 2BFZA 3I13A 3I11A 2OHJA 1DXKA 2FU7A 2GCUA 1WUPA 5ACQA 4YSKA 3KNRA 1BMCA 5LM6A 3X30A 2DKFA 2BG8B 1VGNA 3T3OA 1SMLA 4EY2A 4XUKA 2YNTB 2UYXA 2A7MA 4XWWA 2AIOA 2E7YA 3FAIA 2Q0IA 2YNVA 2GKLA 5K4NA 1MQOA 5IQKA 1XM8A 4UA4A 3RKKA 4D02A 3IE2A 2WHGA 2NYPA 2Y87A 2ZWRA 4FEKA 3TP9A 2NXAA 1M2XA 3BC2A 3VPEA 3AJ3A 5A23A 4ZO2A 5B15A 2OHIA 1QH5A 2BFLA 2BMIA 4BP0A 4Z6XA 3PY5A 4AWYB 4RL2A 3DHBA 1KO3A 2M5CA 5B3RA 4NQ2A 2BG8A 5ACUA 2P18A 4GCWA 4ZO3A 2WYLA 2BFKA 2CFUA 4D1WA 2FK6A 4TYFA 1L9YA 3X2XA 4RM5A 5ACWA 4NURA 3SW3A 3ADRA 2OHHA 2P97A 3LVZA 3AF6A 2BIBA 4NQ6A 5A87A 5AHRA 4TZEA 5HIQA 1P9EA 1QH3A 3ZQ4A 1DD6A 3FCZA 2QJSA 3SFPA 2BC2A 4O98A 4U4LA 4V0HA 1JT1A 3IOFA 1WW1A 2Y8AA 5FQBA 4D1TA 3P2UA 5K4MA 3BV6A 3I15A 3VQZA 2FM6A 5LCFA 5KILA 3X2YA 4UWPB 1JJEA 4ZNBA 4JO0A 5EVBA 4EYBA 2CG3A 2H6AA 2BFZB 2YCBA 4FR7A 2R2DA 2I7VA 4PVTA 3RKJA 4CHLA 2BGAA 4C1FA 5HIOA 4GYUA 2CFZA 4WD6A 4C1EA 1XTOA 3SD9A 4KEQA 3DHCA 4AV7A 3RPCA 4AXHA 3IE1A 5AXRA 2Q42A 4XWTA 5ACPA 4GYQA 5ACTA 2QINA 5AYAA 3I14A 1Y44A 3KL7A 2BG7A 4YSBA 3ZWFA 2XR1A 1ZNBA 2ZNBA 4C1GA 5EV6A 5LMCA 4HL1A 4H0DA 3QH8A 2VW8A 4C1CA 4Z7RA 4NQ4A 2BR6A 5LCAA 5ACXA 5LLDA 4UWOB 1X8HA 1HLKA 4AX1B 4TZBA 5K4KA 1BVTA 5AJLA 2BTNA 4EXSA 1WUOA 3IEMA 5EVDA 2QDSA 4J5FA 3H3EA 2HB9A 3IELA 4RL0A 2ZO4A 2P4ZA 2QEDA 1VJNA 4AWZA 4EXYA 4YSLA 1YCHA 1YCFA 4Z5YA 2WRSA 5EH9A 5EHTA 5ACRA 4F6ZA 3WXCA 4KEPA 4DILA 4TZ9A 3SRXA 2YZ3A 3ESHA 2YNTA 3IOGA 4DIKA 4Z67A 4TYTA 3I0VA 5K0WA 2YHEA 2ZZIA 4RBSA 2CG2A 4EFZA 4RAWA 5ACSA 4HKYA 4PVOA 5HIPA 5FQAA 4F6HA 4C09A 2I7TA 3BK2A 3AF5A 1X8GA 3L6NA 3BK1A 3DH8A 3X2ZA 2GMNA 4UWSB 1A7TA 4Z5ZA 2P1EA 5ACVA 3T3NA 5HH4A 2AZ4A 2FHXB 3JXPA 1A8TA 5HISA 2WYMC 4LE6A 2M5DA 2DOOA 4UAMA 1JJTA 5EV8A 3ZR9A 2Q9UA 2BG2A 3T9MA 1YCGA 3KNSA 5LE1A 2CBNA 4AD9A 3IEKA 2I7XA 5LS3A 4Z60A 2YNUA 3IE0A 3F9OA 5KIKA 2YNWA 4NQ5A 5AHOA 4EYLA 5EVKA 4D1UA 2XF4A 3SBLA 2FHXA 4D1VA 2BG6A 2GFJA 3ZNBA 2Y8BA 4TZFA 3DHAA 3Q6VA 3S0ZA 5A0VA 4UBQA 4C1DA 1X8IA 1KO2A 3PG4A 1E5DA 5AIJA 2FU6A 2NZFA 3R2UA 4B87A 1KR3A 3G1PA 2WYMA 3IDZA 4PDXA 5FQCA 5HH6A 5B1UA 5AEBA 3SPUA 1DDKA 5EWAA 4RAMA 1WRAA 5HH5A 5LCHA 2QDTA 4HL2A 3A4YA 4AX0B 4P62A 1VMEA 5EW0A 4FSBA 5LSCA 5A5ZA 4EYFA
chains in the Genus database with same CATH topology
2GFKA 3PY6A 4BZ3A 4ZEJA 4UWRB 2YNVB 4C1HA 2Q0JA 1ZKPA 2NZEA 5DPXA 2FU8A 2FU9A 1ZTCA 4J5HA 1BC2A 3MD7A 5AXOA 1K07A 5A0TA 2BFZA 3I13A 3I11A 2OHJA 1DXKA 2FU7A 2GCUA 1WUPA 5ACQA 4YSKA 3KNRA 1BMCA 5LM6A 3X30A 2DKFA 2BG8B 1VGNA 3T3OA 1SMLA 4EY2A 4XUKA 2YNTB 2UYXA 2A7MA 4XWWA 2AIOA 2E7YA 3FAIA 2Q0IA 2YNVA 2GKLA 5K4NA 1MQOA 5IQKA 1XM8A 4UA4A 3RKKA 4D02A 3IE2A 2WHGA 2NYPA 2Y87A 2ZWRA 4FEKA 3TP9A 2NXAA 1M2XA 3BC2A 3VPEA 3AJ3A 4ZO2A 5B15A 2OHIA 1QH5A 2BFLA 2BMIA 4BP0A 4Z6XA 3PY5A 4AWYB 4RL2A 3DHBA 1KO3A 2M5CA 5B3RA 4NQ2A 2BG8A 5ACUA 2P18A 4GCWA 4ZO3A 2WYLA 2BFKA 4D1WA 2FK6A 4TYFA 1L9YA 3X2XA 4RM5A 5ACWA 3SW3A 3ADRA 2OHHA 2P97A 3LVZA 3AF6A 2BIBA 4NQ6A 5A87A 5AHRA 4TZEA 5HIQA 1P9EA 1QH3A 3ZQ4A 1DD6A 3FCZA 2QJSA 3SFPA 2BC2A 4O98A 4U4LA 4V0HA 1JT1A 3IOFA 1WW1A 2Y8AA 5FQBA 4D1TA 3P2UA 5K4MA 3BV6A 3I15A 3VQZA 2FM6A 5LCFA 5KILA 3X2YA 4UWPB 1JJEA 4ZNBA 4JO0A 5EVBA 4EYBA 2H6AA 2BFZB 2YCBA 4FR7A 2R2DA 2I7VA 4PVTA 3RKJA 4CHLA 2BGAA 4C1FA 5HIOA 4GYUA 4WD6A 4C1EA 1XTOA 3SD9A 4KEQA 3DHCA 3RPCA 3IE1A 5AXRA 2Q42A 4XWTA 5ACPA 4GYQA 5ACTA 2QINA 5AYAA 3I14A 1Y44A 3KL7A 2BG7A 4YSBA 3ZWFA 2XR1A 1ZNBA 2ZNBA 4C1GA 5EV6A 5LMCA 4HL1A 4H0DA 3QH8A 2VW8A 4C1CA 4Z7RA 4NQ4A 2BR6A 5LCAA 5ACXA 5LLDA 4UWOB 1X8HA 1HLKA 4AX1B 4TZBA 5K4KA 1BVTA 2BTNA 4EXSA 1WUOA 3IEMA 5EVDA 2QDSA 4J5FA 3H3EA 2HB9A 3IELA 4RL0A 2ZO4A 2P4ZA 2QEDA 1VJNA 4AWZA 4EXYA 4YSLA 1YCHA 1YCFA 4Z5YA 2WRSA 5EH9A 5EHTA 5ACRA 4F6ZA 3WXCA 4KEPA 4DILA 4TZ9A 3SRXA 2YZ3A 3ESHA 2YNTA 3IOGA 4DIKA 4Z67A 4TYTA 3I0VA 5K0WA 2ZZIA 4RBSA 4EFZA 4RAWA 5ACSA 4HKYA 4PVOA 5HIPA 5FQAA 4F6HA 4C09A 2I7TA 3BK2A 3AF5A 1X8GA 3L6NA 3BK1A 3DH8A 3X2ZA 2GMNA 4UWSB 1A7TA 4Z5ZA 2P1EA 5ACVA 3T3NA 5HH4A 2AZ4A 2FHXB 3JXPA 1A8TA 5HISA 2WYMC 4LE6A 2M5DA 2DOOA 4UAMA 1JJTA 5EV8A 3ZR9A 2Q9UA 2BG2A 3T9MA 1YCGA 3KNSA 5LE1A 2CBNA 4AD9A 3IEKA 2I7XA 5LS3A 4Z60A 2YNUA 3IE0A 3F9OA 5KIKA 2YNWA 4NQ5A 5AHOA 4EYLA 5EVKA 4D1UA 2XF4A 3SBLA 2FHXA 4D1VA 2BG6A 2GFJA 3ZNBA 2Y8BA 4TZFA 3DHAA 3Q6VA 3S0ZA 5A0VA 4UBQA 4C1DA 1X8IA 1KO2A 3PG4A 1E5DA 2FU6A 2NZFA 3R2UA 4B87A 1KR3A 3G1PA 2WYMA 3IDZA 5FQCA 5HH6A 5B1UA 5AEBA 3SPUA 1DDKA 5EWAA 4RAMA 1WRAA 5HH5A 5LCHA 2QDTA 4HL2A 3A4YA 4AX0B 4P62A 1VMEA 5EW0A 4FSBA 5LSCA 5A5ZA 4EYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GFK A;  3PY6 A;  4BZ3 A;  4ZEJ A;  4UWR B;  2YNV B;  4C1H A;  2Q0J A;  1ZKP A;  2NZE A;  5DPX A;  2FU8 A;  2FU9 A;  1ZTC A;  4J5H A;  1BC2 A;  3MD7 A;  5AXO A;  1K07 A;  5A0T A;  2BFZ A;  3I13 A;  3I11 A;  2OHJ A;  1DXK A;  2FU7 A;  2GCU A;  1WUP A;  5ACQ A;  4YSK A;  3KNR A;  1BMC A;  5LM6 A;  3X30 A;  2DKF A;  2BG8 B;  1VGN A;  3T3O A;  1SML A;  4EY2 A;  4XUK A;  2YNT B;  2UYX A;  2A7M A;  4XWW A;  2AIO A;  2E7Y A;  3FAI A;  2Q0I A;  2YNV A;  2GKL A;  5K4N A;  1MQO A;  5IQK A;  1XM8 A;  4UA4 A;  3RKK A;  4D02 A;  3IE2 A;  2WHG A;  2NYP A;  2Y87 A;  2ZWR A;  4FEK A;  3TP9 A;  2NXA A;  1M2X A;  3BC2 A;  3VPE A;  3AJ3 A;  4ZO2 A;  5B15 A;  2OHI A;  1QH5 A;  2BFL A;  2BMI A;  4BP0 A;  4Z6X A;  3PY5 A;  4AWY B;  4RL2 A;  3DHB A;  1KO3 A;  2M5C A;  5B3R A;  4NQ2 A;  2BG8 A;  5ACU A;  2P18 A;  4GCW A;  4ZO3 A;  2WYL A;  2BFK A;  4D1W A;  2FK6 A;  4TYF A;  1L9Y A;  3X2X A;  4RM5 A;  5ACW A;  3SW3 A;  3ADR A;  2OHH A;  2P97 A;  3LVZ A;  3AF6 A;  2BIB A;  4NQ6 A;  5A87 A;  5AHR A;  4TZE A;  5HIQ A;  1P9E A;  1QH3 A;  3ZQ4 A;  1DD6 A;  3FCZ A;  2QJS A;  3SFP A;  2BC2 A;  4O98 A;  4U4L A;  4V0H A;  1JT1 A;  3IOF A;  1WW1 A;  2Y8A A;  5FQB A;  4D1T A;  3P2U A;  5K4M A;  3BV6 A;  3I15 A;  3VQZ A;  2FM6 A;  5LCF A;  5KIL A;  3X2Y A;  4UWP B;  1JJE A;  4ZNB A;  4JO0 A;  5EVB A;  4EYB A;  2H6A A;  2BFZ B;  2YCB A;  4FR7 A;  2R2D A;  2I7V A;  4PVT A;  3RKJ A;  4CHL A;  2BGA A;  4C1F A;  5HIO A;  4GYU A;  4WD6 A;  4C1E A;  1XTO A;  3SD9 A;  4KEQ A;  3DHC A;  3RPC A;  3IE1 A;  5AXR A;  2Q42 A;  4XWT A;  5ACP A;  4GYQ A;  5ACT A;  2QIN A;  5AYA A;  3I14 A;  1Y44 A;  3KL7 A;  2BG7 A;  4YSB A;  3ZWF A;  2XR1 A;  1ZNB A;  2ZNB A;  4C1G A;  5EV6 A;  5LMC A;  4HL1 A;  4H0D A;  3QH8 A;  2VW8 A;  4C1C A;  4Z7R A;  4NQ4 A;  2BR6 A;  5LCA A;  5ACX A;  5LLD A;  4UWO B;  1X8H A;  1HLK A;  4AX1 B;  4TZB A;  5K4K A;  1BVT A;  2BTN A;  4EXS A;  1WUO A;  3IEM A;  5EVD A;  2QDS A;  4J5F A;  3H3E A;  2HB9 A;  3IEL A;  4RL0 A;  2ZO4 A;  2P4Z A;  2QED A;  1VJN A;  4AWZ A;  4EXY A;  4YSL A;  1YCH A;  1YCF A;  4Z5Y A;  2WRS A;  5EH9 A;  5EHT A;  5ACR A;  4F6Z A;  3WXC A;  4KEP A;  4DIL A;  4TZ9 A;  3SRX A;  2YZ3 A;  3ESH A;  2YNT A;  3IOG A;  4DIK A;  4Z67 A;  4TYT A;  3I0V A;  5K0W A;  2ZZI A;  4RBS A;  4EFZ A;  4RAW A;  5ACS A;  4HKY A;  4PVO A;  5HIP A;  5FQA A;  4F6H A;  4C09 A;  2I7T A;  3BK2 A;  3AF5 A;  1X8G A;  3L6N A;  3BK1 A;  3DH8 A;  3X2Z A;  2GMN A;  4UWS B;  1A7T A;  4Z5Z A;  2P1E A;  5ACV A;  3T3N A;  5HH4 A;  2AZ4 A;  2FHX B;  3JXP A;  1A8T A;  5HIS A;  2WYM C;  4LE6 A;  2M5D A;  2DOO A;  4UAM A;  1JJT A;  5EV8 A;  3ZR9 A;  2Q9U A;  2BG2 A;  3T9M A;  1YCG A;  3KNS A;  5LE1 A;  2CBN A;  4AD9 A;  3IEK A;  2I7X A;  5LS3 A;  4Z60 A;  2YNU A;  3IE0 A;  3F9O A;  5KIK A;  2YNW A;  4NQ5 A;  5AHO A;  4EYL A;  5EVK A;  4D1U A;  2XF4 A;  3SBL A;  2FHX A;  4D1V A;  2BG6 A;  2GFJ A;  3ZNB A;  2Y8B A;  4TZF A;  3DHA A;  3Q6V A;  3S0Z A;  5A0V A;  4UBQ A;  4C1D A;  1X8I A;  1KO2 A;  3PG4 A;  1E5D A;  2FU6 A;  2NZF A;  3R2U A;  4B87 A;  1KR3 A;  3G1P A;  2WYM A;  3IDZ A;  5FQC A;  5HH6 A;  5B1U A;  5AEB A;  3SPU A;  1DDK A;  5EWA A;  4RAM A;  1WRA A;  5HH5 A;  5LCH A;  2QDT A;  4HL2 A;  3A4Y A;  4AX0 B;  4P62 A;  1VME A;  5EW0 A;  4FSB A;  5LSC A;  5A5Z A;  4EYF A; 
#chains in the Genus database with same CATH topology
 2GFK A;  3PY6 A;  4BZ3 A;  4ZEJ A;  4UWR B;  2YNV B;  4C1H A;  2Q0J A;  1ZKP A;  2NZE A;  5DPX A;  2FU8 A;  2FU9 A;  1ZTC A;  4J5H A;  1BC2 A;  3MD7 A;  5AXO A;  1K07 A;  5A0T A;  2BFZ A;  3I13 A;  3I11 A;  2OHJ A;  1DXK A;  2FU7 A;  2GCU A;  1WUP A;  5ACQ A;  4YSK A;  3KNR A;  1BMC A;  5LM6 A;  3X30 A;  2DKF A;  2BG8 B;  1VGN A;  3T3O A;  1SML A;  4EY2 A;  4XUK A;  2YNT B;  2UYX A;  2A7M A;  4XWW A;  2AIO A;  2E7Y A;  3FAI A;  2Q0I A;  2YNV A;  2GKL A;  5K4N A;  1MQO A;  5IQK A;  1XM8 A;  4UA4 A;  3RKK A;  4D02 A;  3IE2 A;  2WHG A;  2NYP A;  2Y87 A;  2ZWR A;  4FEK A;  3TP9 A;  2NXA A;  1M2X A;  3BC2 A;  3VPE A;  3AJ3 A;  5A23 A;  4ZO2 A;  5B15 A;  2OHI A;  1QH5 A;  2BFL A;  2BMI A;  4BP0 A;  4Z6X A;  3PY5 A;  4AWY B;  4RL2 A;  3DHB A;  1KO3 A;  2M5C A;  5B3R A;  4NQ2 A;  2BG8 A;  5ACU A;  2P18 A;  4GCW A;  4ZO3 A;  2WYL A;  2BFK A;  2CFU A;  4D1W A;  2FK6 A;  4TYF A;  1L9Y A;  3X2X A;  4RM5 A;  5ACW A;  4NUR A;  3SW3 A;  3ADR A;  2OHH A;  2P97 A;  3LVZ A;  3AF6 A;  2BIB A;  4NQ6 A;  5A87 A;  5AHR A;  4TZE A;  5HIQ A;  1P9E A;  1QH3 A;  3ZQ4 A;  1DD6 A;  3FCZ A;  2QJS A;  3SFP A;  2BC2 A;  4O98 A;  4U4L A;  4V0H A;  1JT1 A;  3IOF A;  1WW1 A;  2Y8A A;  5FQB A;  4D1T A;  3P2U A;  5K4M A;  3BV6 A;  3I15 A;  3VQZ A;  2FM6 A;  5LCF A;  5KIL A;  3X2Y A;  4UWP B;  1JJE A;  4ZNB A;  4JO0 A;  5EVB A;  4EYB A;  2CG3 A;  2H6A A;  2BFZ B;  2YCB A;  4FR7 A;  2R2D A;  2I7V A;  4PVT A;  3RKJ A;  4CHL A;  2BGA A;  4C1F A;  5HIO A;  4GYU A;  2CFZ A;  4WD6 A;  4C1E A;  1XTO A;  3SD9 A;  4KEQ A;  3DHC A;  4AV7 A;  3RPC A;  4AXH A;  3IE1 A;  5AXR A;  2Q42 A;  4XWT A;  5ACP A;  4GYQ A;  5ACT A;  2QIN A;  5AYA A;  3I14 A;  1Y44 A;  3KL7 A;  2BG7 A;  4YSB A;  3ZWF A;  2XR1 A;  1ZNB A;  2ZNB A;  4C1G A;  5EV6 A;  5LMC A;  4HL1 A;  4H0D A;  3QH8 A;  2VW8 A;  4C1C A;  4Z7R A;  4NQ4 A;  2BR6 A;  5LCA A;  5ACX A;  5LLD A;  4UWO B;  1X8H A;  1HLK A;  4AX1 B;  4TZB A;  5K4K A;  1BVT A;  5AJL A;  2BTN A;  4EXS A;  1WUO A;  3IEM A;  5EVD A;  2QDS A;  4J5F A;  3H3E A;  2HB9 A;  3IEL A;  4RL0 A;  2ZO4 A;  2P4Z A;  2QED A;  1VJN A;  4AWZ A;  4EXY A;  4YSL A;  1YCH A;  1YCF A;  4Z5Y A;  2WRS A;  5EH9 A;  5EHT A;  5ACR A;  4F6Z A;  3WXC A;  4KEP A;  4DIL A;  4TZ9 A;  3SRX A;  2YZ3 A;  3ESH A;  2YNT A;  3IOG A;  4DIK A;  4Z67 A;  4TYT A;  3I0V A;  5K0W A;  2YHE A;  2ZZI A;  4RBS A;  2CG2 A;  4EFZ A;  4RAW A;  5ACS A;  4HKY A;  4PVO A;  5HIP A;  5FQA A;  4F6H A;  4C09 A;  2I7T A;  3BK2 A;  3AF5 A;  1X8G A;  3L6N A;  3BK1 A;  3DH8 A;  3X2Z A;  2GMN A;  4UWS B;  1A7T A;  4Z5Z A;  2P1E A;  5ACV A;  3T3N A;  5HH4 A;  2AZ4 A;  2FHX B;  3JXP A;  1A8T A;  5HIS A;  2WYM C;  4LE6 A;  2M5D A;  2DOO A;  4UAM A;  1JJT A;  5EV8 A;  3ZR9 A;  2Q9U A;  2BG2 A;  3T9M A;  1YCG A;  3KNS A;  5LE1 A;  2CBN A;  4AD9 A;  3IEK A;  2I7X A;  5LS3 A;  4Z60 A;  2YNU A;  3IE0 A;  3F9O A;  5KIK A;  2YNW A;  4NQ5 A;  5AHO A;  4EYL A;  5EVK A;  4D1U A;  2XF4 A;  3SBL A;  2FHX A;  4D1V A;  2BG6 A;  2GFJ A;  3ZNB A;  2Y8B A;  4TZF A;  3DHA A;  3Q6V A;  3S0Z A;  5A0V A;  4UBQ A;  4C1D A;  1X8I A;  1KO2 A;  3PG4 A;  1E5D A;  5AIJ A;  2FU6 A;  2NZF A;  3R2U A;  4B87 A;  1KR3 A;  3G1P A;  2WYM A;  3IDZ A;  4PDX A;  5FQC A;  5HH6 A;  5B1U A;  5AEB A;  3SPU A;  1DDK A;  5EWA A;  4RAM A;  1WRA A;  5HH5 A;  5LCH A;  2QDT A;  4HL2 A;  3A4Y A;  4AX0 B;  4P62 A;  1VME A;  5EW0 A;  4FSB A;  5LSC A;  5A5Z A;  4EYF A; 
#chains in the Genus database with same CATH homology
 2GFK A;  3PY6 A;  4BZ3 A;  4ZEJ A;  4UWR B;  2YNV B;  4C1H A;  2Q0J A;  1ZKP A;  2NZE A;  5DPX A;  2FU8 A;  2FU9 A;  1ZTC A;  4J5H A;  1BC2 A;  3MD7 A;  5AXO A;  1K07 A;  5A0T A;  2BFZ A;  3I13 A;  3I11 A;  2OHJ A;  1DXK A;  2FU7 A;  2GCU A;  1WUP A;  5ACQ A;  4YSK A;  3KNR A;  1BMC A;  5LM6 A;  3X30 A;  2DKF A;  2BG8 B;  1VGN A;  3T3O A;  1SML A;  4EY2 A;  4XUK A;  2YNT B;  2UYX A;  2A7M A;  4XWW A;  2AIO A;  2E7Y A;  3FAI A;  2Q0I A;  2YNV A;  2GKL A;  5K4N A;  1MQO A;  5IQK A;  1XM8 A;  4UA4 A;  3RKK A;  4D02 A;  3IE2 A;  2WHG A;  2NYP A;  2Y87 A;  2ZWR A;  4FEK A;  3TP9 A;  2NXA A;  1M2X A;  3BC2 A;  3VPE A;  3AJ3 A;  4ZO2 A;  5B15 A;  2OHI A;  1QH5 A;  2BFL A;  2BMI A;  4BP0 A;  4Z6X A;  3PY5 A;  4AWY B;  4RL2 A;  3DHB A;  1KO3 A;  2M5C A;  5B3R A;  4NQ2 A;  2BG8 A;  5ACU A;  2P18 A;  4GCW A;  4ZO3 A;  2WYL A;  2BFK A;  4D1W A;  2FK6 A;  4TYF A;  1L9Y A;  3X2X A;  4RM5 A;  5ACW A;  3SW3 A;  3ADR A;  2OHH A;  2P97 A;  3LVZ A;  3AF6 A;  2BIB A;  4NQ6 A;  5A87 A;  5AHR A;  4TZE A;  5HIQ A;  1P9E A;  1QH3 A;  3ZQ4 A;  1DD6 A;  3FCZ A;  2QJS A;  3SFP A;  2BC2 A;  4O98 A;  4U4L A;  4V0H A;  1JT1 A;  3IOF A;  1WW1 A;  2Y8A A;  5FQB A;  4D1T A;  3P2U A;  5K4M A;  3BV6 A;  3I15 A;  3VQZ A;  2FM6 A;  5LCF A;  5KIL A;  3X2Y A;  4UWP B;  1JJE A;  4ZNB A;  4JO0 A;  5EVB A;  4EYB A;  2H6A A;  2BFZ B;  2YCB A;  4FR7 A;  2R2D A;  2I7V A;  4PVT A;  3RKJ A;  4CHL A;  2BGA A;  4C1F A;  5HIO A;  4GYU A;  4WD6 A;  4C1E A;  1XTO A;  3SD9 A;  4KEQ A;  3DHC A;  3RPC A;  3IE1 A;  5AXR A;  2Q42 A;  4XWT A;  5ACP A;  4GYQ A;  5ACT A;  2QIN A;  5AYA A;  3I14 A;  1Y44 A;  3KL7 A;  2BG7 A;  4YSB A;  3ZWF A;  2XR1 A;  1ZNB A;  2ZNB A;  4C1G A;  5EV6 A;  5LMC A;  4HL1 A;  4H0D A;  3QH8 A;  2VW8 A;  4C1C A;  4Z7R A;  4NQ4 A;  2BR6 A;  5LCA A;  5ACX A;  5LLD A;  4UWO B;  1X8H A;  1HLK A;  4AX1 B;  4TZB A;  5K4K A;  1BVT A;  2BTN A;  4EXS A;  1WUO A;  3IEM A;  5EVD A;  2QDS A;  4J5F A;  3H3E A;  2HB9 A;  3IEL A;  4RL0 A;  2ZO4 A;  2P4Z A;  2QED A;  1VJN A;  4AWZ A;  4EXY A;  4YSL A;  1YCH A;  1YCF A;  4Z5Y A;  2WRS A;  5EH9 A;  5EHT A;  5ACR A;  4F6Z A;  3WXC A;  4KEP A;  4DIL A;  4TZ9 A;  3SRX A;  2YZ3 A;  3ESH A;  2YNT A;  3IOG A;  4DIK A;  4Z67 A;  4TYT A;  3I0V A;  5K0W A;  2ZZI A;  4RBS A;  4EFZ A;  4RAW A;  5ACS A;  4HKY A;  4PVO A;  5HIP A;  5FQA A;  4F6H A;  4C09 A;  2I7T A;  3BK2 A;  3AF5 A;  1X8G A;  3L6N A;  3BK1 A;  3DH8 A;  3X2Z A;  2GMN A;  4UWS B;  1A7T A;  4Z5Z A;  2P1E A;  5ACV A;  3T3N A;  5HH4 A;  2AZ4 A;  2FHX B;  3JXP A;  1A8T A;  5HIS A;  2WYM C;  4LE6 A;  2M5D A;  2DOO A;  4UAM A;  1JJT A;  5EV8 A;  3ZR9 A;  2Q9U A;  2BG2 A;  3T9M A;  1YCG A;  3KNS A;  5LE1 A;  2CBN A;  4AD9 A;  3IEK A;  2I7X A;  5LS3 A;  4Z60 A;  2YNU A;  3IE0 A;  3F9O A;  5KIK A;  2YNW A;  4NQ5 A;  5AHO A;  4EYL A;  5EVK A;  4D1U A;  2XF4 A;  3SBL A;  2FHX A;  4D1V A;  2BG6 A;  2GFJ A;  3ZNB A;  2Y8B A;  4TZF A;  3DHA A;  3Q6V A;  3S0Z A;  5A0V A;  4UBQ A;  4C1D A;  1X8I A;  1KO2 A;  3PG4 A;  1E5D A;  2FU6 A;  2NZF A;  3R2U A;  4B87 A;  1KR3 A;  3G1P A;  2WYM A;  3IDZ A;  5FQC A;  5HH6 A;  5B1U A;  5AEB A;  3SPU A;  1DDK A;  5EWA A;  4RAM A;  1WRA A;  5HH5 A;  5LCH A;  2QDT A;  4HL2 A;  3A4Y A;  4AX0 B;  4P62 A;  1VME A;  5EW0 A;  4FSB A;  5LSC A;  5A5Z A;  4EYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...