5HH4A

Crystal structure of metallo-beta-lactamase imp-1 in complex with a phosphonate-based inhibitor
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
218
structure length
218
Chain Sequence
SLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase IMP-1
publication title Structural and Kinetic Studies of the Potent Inhibition of Metallo-beta-lactamases by 6-Phosphonomethylpyridine-2-carboxylates.
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Hydrolase
total genus 61
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5hh4A00
4EYBA 1KR3A 5EVKA 4HL2A 4PVTA 2M5CA 2YCBA 5EVDA 3RKKA 4BZ3A 4BP0A 1JJEA 2E7YA 1Y44A 5DPXA 5FQCA 5AEBA 3BC2A 1VJNA 2H6AA 5B15A 1ZKPA 2GKLA 4RM5A 2YNWA 3F9OA 4RBSA 4HL1A 2BFZB 2BIBA 4UAMA 3VPEA 1WUPA 3Q6VA 3RPCA 1X8IA 4FR7A 5FQBA 5IQKA 2AZ4A 5K0WA 1HLKA 2DKFA 5A87A 4YSLA 5K4NA 3I13A 3SBLA 2HB9A 3DHBA 1SMLA 5EW0A 1X8GA 2NXAA 4UWRB 2FU6A 2NYPA 4EXYA 5LM6A 3BK1A 4C1CA 5ACQA 1YCFA 2BC2A 3IOGA 3ZNBA 4TZFA 5AHOA 3X2ZA 5ACSA 3IDZA 5ACTA 4KEQA 4RL0A 2WRSA 3DH8A 5AHRA 2FU9A 1X8HA 1XTOA 2GMNA 4WD6A 2P97A 4F6HA 3T3OA 1DDKA 5HIPA 5LCFA 3AF6A 2GFKA 2I7TA 3PY5A 1BC2A 4D1UA 2GCUA 3I0VA 4P62A 3SFPA 3IELA 5K4MA 2OHHA 3X2XA 4TZEA 2BFKA 2BG8B 4GCWA 4EXSA 1ZNBA 4C1EA 2CBNA 4Z60A 5EV6A 3IE2A 1DD6A 5ACRA 1VGNA 4UWOB 3ZR9A 1WW1A 2Y8BA 4ZNBA 4YSBA 4CHLA 1ZTCA 2QEDA 1E5DA 2I7VA 4TZBA 1A8TA 2ZNBA 4PVOA 2UYXA 4RL2A 4GYQA 2BG2A 5EHTA 3IEMA 3I11A 4D02A 2BFZA 4KEPA 3DHCA 3WXCA 2YNVB 3T9MA 5LCAA 4D1TA 4FEKA 1YCGA 4UWSB 3ADRA 3PY6A 3DHAA 2FU8A 3QH8A 2BFLA 5B3RA 2R2DA 2QINA 5B1UA 4C1FA 3P2UA 3KNRA 1K07A 3PG4A 3TP9A 2FU7A 4B87A 4NQ2A 4NQ6A 5LS3A 1A7TA 4Z5YA 3LVZA 4D1VA 4XWTA 4C09A 4F6ZA 5AXOA 2NZFA 5AYAA 4UA4A 1QH5A 5HH6A 4XWWA 3I15A 4V0HA 2WYMA 4YSKA 3SPUA 3RKJA 2Q0JA 4FSBA 2BG6A 2Q9UA 3SRXA 2A7MA 1VMEA 2YNTB 4RAMA 4AWYB 4H0DA 2BG8A 2FK6A 1BMCA 1L9YA 2P18A 2I7XA 2BR6A 4DILA 4J5HA 3SW3A 3X30A 2QDTA 3IEKA 2ZO4A 5FQAA 4D1WA 5HIQA 2WYMC 4TYTA 2QJSA 2BTNA 2Q0IA 4EYFA 3AF5A 2BMIA 2FM6A 2P1EA 2OHIA 3VQZA 5LSCA 5A5ZA 1YCHA 5EH9A 2GFJA 5ACXA 3JXPA 4GYUA 4C1DA 4C1HA 1JT1A 3ZWFA 3SD9A 4ZO2A 3BK2A 3KL7A 4J5FA 1KO3A 3KNSA 4NQ4A 2FHXB 2Y87A 5LE1A 3FAIA 5HIOA 5KIKA 4UWPB 3H3EA 2WYLA 4XUKA 4TZ9A 3R2UA 5A0TA 4EY2A 3G1PA 4U4LA 5LCHA 3X2YA 2Y8AA 4Z5ZA 3T3NA 1WUOA 2YNUA 5EVBA 2VW8A 5LMCA 4AD9A 2P4ZA 3ESHA 2M5DA 5ACVA 3ZQ4A 4ZEJA 2NZEA 4TYFA 1XM8A 5HH4A 1WRAA 1QH3A 4Z6XA 2ZWRA 4ZO3A 5K4KA 2AIOA 3I14A 4JO0A 2XF4A 4UBQA 1JJTA 2YNTA 4HKYA 4AX0B 3IE1A 5ACWA 3A4YA 2Q42A 4C1GA 3S0ZA 2OHJA 5ACUA 4DIKA 4Z7RA 2YZ3A 3IE0A 4Z67A 3BV6A 5A0VA 5ACPA 2QDSA 4EYLA 4O98A 2BGAA 5EV8A 5KILA 3FCZA 1BVTA 2ZZIA 3IOFA 3L6NA 4NQ5A 4LE6A 5HH5A 5AXRA 1P9EA 2DOOA 1MQOA 3MD7A 1M2XA 4AWZA 1KO2A 5LLDA 2BG7A 5EWAA 3AJ3A 1DXKA 2WHGA 2XR1A 2FHXA 4AX1B 5HISA 2YNVA 4EFZA 4RAWA
chains in the Genus database with same CATH superfamily
4EYBA 1KR3A 5EVKA 4HL2A 4PVTA 2M5CA 2YCBA 5EVDA 3RKKA 4BZ3A 4BP0A 1JJEA 2E7YA 1Y44A 5DPXA 5FQCA 5AEBA 3BC2A 1VJNA 2H6AA 5B15A 1ZKPA 2GKLA 4RM5A 2YNWA 3F9OA 4RBSA 4HL1A 2BFZB 2BIBA 4UAMA 3VPEA 1WUPA 3Q6VA 3RPCA 1X8IA 4FR7A 5FQBA 5IQKA 2AZ4A 5K0WA 1HLKA 2DKFA 5A87A 4YSLA 5K4NA 3I13A 3SBLA 2HB9A 3DHBA 1SMLA 5EW0A 1X8GA 2NXAA 4UWRB 2FU6A 2NYPA 4EXYA 5LM6A 3BK1A 4C1CA 5ACQA 1YCFA 5AIJA 2BC2A 3IOGA 3ZNBA 4TZFA 5AHOA 3X2ZA 5ACSA 3IDZA 5ACTA 4KEQA 4RL0A 2WRSA 3DH8A 5AHRA 2FU9A 1X8HA 1XTOA 2GMNA 4WD6A 2P97A 4F6HA 3T3OA 1DDKA 5HIPA 5LCFA 3AF6A 2GFKA 2I7TA 3PY5A 1BC2A 4D1UA 2GCUA 3I0VA 4P62A 3SFPA 3IELA 5K4MA 2OHHA 3X2XA 2CG2A 2BFKA 4TZEA 2BG8B 4GCWA 4EXSA 1ZNBA 4C1EA 2CBNA 4Z60A 5EV6A 3IE2A 4PDXA 1DD6A 5ACRA 1VGNA 4UWOB 3ZR9A 1WW1A 2Y8BA 4ZNBA 4YSBA 4CHLA 1ZTCA 2QEDA 1E5DA 2I7VA 4TZBA 1A8TA 2ZNBA 4PVOA 2UYXA 4RL2A 4GYQA 2BG2A 5EHTA 3IEMA 3I11A 4D02A 2BFZA 4KEPA 3DHCA 3WXCA 2YNVB 3T9MA 5LCAA 4D1TA 4FEKA 1YCGA 4UWSB 3ADRA 3PY6A 3DHAA 2FU8A 3QH8A 2BFLA 5B3RA 2R2DA 2QINA 5B1UA 4C1FA 3P2UA 3KNRA 1K07A 3PG4A 3TP9A 2FU7A 4B87A 4NQ2A 4NQ6A 5LS3A 1A7TA 4Z5YA 3LVZA 2CG3A 4D1VA 4XWTA 4C09A 4F6ZA 5AXOA 2NZFA 5AYAA 4UA4A 1QH5A 5HH6A 4XWWA 3I15A 4V0HA 2WYMA 4YSKA 3SPUA 3RKJA 2Q0JA 4FSBA 2BG6A 2Q9UA 3SRXA 2A7MA 1VMEA 2YNTB 4RAMA 4AWYB 4H0DA 2BG8A 2FK6A 1BMCA 1L9YA 2P18A 2I7XA 2BR6A 4DILA 4J5HA 3SW3A 3X30A 2QDTA 2CFZA 3IEKA 2ZO4A 5FQAA 4D1WA 5HIQA 2WYMC 4TYTA 2QJSA 2BTNA 2Q0IA 4EYFA 3AF5A 2BMIA 2FM6A 2P1EA 2OHIA 3VQZA 5LSCA 5A5ZA 1YCHA 5EH9A 2GFJA 5ACXA 3JXPA 4GYUA 4C1DA 4C1HA 1JT1A 3ZWFA 3SD9A 4AXHA 4ZO2A 3BK2A 3KL7A 4J5FA 1KO3A 3KNSA 4NQ4A 2FHXB 2Y87A 5LE1A 3FAIA 5HIOA 5KIKA 4UWPB 3H3EA 4NURA 2WYLA 4XUKA 4TZ9A 3R2UA 5A0TA 4EY2A 3G1PA 5A23A 4U4LA 5LCHA 3X2YA 2Y8AA 4Z5ZA 3T3NA 1WUOA 2YNUA 5EVBA 2VW8A 5LMCA 4AD9A 2P4ZA 3ESHA 2M5DA 5ACVA 3ZQ4A 4ZEJA 2NZEA 4TYFA 1XM8A 5HH4A 1WRAA 1QH3A 2CFUA 4Z6XA 2ZWRA 4ZO3A 5K4KA 2AIOA 3I14A 4JO0A 2XF4A 4UBQA 1JJTA 2YNTA 4HKYA 4AX0B 5AJLA 3IE1A 5ACWA 3A4YA 2Q42A 4C1GA 3S0ZA 2OHJA 5ACUA 4AV7A 4DIKA 4Z7RA 2YZ3A 3IE0A 4Z67A 3BV6A 5A0VA 2YHEA 5ACPA 2QDSA 4EYLA 4O98A 2BGAA 5EV8A 5KILA 3FCZA 1BVTA 2ZZIA 3IOFA 3L6NA 4NQ5A 4LE6A 5HH5A 5AXRA 1P9EA 2DOOA 1MQOA 3MD7A 4AWZA 1M2XA 1KO2A 5LLDA 2BG7A 5EWAA 3AJ3A 1DXKA 2WHGA 2XR1A 2FHXA 4AX1B 5HISA 2YNVA 4EFZA 4RAWA
chains in the Genus database with same CATH topology
4EYBA 1KR3A 5EVKA 4HL2A 4PVTA 2M5CA 2YCBA 5EVDA 3RKKA 4BZ3A 4BP0A 1JJEA 2E7YA 1Y44A 5DPXA 5FQCA 5AEBA 3BC2A 1VJNA 2H6AA 5B15A 1ZKPA 2GKLA 4RM5A 2YNWA 3F9OA 4RBSA 4HL1A 2BFZB 2BIBA 4UAMA 3VPEA 1WUPA 3Q6VA 3RPCA 1X8IA 4FR7A 5FQBA 5IQKA 2AZ4A 5K0WA 1HLKA 2DKFA 5A87A 4YSLA 5K4NA 3I13A 3SBLA 2HB9A 3DHBA 1SMLA 5EW0A 1X8GA 2NXAA 4UWRB 2FU6A 2NYPA 4EXYA 5LM6A 3BK1A 4C1CA 5ACQA 1YCFA 2BC2A 3IOGA 3ZNBA 4TZFA 5AHOA 3X2ZA 5ACSA 3IDZA 5ACTA 4KEQA 4RL0A 2WRSA 3DH8A 5AHRA 2FU9A 1X8HA 1XTOA 2GMNA 4WD6A 2P97A 4F6HA 3T3OA 1DDKA 5HIPA 5LCFA 3AF6A 2GFKA 2I7TA 3PY5A 1BC2A 4D1UA 2GCUA 3I0VA 4P62A 3SFPA 3IELA 5K4MA 2OHHA 3X2XA 4TZEA 2BFKA 2BG8B 4GCWA 4EXSA 1ZNBA 4C1EA 2CBNA 4Z60A 5EV6A 3IE2A 1DD6A 5ACRA 1VGNA 4UWOB 3ZR9A 1WW1A 2Y8BA 4ZNBA 4YSBA 4CHLA 1ZTCA 2QEDA 1E5DA 2I7VA 4TZBA 1A8TA 2ZNBA 4PVOA 2UYXA 4RL2A 4GYQA 2BG2A 5EHTA 3IEMA 3I11A 4D02A 2BFZA 4KEPA 3DHCA 3WXCA 2YNVB 3T9MA 5LCAA 4D1TA 4FEKA 1YCGA 4UWSB 3ADRA 3PY6A 3DHAA 2FU8A 3QH8A 2BFLA 5B3RA 2R2DA 2QINA 5B1UA 4C1FA 3P2UA 3KNRA 1K07A 3PG4A 3TP9A 2FU7A 4B87A 4NQ2A 4NQ6A 5LS3A 1A7TA 4Z5YA 3LVZA 4D1VA 4XWTA 4C09A 4F6ZA 5AXOA 2NZFA 5AYAA 4UA4A 1QH5A 5HH6A 4XWWA 3I15A 4V0HA 2WYMA 4YSKA 3SPUA 3RKJA 2Q0JA 4FSBA 2BG6A 2Q9UA 3SRXA 2A7MA 1VMEA 2YNTB 4RAMA 4AWYB 4H0DA 2BG8A 2FK6A 1BMCA 1L9YA 2P18A 2I7XA 2BR6A 4DILA 4J5HA 3SW3A 3X30A 2QDTA 3IEKA 2ZO4A 5FQAA 4D1WA 5HIQA 2WYMC 4TYTA 2QJSA 2BTNA 2Q0IA 4EYFA 3AF5A 2BMIA 2FM6A 2P1EA 2OHIA 3VQZA 5LSCA 5A5ZA 1YCHA 5EH9A 2GFJA 5ACXA 3JXPA 4GYUA 4C1DA 4C1HA 1JT1A 3ZWFA 3SD9A 4ZO2A 3BK2A 3KL7A 4J5FA 1KO3A 3KNSA 4NQ4A 2FHXB 2Y87A 5LE1A 3FAIA 5HIOA 5KIKA 4UWPB 3H3EA 2WYLA 4XUKA 4TZ9A 3R2UA 5A0TA 4EY2A 3G1PA 4U4LA 5LCHA 3X2YA 2Y8AA 4Z5ZA 3T3NA 1WUOA 2YNUA 5EVBA 2VW8A 5LMCA 4AD9A 2P4ZA 3ESHA 2M5DA 5ACVA 3ZQ4A 4ZEJA 2NZEA 4TYFA 1XM8A 5HH4A 1WRAA 1QH3A 4Z6XA 2ZWRA 4ZO3A 5K4KA 2AIOA 3I14A 4JO0A 2XF4A 4UBQA 1JJTA 2YNTA 4HKYA 4AX0B 3IE1A 5ACWA 3A4YA 2Q42A 4C1GA 3S0ZA 2OHJA 5ACUA 4DIKA 4Z7RA 2YZ3A 3IE0A 4Z67A 3BV6A 5A0VA 5ACPA 2QDSA 4EYLA 4O98A 2BGAA 5EV8A 5KILA 3FCZA 1BVTA 2ZZIA 3IOFA 3L6NA 4NQ5A 4LE6A 5HH5A 5AXRA 1P9EA 2DOOA 1MQOA 3MD7A 1M2XA 4AWZA 1KO2A 5LLDA 2BG7A 5EWAA 3AJ3A 1DXKA 2WHGA 2XR1A 2FHXA 4AX1B 5HISA 2YNVA 4EFZA 4RAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EYB A;  1KR3 A;  5EVK A;  4HL2 A;  4PVT A;  2M5C A;  2YCB A;  5EVD A;  3RKK A;  4BZ3 A;  4BP0 A;  1JJE A;  2E7Y A;  1Y44 A;  5DPX A;  5FQC A;  5AEB A;  3BC2 A;  1VJN A;  2H6A A;  5B15 A;  1ZKP A;  2GKL A;  4RM5 A;  2YNW A;  3F9O A;  4RBS A;  4HL1 A;  2BFZ B;  2BIB A;  4UAM A;  3VPE A;  1WUP A;  3Q6V A;  3RPC A;  1X8I A;  4FR7 A;  5FQB A;  5IQK A;  2AZ4 A;  5K0W A;  1HLK A;  2DKF A;  5A87 A;  4YSL A;  5K4N A;  3I13 A;  3SBL A;  2HB9 A;  3DHB A;  1SML A;  5EW0 A;  1X8G A;  2NXA A;  4UWR B;  2FU6 A;  2NYP A;  4EXY A;  5LM6 A;  3BK1 A;  4C1C A;  5ACQ A;  1YCF A;  2BC2 A;  3IOG A;  3ZNB A;  4TZF A;  5AHO A;  3X2Z A;  5ACS A;  3IDZ A;  5ACT A;  4KEQ A;  4RL0 A;  2WRS A;  3DH8 A;  5AHR A;  2FU9 A;  1X8H A;  1XTO A;  2GMN A;  4WD6 A;  2P97 A;  4F6H A;  3T3O A;  1DDK A;  5HIP A;  5LCF A;  3AF6 A;  2GFK A;  2I7T A;  3PY5 A;  1BC2 A;  4D1U A;  2GCU A;  3I0V A;  4P62 A;  3SFP A;  3IEL A;  5K4M A;  2OHH A;  3X2X A;  4TZE A;  2BFK A;  2BG8 B;  4GCW A;  4EXS A;  1ZNB A;  4C1E A;  2CBN A;  4Z60 A;  5EV6 A;  3IE2 A;  1DD6 A;  5ACR A;  1VGN A;  4UWO B;  3ZR9 A;  1WW1 A;  2Y8B A;  4ZNB A;  4YSB A;  4CHL A;  1ZTC A;  2QED A;  1E5D A;  2I7V A;  4TZB A;  1A8T A;  2ZNB A;  4PVO A;  2UYX A;  4RL2 A;  4GYQ A;  2BG2 A;  5EHT A;  3IEM A;  3I11 A;  4D02 A;  2BFZ A;  4KEP A;  3DHC A;  3WXC A;  2YNV B;  3T9M A;  5LCA A;  4D1T A;  4FEK A;  1YCG A;  4UWS B;  3ADR A;  3PY6 A;  3DHA A;  2FU8 A;  3QH8 A;  2BFL A;  5B3R A;  2R2D A;  2QIN A;  5B1U A;  4C1F A;  3P2U A;  3KNR A;  1K07 A;  3PG4 A;  3TP9 A;  2FU7 A;  4B87 A;  4NQ2 A;  4NQ6 A;  5LS3 A;  1A7T A;  4Z5Y A;  3LVZ A;  4D1V A;  4XWT A;  4C09 A;  4F6Z A;  5AXO A;  2NZF A;  5AYA A;  4UA4 A;  1QH5 A;  5HH6 A;  4XWW A;  3I15 A;  4V0H A;  2WYM A;  4YSK A;  3SPU A;  3RKJ A;  2Q0J A;  4FSB A;  2BG6 A;  2Q9U A;  3SRX A;  2A7M A;  1VME A;  2YNT B;  4RAM A;  4AWY B;  4H0D A;  2BG8 A;  2FK6 A;  1BMC A;  1L9Y A;  2P18 A;  2I7X A;  2BR6 A;  4DIL A;  4J5H A;  3SW3 A;  3X30 A;  2QDT A;  3IEK A;  2ZO4 A;  5FQA A;  4D1W A;  5HIQ A;  2WYM C;  4TYT A;  2QJS A;  2BTN A;  2Q0I A;  4EYF A;  3AF5 A;  2BMI A;  2FM6 A;  2P1E A;  2OHI A;  3VQZ A;  5LSC A;  5A5Z A;  1YCH A;  5EH9 A;  2GFJ A;  5ACX A;  3JXP A;  4GYU A;  4C1D A;  4C1H A;  1JT1 A;  3ZWF A;  3SD9 A;  4ZO2 A;  3BK2 A;  3KL7 A;  4J5F A;  1KO3 A;  3KNS A;  4NQ4 A;  2FHX B;  2Y87 A;  5LE1 A;  3FAI A;  5HIO A;  5KIK A;  4UWP B;  3H3E A;  2WYL A;  4XUK A;  4TZ9 A;  3R2U A;  5A0T A;  4EY2 A;  3G1P A;  4U4L A;  5LCH A;  3X2Y A;  2Y8A A;  4Z5Z A;  3T3N A;  1WUO A;  2YNU A;  5EVB A;  2VW8 A;  5LMC A;  4AD9 A;  2P4Z A;  3ESH A;  2M5D A;  5ACV A;  3ZQ4 A;  4ZEJ A;  2NZE A;  4TYF A;  1XM8 A;  5HH4 A;  1WRA A;  1QH3 A;  4Z6X A;  2ZWR A;  4ZO3 A;  5K4K A;  2AIO A;  3I14 A;  4JO0 A;  2XF4 A;  4UBQ A;  1JJT A;  2YNT A;  4HKY A;  4AX0 B;  3IE1 A;  5ACW A;  3A4Y A;  2Q42 A;  4C1G A;  3S0Z A;  2OHJ A;  5ACU A;  4DIK A;  4Z7R A;  2YZ3 A;  3IE0 A;  4Z67 A;  3BV6 A;  5A0V A;  5ACP A;  2QDS A;  4EYL A;  4O98 A;  2BGA A;  5EV8 A;  5KIL A;  3FCZ A;  1BVT A;  2ZZI A;  3IOF A;  3L6N A;  4NQ5 A;  4LE6 A;  5HH5 A;  5AXR A;  1P9E A;  2DOO A;  1MQO A;  3MD7 A;  1M2X A;  4AWZ A;  1KO2 A;  5LLD A;  2BG7 A;  5EWA A;  3AJ3 A;  1DXK A;  2WHG A;  2XR1 A;  2FHX A;  4AX1 B;  5HIS A;  2YNV A;  4EFZ A;  4RAW A; 
#chains in the Genus database with same CATH topology
 4EYB A;  1KR3 A;  5EVK A;  4HL2 A;  4PVT A;  2M5C A;  2YCB A;  5EVD A;  3RKK A;  4BZ3 A;  4BP0 A;  1JJE A;  2E7Y A;  1Y44 A;  5DPX A;  5FQC A;  5AEB A;  3BC2 A;  1VJN A;  2H6A A;  5B15 A;  1ZKP A;  2GKL A;  4RM5 A;  2YNW A;  3F9O A;  4RBS A;  4HL1 A;  2BFZ B;  2BIB A;  4UAM A;  3VPE A;  1WUP A;  3Q6V A;  3RPC A;  1X8I A;  4FR7 A;  5FQB A;  5IQK A;  2AZ4 A;  5K0W A;  1HLK A;  2DKF A;  5A87 A;  4YSL A;  5K4N A;  3I13 A;  3SBL A;  2HB9 A;  3DHB A;  1SML A;  5EW0 A;  1X8G A;  2NXA A;  4UWR B;  2FU6 A;  2NYP A;  4EXY A;  5LM6 A;  3BK1 A;  4C1C A;  5ACQ A;  1YCF A;  5AIJ A;  2BC2 A;  3IOG A;  3ZNB A;  4TZF A;  5AHO A;  3X2Z A;  5ACS A;  3IDZ A;  5ACT A;  4KEQ A;  4RL0 A;  2WRS A;  3DH8 A;  5AHR A;  2FU9 A;  1X8H A;  1XTO A;  2GMN A;  4WD6 A;  2P97 A;  4F6H A;  3T3O A;  1DDK A;  5HIP A;  5LCF A;  3AF6 A;  2GFK A;  2I7T A;  3PY5 A;  1BC2 A;  4D1U A;  2GCU A;  3I0V A;  4P62 A;  3SFP A;  3IEL A;  5K4M A;  2OHH A;  3X2X A;  2CG2 A;  2BFK A;  4TZE A;  2BG8 B;  4GCW A;  4EXS A;  1ZNB A;  4C1E A;  2CBN A;  4Z60 A;  5EV6 A;  3IE2 A;  4PDX A;  1DD6 A;  5ACR A;  1VGN A;  4UWO B;  3ZR9 A;  1WW1 A;  2Y8B A;  4ZNB A;  4YSB A;  4CHL A;  1ZTC A;  2QED A;  1E5D A;  2I7V A;  4TZB A;  1A8T A;  2ZNB A;  4PVO A;  2UYX A;  4RL2 A;  4GYQ A;  2BG2 A;  5EHT A;  3IEM A;  3I11 A;  4D02 A;  2BFZ A;  4KEP A;  3DHC A;  3WXC A;  2YNV B;  3T9M A;  5LCA A;  4D1T A;  4FEK A;  1YCG A;  4UWS B;  3ADR A;  3PY6 A;  3DHA A;  2FU8 A;  3QH8 A;  2BFL A;  5B3R A;  2R2D A;  2QIN A;  5B1U A;  4C1F A;  3P2U A;  3KNR A;  1K07 A;  3PG4 A;  3TP9 A;  2FU7 A;  4B87 A;  4NQ2 A;  4NQ6 A;  5LS3 A;  1A7T A;  4Z5Y A;  3LVZ A;  2CG3 A;  4D1V A;  4XWT A;  4C09 A;  4F6Z A;  5AXO A;  2NZF A;  5AYA A;  4UA4 A;  1QH5 A;  5HH6 A;  4XWW A;  3I15 A;  4V0H A;  2WYM A;  4YSK A;  3SPU A;  3RKJ A;  2Q0J A;  4FSB A;  2BG6 A;  2Q9U A;  3SRX A;  2A7M A;  1VME A;  2YNT B;  4RAM A;  4AWY B;  4H0D A;  2BG8 A;  2FK6 A;  1BMC A;  1L9Y A;  2P18 A;  2I7X A;  2BR6 A;  4DIL A;  4J5H A;  3SW3 A;  3X30 A;  2QDT A;  2CFZ A;  3IEK A;  2ZO4 A;  5FQA A;  4D1W A;  5HIQ A;  2WYM C;  4TYT A;  2QJS A;  2BTN A;  2Q0I A;  4EYF A;  3AF5 A;  2BMI A;  2FM6 A;  2P1E A;  2OHI A;  3VQZ A;  5LSC A;  5A5Z A;  1YCH A;  5EH9 A;  2GFJ A;  5ACX A;  3JXP A;  4GYU A;  4C1D A;  4C1H A;  1JT1 A;  3ZWF A;  3SD9 A;  4AXH A;  4ZO2 A;  3BK2 A;  3KL7 A;  4J5F A;  1KO3 A;  3KNS A;  4NQ4 A;  2FHX B;  2Y87 A;  5LE1 A;  3FAI A;  5HIO A;  5KIK A;  4UWP B;  3H3E A;  4NUR A;  2WYL A;  4XUK A;  4TZ9 A;  3R2U A;  5A0T A;  4EY2 A;  3G1P A;  5A23 A;  4U4L A;  5LCH A;  3X2Y A;  2Y8A A;  4Z5Z A;  3T3N A;  1WUO A;  2YNU A;  5EVB A;  2VW8 A;  5LMC A;  4AD9 A;  2P4Z A;  3ESH A;  2M5D A;  5ACV A;  3ZQ4 A;  4ZEJ A;  2NZE A;  4TYF A;  1XM8 A;  5HH4 A;  1WRA A;  1QH3 A;  2CFU A;  4Z6X A;  2ZWR A;  4ZO3 A;  5K4K A;  2AIO A;  3I14 A;  4JO0 A;  2XF4 A;  4UBQ A;  1JJT A;  2YNT A;  4HKY A;  4AX0 B;  5AJL A;  3IE1 A;  5ACW A;  3A4Y A;  2Q42 A;  4C1G A;  3S0Z A;  2OHJ A;  5ACU A;  4AV7 A;  4DIK A;  4Z7R A;  2YZ3 A;  3IE0 A;  4Z67 A;  3BV6 A;  5A0V A;  2YHE A;  5ACP A;  2QDS A;  4EYL A;  4O98 A;  2BGA A;  5EV8 A;  5KIL A;  3FCZ A;  1BVT A;  2ZZI A;  3IOF A;  3L6N A;  4NQ5 A;  4LE6 A;  5HH5 A;  5AXR A;  1P9E A;  2DOO A;  1MQO A;  3MD7 A;  4AWZ A;  1M2X A;  1KO2 A;  5LLD A;  2BG7 A;  5EWA A;  3AJ3 A;  1DXK A;  2WHG A;  2XR1 A;  2FHX A;  4AX1 B;  5HIS A;  2YNV A;  4EFZ A;  4RAW A; 
#chains in the Genus database with same CATH homology
 4EYB A;  1KR3 A;  5EVK A;  4HL2 A;  4PVT A;  2M5C A;  2YCB A;  5EVD A;  3RKK A;  4BZ3 A;  4BP0 A;  1JJE A;  2E7Y A;  1Y44 A;  5DPX A;  5FQC A;  5AEB A;  3BC2 A;  1VJN A;  2H6A A;  5B15 A;  1ZKP A;  2GKL A;  4RM5 A;  2YNW A;  3F9O A;  4RBS A;  4HL1 A;  2BFZ B;  2BIB A;  4UAM A;  3VPE A;  1WUP A;  3Q6V A;  3RPC A;  1X8I A;  4FR7 A;  5FQB A;  5IQK A;  2AZ4 A;  5K0W A;  1HLK A;  2DKF A;  5A87 A;  4YSL A;  5K4N A;  3I13 A;  3SBL A;  2HB9 A;  3DHB A;  1SML A;  5EW0 A;  1X8G A;  2NXA A;  4UWR B;  2FU6 A;  2NYP A;  4EXY A;  5LM6 A;  3BK1 A;  4C1C A;  5ACQ A;  1YCF A;  2BC2 A;  3IOG A;  3ZNB A;  4TZF A;  5AHO A;  3X2Z A;  5ACS A;  3IDZ A;  5ACT A;  4KEQ A;  4RL0 A;  2WRS A;  3DH8 A;  5AHR A;  2FU9 A;  1X8H A;  1XTO A;  2GMN A;  4WD6 A;  2P97 A;  4F6H A;  3T3O A;  1DDK A;  5HIP A;  5LCF A;  3AF6 A;  2GFK A;  2I7T A;  3PY5 A;  1BC2 A;  4D1U A;  2GCU A;  3I0V A;  4P62 A;  3SFP A;  3IEL A;  5K4M A;  2OHH A;  3X2X A;  4TZE A;  2BFK A;  2BG8 B;  4GCW A;  4EXS A;  1ZNB A;  4C1E A;  2CBN A;  4Z60 A;  5EV6 A;  3IE2 A;  1DD6 A;  5ACR A;  1VGN A;  4UWO B;  3ZR9 A;  1WW1 A;  2Y8B A;  4ZNB A;  4YSB A;  4CHL A;  1ZTC A;  2QED A;  1E5D A;  2I7V A;  4TZB A;  1A8T A;  2ZNB A;  4PVO A;  2UYX A;  4RL2 A;  4GYQ A;  2BG2 A;  5EHT A;  3IEM A;  3I11 A;  4D02 A;  2BFZ A;  4KEP A;  3DHC A;  3WXC A;  2YNV B;  3T9M A;  5LCA A;  4D1T A;  4FEK A;  1YCG A;  4UWS B;  3ADR A;  3PY6 A;  3DHA A;  2FU8 A;  3QH8 A;  2BFL A;  5B3R A;  2R2D A;  2QIN A;  5B1U A;  4C1F A;  3P2U A;  3KNR A;  1K07 A;  3PG4 A;  3TP9 A;  2FU7 A;  4B87 A;  4NQ2 A;  4NQ6 A;  5LS3 A;  1A7T A;  4Z5Y A;  3LVZ A;  4D1V A;  4XWT A;  4C09 A;  4F6Z A;  5AXO A;  2NZF A;  5AYA A;  4UA4 A;  1QH5 A;  5HH6 A;  4XWW A;  3I15 A;  4V0H A;  2WYM A;  4YSK A;  3SPU A;  3RKJ A;  2Q0J A;  4FSB A;  2BG6 A;  2Q9U A;  3SRX A;  2A7M A;  1VME A;  2YNT B;  4RAM A;  4AWY B;  4H0D A;  2BG8 A;  2FK6 A;  1BMC A;  1L9Y A;  2P18 A;  2I7X A;  2BR6 A;  4DIL A;  4J5H A;  3SW3 A;  3X30 A;  2QDT A;  3IEK A;  2ZO4 A;  5FQA A;  4D1W A;  5HIQ A;  2WYM C;  4TYT A;  2QJS A;  2BTN A;  2Q0I A;  4EYF A;  3AF5 A;  2BMI A;  2FM6 A;  2P1E A;  2OHI A;  3VQZ A;  5LSC A;  5A5Z A;  1YCH A;  5EH9 A;  2GFJ A;  5ACX A;  3JXP A;  4GYU A;  4C1D A;  4C1H A;  1JT1 A;  3ZWF A;  3SD9 A;  4ZO2 A;  3BK2 A;  3KL7 A;  4J5F A;  1KO3 A;  3KNS A;  4NQ4 A;  2FHX B;  2Y87 A;  5LE1 A;  3FAI A;  5HIO A;  5KIK A;  4UWP B;  3H3E A;  2WYL A;  4XUK A;  4TZ9 A;  3R2U A;  5A0T A;  4EY2 A;  3G1P A;  4U4L A;  5LCH A;  3X2Y A;  2Y8A A;  4Z5Z A;  3T3N A;  1WUO A;  2YNU A;  5EVB A;  2VW8 A;  5LMC A;  4AD9 A;  2P4Z A;  3ESH A;  2M5D A;  5ACV A;  3ZQ4 A;  4ZEJ A;  2NZE A;  4TYF A;  1XM8 A;  5HH4 A;  1WRA A;  1QH3 A;  4Z6X A;  2ZWR A;  4ZO3 A;  5K4K A;  2AIO A;  3I14 A;  4JO0 A;  2XF4 A;  4UBQ A;  1JJT A;  2YNT A;  4HKY A;  4AX0 B;  3IE1 A;  5ACW A;  3A4Y A;  2Q42 A;  4C1G A;  3S0Z A;  2OHJ A;  5ACU A;  4DIK A;  4Z7R A;  2YZ3 A;  3IE0 A;  4Z67 A;  3BV6 A;  5A0V A;  5ACP A;  2QDS A;  4EYL A;  4O98 A;  2BGA A;  5EV8 A;  5KIL A;  3FCZ A;  1BVT A;  2ZZI A;  3IOF A;  3L6N A;  4NQ5 A;  4LE6 A;  5HH5 A;  5AXR A;  1P9E A;  2DOO A;  1MQO A;  3MD7 A;  1M2X A;  4AWZ A;  1KO2 A;  5LLD A;  2BG7 A;  5EWA A;  3AJ3 A;  1DXK A;  2WHG A;  2XR1 A;  2FHX A;  4AX1 B;  5HIS A;  2YNV A;  4EFZ A;  4RAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...