5HH4A

Crystal structure of metallo-beta-lactamase imp-1 in complex with a phosphonate-based inhibitor
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
218
structure length
218
Chain Sequence
b'SLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase IMP-1
publication title Structural and Kinetic Studies of the Potent Inhibition of Metallo-beta-lactamases by 6-Phosphonomethylpyridine-2-carboxylates.
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Hydrolase
total genus 61
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5hh4A00
2NZEA 3AJ3A 4YSKA 3FAIA 5EW0A 2GFKA 2FM6A 5K0WA 1M2XA 4NQ4A 2OHJA 3H3EA 3QH8A 4CHLA 4TZFA 5LMCA 2GCUA 4FSBA 3BC2A 2NYPA 3DH8A 3LVZA 4PVOA 5KILA 2OHHA 5A0TA 5HH6A 2YNVA 2P4ZA 3SBLA 2BG8A 2YNWA 3L6NA 4F6HA 4ZO3A 5LS3A 5AHRA 3BK2A 2YNTB 2AZ4A 3RPCA 3ESHA 4FR7A 5B1UA 5KIKA 3WXCA 2P97A 3VQZA 4BP0A 4XUKA 4J5HA 1WRAA 2BFKA 4LE6A 4TZEA 4U4LA 5B3RA 2ZZIA 5ACSA 1WW1A 4AWYB 1X8IA 5AHOA 5FQBA 1YCHA 3G1PA 2ZNBA 3DHCA 4C09A 3A4YA 5AEBA 5AXOA 1A8TA 1ZNBA 5EVKA 2I7XA 5LE1A 3IE2A 2M5DA 2DKFA 5HH4A 3RKJA 4Z67A 1X8GA 2A7MA 4AD9A 2ZO4A 3T3OA 3X2ZA 2NZFA 4UAMA 2UYXA 5HIOA 2BFZA 1XTOA 4JO0A 3PG4A 4KEQA 3PY5A 5EHTA 4DIKA 4ZO2A 3KL7A 5K4KA 4RL0A 2R2DA 4UWRB 2Q0JA 5A87A 4YSBA 3ADRA 4ZNBA 2ZWRA 4UWSB 2BG6A 2FHXB 4TYFA 1ZTCA 5K4NA 5EVBA 3JXPA 1KO3A 2QINA 5HH5A 4HL2A 5EH9A 3RKKA 3I15A 3I11A 2WRSA 2AIOA 2WYLA 2I7TA 1DXKA 1QH5A 2QEDA 3X2XA 4EY2A 4C1CA 4D02A 3R2UA 3IE0A 2FK6A 2DOOA 4TYTA 3SFPA 3FCZA 3SRXA 3BK1A 5ACXA 3AF5A 5A5ZA 1JJTA 3BV6A 2CBNA 1DDKA 2FU9A 1VJNA 4NQ2A 4D1WA 2YCBA 4XWTA 4BZ3A 1KR3A 2M5CA 2XR1A 4O98A 4EFZA 4P62A 3AF6A 2YNUA 4AWZA 4C1FA 1X8HA 1WUPA 1XM8A 2YNTA 1DD6A 4DILA 1K07A 4Z60A 4RAWA 3KNRA 2BMIA 4GCWA 1QH3A 4UWOB 3ZQ4A 1JJEA 5ACRA 1BC2A 3IELA 5FQCA 1VMEA 5LCAA 2WYMA 2OHIA 4YSLA 4EXSA 2FU6A 5ACWA 2P1EA 4RL2A 1MQOA 2BG2A 1VGNA 3IEMA 4C1EA 5LLDA 3S0ZA 5ACPA 2FU8A 2QJSA 2Q0IA 2HB9A 4UA4A 4EXYA 5EV8A 5LCFA 5DPXA 5EWAA 2P18A 4Z7RA 3P2UA 2FU7A 2BTNA 2VW8A 2E7YA 3I0VA 4TZBA 1BMCA 2XF4A 1ZKPA 3IOFA 5LM6A 2FHXA 2YNVB 4D1TA 4KEPA 2BR6A 2BG8B 4FEKA 3IOGA 5AYAA 1YCGA 1WUOA 2Q42A 1A7TA 4D1VA 2H6AA 2YZ3A 5K4MA 4NQ6A 3X2YA 2NXAA 3T9MA 2BC2A 5ACQA 5EV6A 2GMNA 5LSCA 3I13A 2WYMC 3IE1A 4GYUA 5IQKA 4PVTA 4Z6XA 1YCFA 5ACUA 3I14A 3IEKA 3ZR9A 4B87A 4ZEJA 2Y8AA 1JT1A 4RM5A 4AX1B 3MD7A 4EYFA 3DHAA 2GKLA 3F9OA 3ZWFA 1HLKA 2WHGA 1E5DA 5EVDA 4AX0B 3IDZA 1L9YA 2Q9UA 5HISA 4V0HA 5B15A 2BFZB 3SD9A 3VPEA 2BFLA 2QDSA 4XWWA 2Y87A 1SMLA 5AXRA 4NQ5A 4EYBA 4RBSA 1KO2A 3KNSA 2Y8BA 4TZ9A 2I7VA 4UBQA 5HIQA 5FQAA 2GFJA 4C1HA 5ACVA 5ACTA 3T3NA 2BIBA 4C1GA 4Z5ZA 1BVTA 2BG7A 3SPUA 3DHBA 1P9EA 5HIPA 2QDTA 3ZNBA 4HL1A 4UWPB 3X30A 3PY6A 4GYQA 3TP9A 4F6ZA 4WD6A 2BGAA 3Q6VA 4J5FA 4HKYA 4Z5YA 4H0DA 4EYLA 5A0VA 5LCHA 4D1UA 1Y44A 4RAMA 3SW3A 4C1DA
chains in the Genus database with same CATH superfamily
2NZEA 3AJ3A 4YSKA 3FAIA 5EW0A 2GFKA 2FM6A 5K0WA 1M2XA 4NQ4A 2OHJA 3H3EA 3QH8A 4CHLA 4TZFA 5LMCA 2GCUA 4FSBA 3BC2A 2NYPA 3DH8A 3LVZA 4PVOA 5KILA 2OHHA 5A0TA 5HH6A 2YNVA 2P4ZA 3SBLA 2BG8A 2YNWA 3L6NA 4F6HA 4ZO3A 5LS3A 5AHRA 3BK2A 2YNTB 2AZ4A 3RPCA 4NURA 2YHEA 3ESHA 4FR7A 5B1UA 5KIKA 3WXCA 2P97A 3VQZA 4BP0A 4XUKA 4J5HA 1WRAA 2BFKA 4LE6A 4TZEA 4U4LA 5B3RA 2ZZIA 5ACSA 1WW1A 4AWYB 1X8IA 5AHOA 5FQBA 1YCHA 3G1PA 2ZNBA 3DHCA 4C09A 3A4YA 5AEBA 5AXOA 1A8TA 1ZNBA 5EVKA 2I7XA 5LE1A 3IE2A 2M5DA 2DKFA 5HH4A 3RKJA 4Z67A 1X8GA 2A7MA 4AD9A 2ZO4A 3T3OA 3X2ZA 2NZFA 4UAMA 2UYXA 5HIOA 2BFZA 1XTOA 4JO0A 3PG4A 4KEQA 3PY5A 5EHTA 4DIKA 4ZO2A 3KL7A 5K4KA 4RL0A 2R2DA 4UWRB 2Q0JA 5A87A 4YSBA 3ADRA 4ZNBA 2ZWRA 4UWSB 2BG6A 2FHXB 4AV7A 4TYFA 1ZTCA 5K4NA 5EVBA 3JXPA 1KO3A 2QINA 5HH5A 4HL2A 5EH9A 3RKKA 3I15A 3I11A 2WRSA 2CFZA 2AIOA 2WYLA 2I7TA 1DXKA 1QH5A 2QEDA 3X2XA 4EY2A 4C1CA 4D02A 3R2UA 3IE0A 2FK6A 2DOOA 4TYTA 3SFPA 3FCZA 3SRXA 3BK1A 5ACXA 3AF5A 5A5ZA 1JJTA 3BV6A 2CBNA 1DDKA 2FU9A 1VJNA 4NQ2A 4D1WA 2YCBA 4XWTA 4BZ3A 5AJLA 1KR3A 2M5CA 2XR1A 4O98A 4EFZA 2CG3A 4P62A 3AF6A 2YNUA 4AWZA 4C1FA 1X8HA 1WUPA 1XM8A 2YNTA 1DD6A 4DILA 1K07A 4Z60A 4RAWA 3KNRA 2BMIA 5AIJA 4GCWA 1QH3A 4UWOB 3ZQ4A 1JJEA 5ACRA 1BC2A 3IELA 5FQCA 1VMEA 5LCAA 2CG2A 2WYMA 2OHIA 4YSLA 4EXSA 2FU6A 5ACWA 2P1EA 4RL2A 1MQOA 2BG2A 1VGNA 3IEMA 4C1EA 5LLDA 3S0ZA 5ACPA 2FU8A 2QJSA 2Q0IA 2HB9A 4UA4A 4EXYA 5EV8A 5LCFA 5DPXA 5EWAA 2P18A 4Z7RA 3P2UA 2FU7A 2BTNA 2VW8A 2E7YA 3I0VA 4TZBA 1BMCA 2XF4A 1ZKPA 3IOFA 5LM6A 2FHXA 2YNVB 4D1TA 4KEPA 2BR6A 2BG8B 4FEKA 3IOGA 5AYAA 1YCGA 1WUOA 2Q42A 1A7TA 4D1VA 2H6AA 2YZ3A 5K4MA 4NQ6A 3X2YA 2NXAA 3T9MA 2BC2A 5ACQA 5EV6A 2GMNA 5LSCA 3I13A 2WYMC 3IE1A 4GYUA 5IQKA 4PVTA 4Z6XA 1YCFA 5ACUA 3I14A 3IEKA 3ZR9A 4B87A 4ZEJA 2Y8AA 1JT1A 4RM5A 4AX1B 3MD7A 4EYFA 3DHAA 2GKLA 3F9OA 2CFUA 5A23A 3ZWFA 1HLKA 2WHGA 1E5DA 5EVDA 4AX0B 3IDZA 1L9YA 2Q9UA 5HISA 4V0HA 5B15A 2BFZB 3SD9A 3VPEA 2BFLA 2QDSA 4AXHA 4XWWA 2Y87A 1SMLA 5AXRA 4NQ5A 4EYBA 4RBSA 1KO2A 3KNSA 2Y8BA 4TZ9A 2I7VA 4UBQA 5HIQA 5FQAA 2GFJA 4C1HA 5ACVA 5ACTA 3T3NA 2BIBA 4C1GA 4Z5ZA 1BVTA 2BG7A 3SPUA 3DHBA 1P9EA 5HIPA 2QDTA 3ZNBA 4HL1A 4UWPB 3X30A 3PY6A 4GYQA 3TP9A 4F6ZA 4WD6A 2BGAA 3Q6VA 4J5FA 4HKYA 4Z5YA 4H0DA 4EYLA 5A0VA 4PDXA 5LCHA 4D1UA 1Y44A 4RAMA 3SW3A 4C1DA
chains in the Genus database with same CATH topology
2NZEA 3AJ3A 4YSKA 3FAIA 5EW0A 2GFKA 2FM6A 5K0WA 1M2XA 4NQ4A 2OHJA 3H3EA 3QH8A 4CHLA 4TZFA 5LMCA 2GCUA 4FSBA 3BC2A 2NYPA 3DH8A 3LVZA 4PVOA 5KILA 2OHHA 5A0TA 5HH6A 2YNVA 2P4ZA 3SBLA 2BG8A 2YNWA 3L6NA 4F6HA 4ZO3A 5LS3A 5AHRA 3BK2A 2YNTB 2AZ4A 3RPCA 3ESHA 4FR7A 5B1UA 5KIKA 3WXCA 2P97A 3VQZA 4BP0A 4XUKA 4J5HA 1WRAA 2BFKA 4LE6A 4TZEA 4U4LA 5B3RA 2ZZIA 5ACSA 1WW1A 4AWYB 1X8IA 5AHOA 5FQBA 1YCHA 3G1PA 2ZNBA 3DHCA 4C09A 3A4YA 5AEBA 5AXOA 1A8TA 1ZNBA 5EVKA 2I7XA 5LE1A 3IE2A 2M5DA 2DKFA 5HH4A 3RKJA 4Z67A 1X8GA 2A7MA 4AD9A 2ZO4A 3T3OA 3X2ZA 2NZFA 4UAMA 2UYXA 5HIOA 2BFZA 1XTOA 4JO0A 3PG4A 4KEQA 3PY5A 5EHTA 4DIKA 4ZO2A 3KL7A 5K4KA 4RL0A 2R2DA 4UWRB 2Q0JA 5A87A 4YSBA 3ADRA 4ZNBA 2ZWRA 4UWSB 2BG6A 2FHXB 4TYFA 1ZTCA 5K4NA 5EVBA 3JXPA 1KO3A 2QINA 5HH5A 4HL2A 5EH9A 3RKKA 3I15A 3I11A 2WRSA 2AIOA 2WYLA 2I7TA 1DXKA 1QH5A 2QEDA 3X2XA 4EY2A 4C1CA 4D02A 3R2UA 3IE0A 2FK6A 2DOOA 4TYTA 3SFPA 3FCZA 3SRXA 3BK1A 5ACXA 3AF5A 5A5ZA 1JJTA 3BV6A 2CBNA 1DDKA 2FU9A 1VJNA 4NQ2A 4D1WA 2YCBA 4XWTA 4BZ3A 1KR3A 2M5CA 2XR1A 4O98A 4EFZA 4P62A 3AF6A 2YNUA 4AWZA 4C1FA 1X8HA 1WUPA 1XM8A 2YNTA 1DD6A 4DILA 1K07A 4Z60A 4RAWA 3KNRA 2BMIA 4GCWA 1QH3A 4UWOB 3ZQ4A 1JJEA 5ACRA 1BC2A 3IELA 5FQCA 1VMEA 5LCAA 2WYMA 2OHIA 4YSLA 4EXSA 2FU6A 5ACWA 2P1EA 4RL2A 1MQOA 2BG2A 1VGNA 3IEMA 4C1EA 5LLDA 3S0ZA 5ACPA 2FU8A 2QJSA 2Q0IA 2HB9A 4UA4A 4EXYA 5EV8A 5LCFA 5DPXA 5EWAA 2P18A 4Z7RA 3P2UA 2FU7A 2BTNA 2VW8A 2E7YA 3I0VA 4TZBA 1BMCA 2XF4A 1ZKPA 3IOFA 5LM6A 2FHXA 2YNVB 4D1TA 4KEPA 2BR6A 2BG8B 4FEKA 3IOGA 5AYAA 1YCGA 1WUOA 2Q42A 1A7TA 4D1VA 2H6AA 2YZ3A 5K4MA 4NQ6A 3X2YA 2NXAA 3T9MA 2BC2A 5ACQA 5EV6A 2GMNA 5LSCA 3I13A 2WYMC 3IE1A 4GYUA 5IQKA 4PVTA 4Z6XA 1YCFA 5ACUA 3I14A 3IEKA 3ZR9A 4B87A 4ZEJA 2Y8AA 1JT1A 4RM5A 4AX1B 3MD7A 4EYFA 3DHAA 2GKLA 3F9OA 3ZWFA 1HLKA 2WHGA 1E5DA 5EVDA 4AX0B 3IDZA 1L9YA 2Q9UA 5HISA 4V0HA 5B15A 2BFZB 3SD9A 3VPEA 2BFLA 2QDSA 4XWWA 2Y87A 1SMLA 5AXRA 4NQ5A 4EYBA 4RBSA 1KO2A 3KNSA 2Y8BA 4TZ9A 2I7VA 4UBQA 5HIQA 5FQAA 2GFJA 4C1HA 5ACVA 5ACTA 3T3NA 2BIBA 4C1GA 4Z5ZA 1BVTA 2BG7A 3SPUA 3DHBA 1P9EA 5HIPA 2QDTA 3ZNBA 4HL1A 4UWPB 3X30A 3PY6A 4GYQA 3TP9A 4F6ZA 4WD6A 2BGAA 3Q6VA 4J5FA 4HKYA 4Z5YA 4H0DA 4EYLA 5A0VA 5LCHA 4D1UA 1Y44A 4RAMA 3SW3A 4C1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NZE A;  3AJ3 A;  4YSK A;  3FAI A;  5EW0 A;  2GFK A;  2FM6 A;  5K0W A;  1M2X A;  4NQ4 A;  2OHJ A;  3H3E A;  3QH8 A;  4CHL A;  4TZF A;  5LMC A;  2GCU A;  4FSB A;  3BC2 A;  2NYP A;  3DH8 A;  3LVZ A;  4PVO A;  5KIL A;  2OHH A;  5A0T A;  5HH6 A;  2YNV A;  2P4Z A;  3SBL A;  2BG8 A;  2YNW A;  3L6N A;  4F6H A;  4ZO3 A;  5LS3 A;  5AHR A;  3BK2 A;  2YNT B;  2AZ4 A;  3RPC A;  3ESH A;  4FR7 A;  5B1U A;  5KIK A;  3WXC A;  2P97 A;  3VQZ A;  4BP0 A;  4XUK A;  4J5H A;  1WRA A;  2BFK A;  4LE6 A;  4TZE A;  4U4L A;  5B3R A;  2ZZI A;  5ACS A;  1WW1 A;  4AWY B;  1X8I A;  5AHO A;  5FQB A;  1YCH A;  3G1P A;  2ZNB A;  3DHC A;  4C09 A;  3A4Y A;  5AEB A;  5AXO A;  1A8T A;  1ZNB A;  5EVK A;  2I7X A;  5LE1 A;  3IE2 A;  2M5D A;  2DKF A;  5HH4 A;  3RKJ A;  4Z67 A;  1X8G A;  2A7M A;  4AD9 A;  2ZO4 A;  3T3O A;  3X2Z A;  2NZF A;  4UAM A;  2UYX A;  5HIO A;  2BFZ A;  1XTO A;  4JO0 A;  3PG4 A;  4KEQ A;  3PY5 A;  5EHT A;  4DIK A;  4ZO2 A;  3KL7 A;  5K4K A;  4RL0 A;  2R2D A;  4UWR B;  2Q0J A;  5A87 A;  4YSB A;  3ADR A;  4ZNB A;  2ZWR A;  4UWS B;  2BG6 A;  2FHX B;  4TYF A;  1ZTC A;  5K4N A;  5EVB A;  3JXP A;  1KO3 A;  2QIN A;  5HH5 A;  4HL2 A;  5EH9 A;  3RKK A;  3I15 A;  3I11 A;  2WRS A;  2AIO A;  2WYL A;  2I7T A;  1DXK A;  1QH5 A;  2QED A;  3X2X A;  4EY2 A;  4C1C A;  4D02 A;  3R2U A;  3IE0 A;  2FK6 A;  2DOO A;  4TYT A;  3SFP A;  3FCZ A;  3SRX A;  3BK1 A;  5ACX A;  3AF5 A;  5A5Z A;  1JJT A;  3BV6 A;  2CBN A;  1DDK A;  2FU9 A;  1VJN A;  4NQ2 A;  4D1W A;  2YCB A;  4XWT A;  4BZ3 A;  1KR3 A;  2M5C A;  2XR1 A;  4O98 A;  4EFZ A;  4P62 A;  3AF6 A;  2YNU A;  4AWZ A;  4C1F A;  1X8H A;  1WUP A;  1XM8 A;  2YNT A;  1DD6 A;  4DIL A;  1K07 A;  4Z60 A;  4RAW A;  3KNR A;  2BMI A;  4GCW A;  1QH3 A;  4UWO B;  3ZQ4 A;  1JJE A;  5ACR A;  1BC2 A;  3IEL A;  5FQC A;  1VME A;  5LCA A;  2WYM A;  2OHI A;  4YSL A;  4EXS A;  2FU6 A;  5ACW A;  2P1E A;  4RL2 A;  1MQO A;  2BG2 A;  1VGN A;  3IEM A;  4C1E A;  5LLD A;  3S0Z A;  5ACP A;  2FU8 A;  2QJS A;  2Q0I A;  2HB9 A;  4UA4 A;  4EXY A;  5EV8 A;  5LCF A;  5DPX A;  5EWA A;  2P18 A;  4Z7R A;  3P2U A;  2FU7 A;  2BTN A;  2VW8 A;  2E7Y A;  3I0V A;  4TZB A;  1BMC A;  2XF4 A;  1ZKP A;  3IOF A;  5LM6 A;  2FHX A;  2YNV B;  4D1T A;  4KEP A;  2BR6 A;  2BG8 B;  4FEK A;  3IOG A;  5AYA A;  1YCG A;  1WUO A;  2Q42 A;  1A7T A;  4D1V A;  2H6A A;  2YZ3 A;  5K4M A;  4NQ6 A;  3X2Y A;  2NXA A;  3T9M A;  2BC2 A;  5ACQ A;  5EV6 A;  2GMN A;  5LSC A;  3I13 A;  2WYM C;  3IE1 A;  4GYU A;  5IQK A;  4PVT A;  4Z6X A;  1YCF A;  5ACU A;  3I14 A;  3IEK A;  3ZR9 A;  4B87 A;  4ZEJ A;  2Y8A A;  1JT1 A;  4RM5 A;  4AX1 B;  3MD7 A;  4EYF A;  3DHA A;  2GKL A;  3F9O A;  3ZWF A;  1HLK A;  2WHG A;  1E5D A;  5EVD A;  4AX0 B;  3IDZ A;  1L9Y A;  2Q9U A;  5HIS A;  4V0H A;  5B15 A;  2BFZ B;  3SD9 A;  3VPE A;  2BFL A;  2QDS A;  4XWW A;  2Y87 A;  1SML A;  5AXR A;  4NQ5 A;  4EYB A;  4RBS A;  1KO2 A;  3KNS A;  2Y8B A;  4TZ9 A;  2I7V A;  4UBQ A;  5HIQ A;  5FQA A;  2GFJ A;  4C1H A;  5ACV A;  5ACT A;  3T3N A;  2BIB A;  4C1G A;  4Z5Z A;  1BVT A;  2BG7 A;  3SPU A;  3DHB A;  1P9E A;  5HIP A;  2QDT A;  3ZNB A;  4HL1 A;  4UWP B;  3X30 A;  3PY6 A;  4GYQ A;  3TP9 A;  4F6Z A;  4WD6 A;  2BGA A;  3Q6V A;  4J5F A;  4HKY A;  4Z5Y A;  4H0D A;  4EYL A;  5A0V A;  5LCH A;  4D1U A;  1Y44 A;  4RAM A;  3SW3 A;  4C1D A; 
#chains in the Genus database with same CATH topology
 2NZE A;  3AJ3 A;  4YSK A;  3FAI A;  5EW0 A;  2GFK A;  2FM6 A;  5K0W A;  1M2X A;  4NQ4 A;  2OHJ A;  3H3E A;  3QH8 A;  4CHL A;  4TZF A;  5LMC A;  2GCU A;  4FSB A;  3BC2 A;  2NYP A;  3DH8 A;  3LVZ A;  4PVO A;  5KIL A;  2OHH A;  5A0T A;  5HH6 A;  2YNV A;  2P4Z A;  3SBL A;  2BG8 A;  2YNW A;  3L6N A;  4F6H A;  4ZO3 A;  5LS3 A;  5AHR A;  3BK2 A;  2YNT B;  2AZ4 A;  3RPC A;  4NUR A;  2YHE A;  3ESH A;  4FR7 A;  5B1U A;  5KIK A;  3WXC A;  2P97 A;  3VQZ A;  4BP0 A;  4XUK A;  4J5H A;  1WRA A;  2BFK A;  4LE6 A;  4TZE A;  4U4L A;  5B3R A;  2ZZI A;  5ACS A;  1WW1 A;  4AWY B;  1X8I A;  5AHO A;  5FQB A;  1YCH A;  3G1P A;  2ZNB A;  3DHC A;  4C09 A;  3A4Y A;  5AEB A;  5AXO A;  1A8T A;  1ZNB A;  5EVK A;  2I7X A;  5LE1 A;  3IE2 A;  2M5D A;  2DKF A;  5HH4 A;  3RKJ A;  4Z67 A;  1X8G A;  2A7M A;  4AD9 A;  2ZO4 A;  3T3O A;  3X2Z A;  2NZF A;  4UAM A;  2UYX A;  5HIO A;  2BFZ A;  1XTO A;  4JO0 A;  3PG4 A;  4KEQ A;  3PY5 A;  5EHT A;  4DIK A;  4ZO2 A;  3KL7 A;  5K4K A;  4RL0 A;  2R2D A;  4UWR B;  2Q0J A;  5A87 A;  4YSB A;  3ADR A;  4ZNB A;  2ZWR A;  4UWS B;  2BG6 A;  2FHX B;  4AV7 A;  4TYF A;  1ZTC A;  5K4N A;  5EVB A;  3JXP A;  1KO3 A;  2QIN A;  5HH5 A;  4HL2 A;  5EH9 A;  3RKK A;  3I15 A;  3I11 A;  2WRS A;  2CFZ A;  2AIO A;  2WYL A;  2I7T A;  1DXK A;  1QH5 A;  2QED A;  3X2X A;  4EY2 A;  4C1C A;  4D02 A;  3R2U A;  3IE0 A;  2FK6 A;  2DOO A;  4TYT A;  3SFP A;  3FCZ A;  3SRX A;  3BK1 A;  5ACX A;  3AF5 A;  5A5Z A;  1JJT A;  3BV6 A;  2CBN A;  1DDK A;  2FU9 A;  1VJN A;  4NQ2 A;  4D1W A;  2YCB A;  4XWT A;  4BZ3 A;  5AJL A;  1KR3 A;  2M5C A;  2XR1 A;  4O98 A;  4EFZ A;  2CG3 A;  4P62 A;  3AF6 A;  2YNU A;  4AWZ A;  4C1F A;  1X8H A;  1WUP A;  1XM8 A;  2YNT A;  1DD6 A;  4DIL A;  1K07 A;  4Z60 A;  4RAW A;  3KNR A;  2BMI A;  5AIJ A;  4GCW A;  1QH3 A;  4UWO B;  3ZQ4 A;  1JJE A;  5ACR A;  1BC2 A;  3IEL A;  5FQC A;  1VME A;  5LCA A;  2CG2 A;  2WYM A;  2OHI A;  4YSL A;  4EXS A;  2FU6 A;  5ACW A;  2P1E A;  4RL2 A;  1MQO A;  2BG2 A;  1VGN A;  3IEM A;  4C1E A;  5LLD A;  3S0Z A;  5ACP A;  2FU8 A;  2QJS A;  2Q0I A;  2HB9 A;  4UA4 A;  4EXY A;  5EV8 A;  5LCF A;  5DPX A;  5EWA A;  2P18 A;  4Z7R A;  3P2U A;  2FU7 A;  2BTN A;  2VW8 A;  2E7Y A;  3I0V A;  4TZB A;  1BMC A;  2XF4 A;  1ZKP A;  3IOF A;  5LM6 A;  2FHX A;  2YNV B;  4D1T A;  4KEP A;  2BR6 A;  2BG8 B;  4FEK A;  3IOG A;  5AYA A;  1YCG A;  1WUO A;  2Q42 A;  1A7T A;  4D1V A;  2H6A A;  2YZ3 A;  5K4M A;  4NQ6 A;  3X2Y A;  2NXA A;  3T9M A;  2BC2 A;  5ACQ A;  5EV6 A;  2GMN A;  5LSC A;  3I13 A;  2WYM C;  3IE1 A;  4GYU A;  5IQK A;  4PVT A;  4Z6X A;  1YCF A;  5ACU A;  3I14 A;  3IEK A;  3ZR9 A;  4B87 A;  4ZEJ A;  2Y8A A;  1JT1 A;  4RM5 A;  4AX1 B;  3MD7 A;  4EYF A;  3DHA A;  2GKL A;  3F9O A;  2CFU A;  5A23 A;  3ZWF A;  1HLK A;  2WHG A;  1E5D A;  5EVD A;  4AX0 B;  3IDZ A;  1L9Y A;  2Q9U A;  5HIS A;  4V0H A;  5B15 A;  2BFZ B;  3SD9 A;  3VPE A;  2BFL A;  2QDS A;  4AXH A;  4XWW A;  2Y87 A;  1SML A;  5AXR A;  4NQ5 A;  4EYB A;  4RBS A;  1KO2 A;  3KNS A;  2Y8B A;  4TZ9 A;  2I7V A;  4UBQ A;  5HIQ A;  5FQA A;  2GFJ A;  4C1H A;  5ACV A;  5ACT A;  3T3N A;  2BIB A;  4C1G A;  4Z5Z A;  1BVT A;  2BG7 A;  3SPU A;  3DHB A;  1P9E A;  5HIP A;  2QDT A;  3ZNB A;  4HL1 A;  4UWP B;  3X30 A;  3PY6 A;  4GYQ A;  3TP9 A;  4F6Z A;  4WD6 A;  2BGA A;  3Q6V A;  4J5F A;  4HKY A;  4Z5Y A;  4H0D A;  4EYL A;  5A0V A;  4PDX A;  5LCH A;  4D1U A;  1Y44 A;  4RAM A;  3SW3 A;  4C1D A; 
#chains in the Genus database with same CATH homology
 2NZE A;  3AJ3 A;  4YSK A;  3FAI A;  5EW0 A;  2GFK A;  2FM6 A;  5K0W A;  1M2X A;  4NQ4 A;  2OHJ A;  3H3E A;  3QH8 A;  4CHL A;  4TZF A;  5LMC A;  2GCU A;  4FSB A;  3BC2 A;  2NYP A;  3DH8 A;  3LVZ A;  4PVO A;  5KIL A;  2OHH A;  5A0T A;  5HH6 A;  2YNV A;  2P4Z A;  3SBL A;  2BG8 A;  2YNW A;  3L6N A;  4F6H A;  4ZO3 A;  5LS3 A;  5AHR A;  3BK2 A;  2YNT B;  2AZ4 A;  3RPC A;  3ESH A;  4FR7 A;  5B1U A;  5KIK A;  3WXC A;  2P97 A;  3VQZ A;  4BP0 A;  4XUK A;  4J5H A;  1WRA A;  2BFK A;  4LE6 A;  4TZE A;  4U4L A;  5B3R A;  2ZZI A;  5ACS A;  1WW1 A;  4AWY B;  1X8I A;  5AHO A;  5FQB A;  1YCH A;  3G1P A;  2ZNB A;  3DHC A;  4C09 A;  3A4Y A;  5AEB A;  5AXO A;  1A8T A;  1ZNB A;  5EVK A;  2I7X A;  5LE1 A;  3IE2 A;  2M5D A;  2DKF A;  5HH4 A;  3RKJ A;  4Z67 A;  1X8G A;  2A7M A;  4AD9 A;  2ZO4 A;  3T3O A;  3X2Z A;  2NZF A;  4UAM A;  2UYX A;  5HIO A;  2BFZ A;  1XTO A;  4JO0 A;  3PG4 A;  4KEQ A;  3PY5 A;  5EHT A;  4DIK A;  4ZO2 A;  3KL7 A;  5K4K A;  4RL0 A;  2R2D A;  4UWR B;  2Q0J A;  5A87 A;  4YSB A;  3ADR A;  4ZNB A;  2ZWR A;  4UWS B;  2BG6 A;  2FHX B;  4TYF A;  1ZTC A;  5K4N A;  5EVB A;  3JXP A;  1KO3 A;  2QIN A;  5HH5 A;  4HL2 A;  5EH9 A;  3RKK A;  3I15 A;  3I11 A;  2WRS A;  2AIO A;  2WYL A;  2I7T A;  1DXK A;  1QH5 A;  2QED A;  3X2X A;  4EY2 A;  4C1C A;  4D02 A;  3R2U A;  3IE0 A;  2FK6 A;  2DOO A;  4TYT A;  3SFP A;  3FCZ A;  3SRX A;  3BK1 A;  5ACX A;  3AF5 A;  5A5Z A;  1JJT A;  3BV6 A;  2CBN A;  1DDK A;  2FU9 A;  1VJN A;  4NQ2 A;  4D1W A;  2YCB A;  4XWT A;  4BZ3 A;  1KR3 A;  2M5C A;  2XR1 A;  4O98 A;  4EFZ A;  4P62 A;  3AF6 A;  2YNU A;  4AWZ A;  4C1F A;  1X8H A;  1WUP A;  1XM8 A;  2YNT A;  1DD6 A;  4DIL A;  1K07 A;  4Z60 A;  4RAW A;  3KNR A;  2BMI A;  4GCW A;  1QH3 A;  4UWO B;  3ZQ4 A;  1JJE A;  5ACR A;  1BC2 A;  3IEL A;  5FQC A;  1VME A;  5LCA A;  2WYM A;  2OHI A;  4YSL A;  4EXS A;  2FU6 A;  5ACW A;  2P1E A;  4RL2 A;  1MQO A;  2BG2 A;  1VGN A;  3IEM A;  4C1E A;  5LLD A;  3S0Z A;  5ACP A;  2FU8 A;  2QJS A;  2Q0I A;  2HB9 A;  4UA4 A;  4EXY A;  5EV8 A;  5LCF A;  5DPX A;  5EWA A;  2P18 A;  4Z7R A;  3P2U A;  2FU7 A;  2BTN A;  2VW8 A;  2E7Y A;  3I0V A;  4TZB A;  1BMC A;  2XF4 A;  1ZKP A;  3IOF A;  5LM6 A;  2FHX A;  2YNV B;  4D1T A;  4KEP A;  2BR6 A;  2BG8 B;  4FEK A;  3IOG A;  5AYA A;  1YCG A;  1WUO A;  2Q42 A;  1A7T A;  4D1V A;  2H6A A;  2YZ3 A;  5K4M A;  4NQ6 A;  3X2Y A;  2NXA A;  3T9M A;  2BC2 A;  5ACQ A;  5EV6 A;  2GMN A;  5LSC A;  3I13 A;  2WYM C;  3IE1 A;  4GYU A;  5IQK A;  4PVT A;  4Z6X A;  1YCF A;  5ACU A;  3I14 A;  3IEK A;  3ZR9 A;  4B87 A;  4ZEJ A;  2Y8A A;  1JT1 A;  4RM5 A;  4AX1 B;  3MD7 A;  4EYF A;  3DHA A;  2GKL A;  3F9O A;  3ZWF A;  1HLK A;  2WHG A;  1E5D A;  5EVD A;  4AX0 B;  3IDZ A;  1L9Y A;  2Q9U A;  5HIS A;  4V0H A;  5B15 A;  2BFZ B;  3SD9 A;  3VPE A;  2BFL A;  2QDS A;  4XWW A;  2Y87 A;  1SML A;  5AXR A;  4NQ5 A;  4EYB A;  4RBS A;  1KO2 A;  3KNS A;  2Y8B A;  4TZ9 A;  2I7V A;  4UBQ A;  5HIQ A;  5FQA A;  2GFJ A;  4C1H A;  5ACV A;  5ACT A;  3T3N A;  2BIB A;  4C1G A;  4Z5Z A;  1BVT A;  2BG7 A;  3SPU A;  3DHB A;  1P9E A;  5HIP A;  2QDT A;  3ZNB A;  4HL1 A;  4UWP B;  3X30 A;  3PY6 A;  4GYQ A;  3TP9 A;  4F6Z A;  4WD6 A;  2BGA A;  3Q6V A;  4J5F A;  4HKY A;  4Z5Y A;  4H0D A;  4EYL A;  5A0V A;  5LCH A;  4D1U A;  1Y44 A;  4RAM A;  3SW3 A;  4C1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...