5HH4A

Crystal structure of metallo-beta-lactamase imp-1 in complex with a phosphonate-based inhibitor
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
218
structure length
218
Chain Sequence
SLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase IMP-1
publication title Structural and Kinetic Studies of the Potent Inhibition of Metallo-beta-lactamases by 6-Phosphonomethylpyridine-2-carboxylates.
pubmed doi rcsb
source organism Serratia marcescens
total genus 61
structure length 218
sequence length 218
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5hh4A00
2ZO4A 4C1EA 2H6AA 3ZR9A 4FR7A 4C1CA 4O98A 2GFJA 2WRSA 1L9YA 4JO0A 3AF5A 4CHLA 3VQZA 2Y8BA 3BC2A 1X8IA 5B15A 4NQ4A 4BP0A 1YCFA 3X2XA 5LSCA 3A4YA 4Z5ZA 3IOGA 5EH9A 5EWAA 4HKYA 1WW1A 3KNSA 5AXOA 5LS3A 3WXCA 2AIOA 2BC2A 5EV8A 4YSBA 2BG6A 4BZ3A 4DIKA 4C1FA 1JT1A 4B87A 2QDSA 3SFPA 1KO2A 5AYAA 5HIQA 3IDZA 2BR6A 4AX1B 4NQ5A 5LLDA 2GMNA 3SBLA 1QH5A 2OHJA 3BK2A 4FSBA 4XUKA 3T3OA 5LCAA 2P1EA 3DH8A 4YSKA 4YSLA 2WYMC 2P4ZA 2M5CA 2FU7A 3FCZA 3LVZA 2YCBA 3R2UA 4NQ6A 3IE1A 5ACRA 2QDTA 2FHXA 3ZNBA 4GCWA 4HL1A 2YNVA 3IELA 2E7YA 2BFZA 4KEPA 2P97A 4UBQA 4D1WA 2BG2A 5FQAA 1X8GA 1DDKA 2YNTB 3IEKA 2WHGA 4D1VA 2BG8B 2FK6A 1JJTA 2A7MA 4GYUA 3S0ZA 3DHAA 2XF4A 2UYXA 4AX0B 4J5FA 4D1TA 1A7TA 1BC2A 4LE6A 4U4LA 4Z6XA 1WUOA 5HH5A 4AWYB 1K07A 1BVTA 5KIKA 3I14A 5HIPA 4EXYA 1WUPA 2BTNA 4DILA 2NXAA 1DXKA 3I0VA 2M5DA 3QH8A 5DPXA 4FEKA 1Y44A 2GCUA 5EVBA 4P62A 2ZWRA 5AHOA 2FU8A 3AF6A 5ACSA 1X8HA 3AJ3A 4GYQA 4TZEA 1M2XA 3IOFA 5EVKA 5K4KA 4EYFA 4C1HA 3KNRA 2FU9A 3MD7A 4XWWA 4EY2A 4WD6A 2FM6A 4ZEJA 1KO3A 2OHIA 3SD9A 4ZO3A 4UWSB 5LM6A 1A8TA 4UAMA 4TZFA 2VW8A 4Z67A 2QJSA 5HH4A 5ACWA 4C09A 5LCFA 4AWZA 1XM8A 3X2ZA 2I7XA 4TZBA 3ZWFA 3PY6A 4D1UA 3RKJA 3VPEA 3PY5A 2I7TA 1VJNA 5AHRA 5ACTA 4HL2A 5ACPA 4F6ZA 5A5ZA 1KR3A 2YNWA 2GFKA 2Y8AA 2BG8A 4C1DA 4RL2A 5AXRA 2FHXB 5LCHA 5A0TA 2YNVB 5EHTA 2BFZB 4EXSA 4PVOA 3FAIA 1SMLA 3I13A 4RAWA 5ACVA 4NQ2A 4EYLA 1ZKPA 1JJEA 5K0WA 1VGNA 2QINA 5KILA 3H3EA 5ACQA 2YZ3A 3RPCA 2BIBA 2DOOA 5K4NA 3BV6A 3JXPA 1HLKA 4ZO2A 2NYPA 4PVTA 2NZEA 1ZTCA 2P18A 4EFZA 3SPUA 5IQKA 1XTOA 1E5DA 2CBNA 5B3RA 4EYBA 5K4MA 4D02A 4Z7RA 2AZ4A 3KL7A 2ZZIA 2ZNBA 3F9OA 2NZFA 5ACUA 2R2DA 2XR1A 4XWTA 3SRXA 5FQCA 4TYFA 4TZ9A 1QH3A 4ZNBA 2BG7A 5FQBA 5EVDA 2GKLA 2FU6A 5LE1A 4UWRB 3RKKA 5ACXA 4RM5A 2YNUA 3P2UA 4Z5YA 3I11A 3BK1A 5EW0A 2Q42A 5HIOA 3IE0A 4H0DA 5A0VA 3SW3A 3T9MA 5HH6A 2I7VA 1BMCA 1P9EA 4UA4A 4UWOB 2QEDA 4TYTA 3X2YA 3L6NA 4J5HA 2OHHA 3I15A 5LMCA 1MQOA 2BFLA 5EV6A 2YNTA 1ZNBA 3ADRA 1VMEA 2WYMA 2WYLA 1DD6A 5B1UA 3IEMA 1YCGA 2BFKA 4Z60A 2DKFA 2Q9UA 2BGAA 5A87A 2BMIA 3T3NA 3ZQ4A 2Q0IA 3DHBA 1YCHA 5HISA 3IE2A 3X30A 3ESHA 4RL0A 2Y87A 3Q6VA 3TP9A 2HB9A 4KEQA 3DHCA 3G1PA 4V0HA 4F6HA 4RAMA 2Q0JA 3PG4A 4AD9A 4UWPB 4RBSA 5AEBA 4C1GA 1WRAA
chains in the Genus database with same CATH superfamily
2ZO4A 4C1EA 2H6AA 3ZR9A 4FR7A 4C1CA 4O98A 2GFJA 2WRSA 1L9YA 4JO0A 3AF5A 4CHLA 3VQZA 2Y8BA 3BC2A 1X8IA 5B15A 4NQ4A 4AXHA 4BP0A 1YCFA 3X2XA 5LSCA 3A4YA 4Z5ZA 3IOGA 5EH9A 5EWAA 2CFZA 4HKYA 1WW1A 3KNSA 5AXOA 5LS3A 3WXCA 2AIOA 2BC2A 5EV8A 4YSBA 2BG6A 4BZ3A 4DIKA 4C1FA 1JT1A 4B87A 2QDSA 3SFPA 1KO2A 5AYAA 5HIQA 3IDZA 2BR6A 4AX1B 4NQ5A 5LLDA 2GMNA 3SBLA 1QH5A 2OHJA 3BK2A 4FSBA 4XUKA 3T3OA 5LCAA 2P1EA 3DH8A 4YSKA 4YSLA 2WYMC 2P4ZA 2M5CA 2FU7A 3FCZA 3LVZA 2YCBA 3R2UA 4NQ6A 3IE1A 5ACRA 2CG2A 5A23A 2QDTA 2CG3A 2CFUA 2FHXA 3ZNBA 4GCWA 4HL1A 2YNVA 3IELA 2E7YA 2BFZA 4KEPA 2P97A 4UBQA 4D1WA 2BG2A 5FQAA 1X8GA 1DDKA 2YNTB 3IEKA 2WHGA 4D1VA 2BG8B 2FK6A 1JJTA 2A7MA 4GYUA 3S0ZA 3DHAA 2XF4A 2UYXA 4AX0B 4J5FA 4D1TA 1A7TA 1BC2A 4LE6A 4U4LA 4Z6XA 1WUOA 5HH5A 4AWYB 1K07A 1BVTA 5KIKA 3I14A 5HIPA 4EXYA 1WUPA 2BTNA 4DILA 2NXAA 1DXKA 3I0VA 2M5DA 3QH8A 5DPXA 4FEKA 1Y44A 2GCUA 5EVBA 4P62A 2ZWRA 5AHOA 2FU8A 3AF6A 5ACSA 1X8HA 3AJ3A 4GYQA 4TZEA 1M2XA 3IOFA 5EVKA 5K4KA 5AJLA 4EYFA 4C1HA 3KNRA 2FU9A 3MD7A 4PDXA 4XWWA 4EY2A 4WD6A 2FM6A 4ZEJA 1KO3A 2OHIA 3SD9A 4ZO3A 4UWSB 5LM6A 1A8TA 4UAMA 4TZFA 2VW8A 4Z67A 2QJSA 5HH4A 5ACWA 4C09A 5LCFA 4AWZA 1XM8A 3X2ZA 2I7XA 4TZBA 3ZWFA 3PY6A 4D1UA 3RKJA 3VPEA 3PY5A 2I7TA 1VJNA 5AHRA 5ACTA 4HL2A 5ACPA 4F6ZA 5A5ZA 1KR3A 2YNWA 2GFKA 2Y8AA 2BG8A 4C1DA 4RL2A 5AXRA 2FHXB 5LCHA 5A0TA 2YHEA 2YNVB 5EHTA 2BFZB 4EXSA 4PVOA 3FAIA 1SMLA 3I13A 4RAWA 5ACVA 4NQ2A 4EYLA 4NURA 1ZKPA 1JJEA 5K0WA 1VGNA 2QINA 5KILA 3H3EA 5ACQA 2YZ3A 3RPCA 2BIBA 2DOOA 5K4NA 3BV6A 3JXPA 1HLKA 4ZO2A 2NYPA 4PVTA 2NZEA 1ZTCA 2P18A 4EFZA 3SPUA 5IQKA 1XTOA 1E5DA 2CBNA 5B3RA 5AIJA 4EYBA 5K4MA 4D02A 4Z7RA 2AZ4A 3KL7A 2ZZIA 2ZNBA 3F9OA 2NZFA 5ACUA 2R2DA 2XR1A 4XWTA 3SRXA 5FQCA 4TYFA 4TZ9A 1QH3A 4ZNBA 2BG7A 5FQBA 5EVDA 2GKLA 2FU6A 5LE1A 4UWRB 3RKKA 5ACXA 4RM5A 2YNUA 3P2UA 4Z5YA 3I11A 3BK1A 5EW0A 2Q42A 5HIOA 3IE0A 4H0DA 5A0VA 3SW3A 3T9MA 5HH6A 2I7VA 1BMCA 1P9EA 4UA4A 4UWOB 2QEDA 4TYTA 3X2YA 3L6NA 4J5HA 2OHHA 3I15A 5LMCA 1MQOA 2BFLA 5EV6A 2YNTA 1ZNBA 3ADRA 1VMEA 2WYMA 2WYLA 1DD6A 5B1UA 3IEMA 1YCGA 2BFKA 4Z60A 2DKFA 2Q9UA 2BGAA 5A87A 2BMIA 3T3NA 3ZQ4A 2Q0IA 3DHBA 1YCHA 4AV7A 5HISA 3IE2A 3X30A 3ESHA 4RL0A 2Y87A 3Q6VA 3TP9A 2HB9A 4KEQA 3DHCA 3G1PA 4V0HA 4F6HA 4RAMA 2Q0JA 3PG4A 4AD9A 4UWPB 4RBSA 5AEBA 4C1GA 1WRAA
chains in the Genus database with same CATH topology
2ZO4A 4C1EA 2H6AA 3ZR9A 4FR7A 4C1CA 4O98A 2GFJA 2WRSA 1L9YA 4JO0A 3AF5A 4CHLA 3VQZA 2Y8BA 3BC2A 1X8IA 5B15A 4NQ4A 4BP0A 1YCFA 3X2XA 5LSCA 3A4YA 4Z5ZA 3IOGA 5EH9A 5EWAA 4HKYA 1WW1A 3KNSA 5AXOA 5LS3A 3WXCA 2AIOA 2BC2A 5EV8A 4YSBA 2BG6A 4BZ3A 4DIKA 4C1FA 1JT1A 4B87A 2QDSA 3SFPA 1KO2A 5AYAA 5HIQA 3IDZA 2BR6A 4AX1B 4NQ5A 5LLDA 2GMNA 3SBLA 1QH5A 2OHJA 3BK2A 4FSBA 4XUKA 3T3OA 5LCAA 2P1EA 3DH8A 4YSKA 4YSLA 2WYMC 2P4ZA 2M5CA 2FU7A 3FCZA 3LVZA 2YCBA 3R2UA 4NQ6A 3IE1A 5ACRA 2QDTA 2FHXA 3ZNBA 4GCWA 4HL1A 2YNVA 3IELA 2E7YA 2BFZA 4KEPA 2P97A 4UBQA 4D1WA 2BG2A 5FQAA 1X8GA 1DDKA 2YNTB 3IEKA 2WHGA 4D1VA 2BG8B 2FK6A 1JJTA 2A7MA 4GYUA 3S0ZA 3DHAA 2XF4A 2UYXA 4AX0B 4J5FA 4D1TA 1A7TA 1BC2A 4LE6A 4U4LA 4Z6XA 1WUOA 5HH5A 4AWYB 1K07A 1BVTA 5KIKA 3I14A 5HIPA 4EXYA 1WUPA 2BTNA 4DILA 2NXAA 1DXKA 3I0VA 2M5DA 3QH8A 5DPXA 4FEKA 1Y44A 2GCUA 5EVBA 4P62A 2ZWRA 5AHOA 2FU8A 3AF6A 5ACSA 1X8HA 3AJ3A 4GYQA 4TZEA 1M2XA 3IOFA 5EVKA 5K4KA 4EYFA 4C1HA 3KNRA 2FU9A 3MD7A 4XWWA 4EY2A 4WD6A 2FM6A 4ZEJA 1KO3A 2OHIA 3SD9A 4ZO3A 4UWSB 5LM6A 1A8TA 4UAMA 4TZFA 2VW8A 4Z67A 2QJSA 5HH4A 5ACWA 4C09A 5LCFA 4AWZA 1XM8A 3X2ZA 2I7XA 4TZBA 3ZWFA 3PY6A 4D1UA 3RKJA 3VPEA 3PY5A 2I7TA 1VJNA 5AHRA 5ACTA 4HL2A 5ACPA 4F6ZA 5A5ZA 1KR3A 2YNWA 2GFKA 2Y8AA 2BG8A 4C1DA 4RL2A 5AXRA 2FHXB 5LCHA 5A0TA 2YNVB 5EHTA 2BFZB 4EXSA 4PVOA 3FAIA 1SMLA 3I13A 4RAWA 5ACVA 4NQ2A 4EYLA 1ZKPA 1JJEA 5K0WA 1VGNA 2QINA 5KILA 3H3EA 5ACQA 2YZ3A 3RPCA 2BIBA 2DOOA 5K4NA 3BV6A 3JXPA 1HLKA 4ZO2A 2NYPA 4PVTA 2NZEA 1ZTCA 2P18A 4EFZA 3SPUA 5IQKA 1XTOA 1E5DA 2CBNA 5B3RA 4EYBA 5K4MA 4D02A 4Z7RA 2AZ4A 3KL7A 2ZZIA 2ZNBA 3F9OA 2NZFA 5ACUA 2R2DA 2XR1A 4XWTA 3SRXA 5FQCA 4TYFA 4TZ9A 1QH3A 4ZNBA 2BG7A 5FQBA 5EVDA 2GKLA 2FU6A 5LE1A 4UWRB 3RKKA 5ACXA 4RM5A 2YNUA 3P2UA 4Z5YA 3I11A 3BK1A 5EW0A 2Q42A 5HIOA 3IE0A 4H0DA 5A0VA 3SW3A 3T9MA 5HH6A 2I7VA 1BMCA 1P9EA 4UA4A 4UWOB 2QEDA 4TYTA 3X2YA 3L6NA 4J5HA 2OHHA 3I15A 5LMCA 1MQOA 2BFLA 5EV6A 2YNTA 1ZNBA 3ADRA 1VMEA 2WYMA 2WYLA 1DD6A 5B1UA 3IEMA 1YCGA 2BFKA 4Z60A 2DKFA 2Q9UA 2BGAA 5A87A 2BMIA 3T3NA 3ZQ4A 2Q0IA 3DHBA 1YCHA 5HISA 3IE2A 3X30A 3ESHA 4RL0A 2Y87A 3Q6VA 3TP9A 2HB9A 4KEQA 3DHCA 3G1PA 4V0HA 4F6HA 4RAMA 2Q0JA 3PG4A 4AD9A 4UWPB 4RBSA 5AEBA 4C1GA 1WRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZO4 A;  4C1E A;  2H6A A;  3ZR9 A;  4FR7 A;  4C1C A;  4O98 A;  2GFJ A;  2WRS A;  1L9Y A;  4JO0 A;  3AF5 A;  4CHL A;  3VQZ A;  2Y8B A;  3BC2 A;  1X8I A;  5B15 A;  4NQ4 A;  4BP0 A;  1YCF A;  3X2X A;  5LSC A;  3A4Y A;  4Z5Z A;  3IOG A;  5EH9 A;  5EWA A;  4HKY A;  1WW1 A;  3KNS A;  5AXO A;  5LS3 A;  3WXC A;  2AIO A;  2BC2 A;  5EV8 A;  4YSB A;  2BG6 A;  4BZ3 A;  4DIK A;  4C1F A;  1JT1 A;  4B87 A;  2QDS A;  3SFP A;  1KO2 A;  5AYA A;  5HIQ A;  3IDZ A;  2BR6 A;  4AX1 B;  4NQ5 A;  5LLD A;  2GMN A;  3SBL A;  1QH5 A;  2OHJ A;  3BK2 A;  4FSB A;  4XUK A;  3T3O A;  5LCA A;  2P1E A;  3DH8 A;  4YSK A;  4YSL A;  2WYM C;  2P4Z A;  2M5C A;  2FU7 A;  3FCZ A;  3LVZ A;  2YCB A;  3R2U A;  4NQ6 A;  3IE1 A;  5ACR A;  2QDT A;  2FHX A;  3ZNB A;  4GCW A;  4HL1 A;  2YNV A;  3IEL A;  2E7Y A;  2BFZ A;  4KEP A;  2P97 A;  4UBQ A;  4D1W A;  2BG2 A;  5FQA A;  1X8G A;  1DDK A;  2YNT B;  3IEK A;  2WHG A;  4D1V A;  2BG8 B;  2FK6 A;  1JJT A;  2A7M A;  4GYU A;  3S0Z A;  3DHA A;  2XF4 A;  2UYX A;  4AX0 B;  4J5F A;  4D1T A;  1A7T A;  1BC2 A;  4LE6 A;  4U4L A;  4Z6X A;  1WUO A;  5HH5 A;  4AWY B;  1K07 A;  1BVT A;  5KIK A;  3I14 A;  5HIP A;  4EXY A;  1WUP A;  2BTN A;  4DIL A;  2NXA A;  1DXK A;  3I0V A;  2M5D A;  3QH8 A;  5DPX A;  4FEK A;  1Y44 A;  2GCU A;  5EVB A;  4P62 A;  2ZWR A;  5AHO A;  2FU8 A;  3AF6 A;  5ACS A;  1X8H A;  3AJ3 A;  4GYQ A;  4TZE A;  1M2X A;  3IOF A;  5EVK A;  5K4K A;  4EYF A;  4C1H A;  3KNR A;  2FU9 A;  3MD7 A;  4XWW A;  4EY2 A;  4WD6 A;  2FM6 A;  4ZEJ A;  1KO3 A;  2OHI A;  3SD9 A;  4ZO3 A;  4UWS B;  5LM6 A;  1A8T A;  4UAM A;  4TZF A;  2VW8 A;  4Z67 A;  2QJS A;  5HH4 A;  5ACW A;  4C09 A;  5LCF A;  4AWZ A;  1XM8 A;  3X2Z A;  2I7X A;  4TZB A;  3ZWF A;  3PY6 A;  4D1U A;  3RKJ A;  3VPE A;  3PY5 A;  2I7T A;  1VJN A;  5AHR A;  5ACT A;  4HL2 A;  5ACP A;  4F6Z A;  5A5Z A;  1KR3 A;  2YNW A;  2GFK A;  2Y8A A;  2BG8 A;  4C1D A;  4RL2 A;  5AXR A;  2FHX B;  5LCH A;  5A0T A;  2YNV B;  5EHT A;  2BFZ B;  4EXS A;  4PVO A;  3FAI A;  1SML A;  3I13 A;  4RAW A;  5ACV A;  4NQ2 A;  4EYL A;  1ZKP A;  1JJE A;  5K0W A;  1VGN A;  2QIN A;  5KIL A;  3H3E A;  5ACQ A;  2YZ3 A;  3RPC A;  2BIB A;  2DOO A;  5K4N A;  3BV6 A;  3JXP A;  1HLK A;  4ZO2 A;  2NYP A;  4PVT A;  2NZE A;  1ZTC A;  2P18 A;  4EFZ A;  3SPU A;  5IQK A;  1XTO A;  1E5D A;  2CBN A;  5B3R A;  4EYB A;  5K4M A;  4D02 A;  4Z7R A;  2AZ4 A;  3KL7 A;  2ZZI A;  2ZNB A;  3F9O A;  2NZF A;  5ACU A;  2R2D A;  2XR1 A;  4XWT A;  3SRX A;  5FQC A;  4TYF A;  4TZ9 A;  1QH3 A;  4ZNB A;  2BG7 A;  5FQB A;  5EVD A;  2GKL A;  2FU6 A;  5LE1 A;  4UWR B;  3RKK A;  5ACX A;  4RM5 A;  2YNU A;  3P2U A;  4Z5Y A;  3I11 A;  3BK1 A;  5EW0 A;  2Q42 A;  5HIO A;  3IE0 A;  4H0D A;  5A0V A;  3SW3 A;  3T9M A;  5HH6 A;  2I7V A;  1BMC A;  1P9E A;  4UA4 A;  4UWO B;  2QED A;  4TYT A;  3X2Y A;  3L6N A;  4J5H A;  2OHH A;  3I15 A;  5LMC A;  1MQO A;  2BFL A;  5EV6 A;  2YNT A;  1ZNB A;  3ADR A;  1VME A;  2WYM A;  2WYL A;  1DD6 A;  5B1U A;  3IEM A;  1YCG A;  2BFK A;  4Z60 A;  2DKF A;  2Q9U A;  2BGA A;  5A87 A;  2BMI A;  3T3N A;  3ZQ4 A;  2Q0I A;  3DHB A;  1YCH A;  5HIS A;  3IE2 A;  3X30 A;  3ESH A;  4RL0 A;  2Y87 A;  3Q6V A;  3TP9 A;  2HB9 A;  4KEQ A;  3DHC A;  3G1P A;  4V0H A;  4F6H A;  4RAM A;  2Q0J A;  3PG4 A;  4AD9 A;  4UWP B;  4RBS A;  5AEB A;  4C1G A;  1WRA A; 
#chains in the Genus database with same CATH topology
 2ZO4 A;  4C1E A;  2H6A A;  3ZR9 A;  4FR7 A;  4C1C A;  4O98 A;  2GFJ A;  2WRS A;  1L9Y A;  4JO0 A;  3AF5 A;  4CHL A;  3VQZ A;  2Y8B A;  3BC2 A;  1X8I A;  5B15 A;  4NQ4 A;  4AXH A;  4BP0 A;  1YCF A;  3X2X A;  5LSC A;  3A4Y A;  4Z5Z A;  3IOG A;  5EH9 A;  5EWA A;  2CFZ A;  4HKY A;  1WW1 A;  3KNS A;  5AXO A;  5LS3 A;  3WXC A;  2AIO A;  2BC2 A;  5EV8 A;  4YSB A;  2BG6 A;  4BZ3 A;  4DIK A;  4C1F A;  1JT1 A;  4B87 A;  2QDS A;  3SFP A;  1KO2 A;  5AYA A;  5HIQ A;  3IDZ A;  2BR6 A;  4AX1 B;  4NQ5 A;  5LLD A;  2GMN A;  3SBL A;  1QH5 A;  2OHJ A;  3BK2 A;  4FSB A;  4XUK A;  3T3O A;  5LCA A;  2P1E A;  3DH8 A;  4YSK A;  4YSL A;  2WYM C;  2P4Z A;  2M5C A;  2FU7 A;  3FCZ A;  3LVZ A;  2YCB A;  3R2U A;  4NQ6 A;  3IE1 A;  5ACR A;  2CG2 A;  5A23 A;  2QDT A;  2CG3 A;  2CFU A;  2FHX A;  3ZNB A;  4GCW A;  4HL1 A;  2YNV A;  3IEL A;  2E7Y A;  2BFZ A;  4KEP A;  2P97 A;  4UBQ A;  4D1W A;  2BG2 A;  5FQA A;  1X8G A;  1DDK A;  2YNT B;  3IEK A;  2WHG A;  4D1V A;  2BG8 B;  2FK6 A;  1JJT A;  2A7M A;  4GYU A;  3S0Z A;  3DHA A;  2XF4 A;  2UYX A;  4AX0 B;  4J5F A;  4D1T A;  1A7T A;  1BC2 A;  4LE6 A;  4U4L A;  4Z6X A;  1WUO A;  5HH5 A;  4AWY B;  1K07 A;  1BVT A;  5KIK A;  3I14 A;  5HIP A;  4EXY A;  1WUP A;  2BTN A;  4DIL A;  2NXA A;  1DXK A;  3I0V A;  2M5D A;  3QH8 A;  5DPX A;  4FEK A;  1Y44 A;  2GCU A;  5EVB A;  4P62 A;  2ZWR A;  5AHO A;  2FU8 A;  3AF6 A;  5ACS A;  1X8H A;  3AJ3 A;  4GYQ A;  4TZE A;  1M2X A;  3IOF A;  5EVK A;  5K4K A;  5AJL A;  4EYF A;  4C1H A;  3KNR A;  2FU9 A;  3MD7 A;  4PDX A;  4XWW A;  4EY2 A;  4WD6 A;  2FM6 A;  4ZEJ A;  1KO3 A;  2OHI A;  3SD9 A;  4ZO3 A;  4UWS B;  5LM6 A;  1A8T A;  4UAM A;  4TZF A;  2VW8 A;  4Z67 A;  2QJS A;  5HH4 A;  5ACW A;  4C09 A;  5LCF A;  4AWZ A;  1XM8 A;  3X2Z A;  2I7X A;  4TZB A;  3ZWF A;  3PY6 A;  4D1U A;  3RKJ A;  3VPE A;  3PY5 A;  2I7T A;  1VJN A;  5AHR A;  5ACT A;  4HL2 A;  5ACP A;  4F6Z A;  5A5Z A;  1KR3 A;  2YNW A;  2GFK A;  2Y8A A;  2BG8 A;  4C1D A;  4RL2 A;  5AXR A;  2FHX B;  5LCH A;  5A0T A;  2YHE A;  2YNV B;  5EHT A;  2BFZ B;  4EXS A;  4PVO A;  3FAI A;  1SML A;  3I13 A;  4RAW A;  5ACV A;  4NQ2 A;  4EYL A;  4NUR A;  1ZKP A;  1JJE A;  5K0W A;  1VGN A;  2QIN A;  5KIL A;  3H3E A;  5ACQ A;  2YZ3 A;  3RPC A;  2BIB A;  2DOO A;  5K4N A;  3BV6 A;  3JXP A;  1HLK A;  4ZO2 A;  2NYP A;  4PVT A;  2NZE A;  1ZTC A;  2P18 A;  4EFZ A;  3SPU A;  5IQK A;  1XTO A;  1E5D A;  2CBN A;  5B3R A;  5AIJ A;  4EYB A;  5K4M A;  4D02 A;  4Z7R A;  2AZ4 A;  3KL7 A;  2ZZI A;  2ZNB A;  3F9O A;  2NZF A;  5ACU A;  2R2D A;  2XR1 A;  4XWT A;  3SRX A;  5FQC A;  4TYF A;  4TZ9 A;  1QH3 A;  4ZNB A;  2BG7 A;  5FQB A;  5EVD A;  2GKL A;  2FU6 A;  5LE1 A;  4UWR B;  3RKK A;  5ACX A;  4RM5 A;  2YNU A;  3P2U A;  4Z5Y A;  3I11 A;  3BK1 A;  5EW0 A;  2Q42 A;  5HIO A;  3IE0 A;  4H0D A;  5A0V A;  3SW3 A;  3T9M A;  5HH6 A;  2I7V A;  1BMC A;  1P9E A;  4UA4 A;  4UWO B;  2QED A;  4TYT A;  3X2Y A;  3L6N A;  4J5H A;  2OHH A;  3I15 A;  5LMC A;  1MQO A;  2BFL A;  5EV6 A;  2YNT A;  1ZNB A;  3ADR A;  1VME A;  2WYM A;  2WYL A;  1DD6 A;  5B1U A;  3IEM A;  1YCG A;  2BFK A;  4Z60 A;  2DKF A;  2Q9U A;  2BGA A;  5A87 A;  2BMI A;  3T3N A;  3ZQ4 A;  2Q0I A;  3DHB A;  1YCH A;  4AV7 A;  5HIS A;  3IE2 A;  3X30 A;  3ESH A;  4RL0 A;  2Y87 A;  3Q6V A;  3TP9 A;  2HB9 A;  4KEQ A;  3DHC A;  3G1P A;  4V0H A;  4F6H A;  4RAM A;  2Q0J A;  3PG4 A;  4AD9 A;  4UWP B;  4RBS A;  5AEB A;  4C1G A;  1WRA A; 
#chains in the Genus database with same CATH homology
 2ZO4 A;  4C1E A;  2H6A A;  3ZR9 A;  4FR7 A;  4C1C A;  4O98 A;  2GFJ A;  2WRS A;  1L9Y A;  4JO0 A;  3AF5 A;  4CHL A;  3VQZ A;  2Y8B A;  3BC2 A;  1X8I A;  5B15 A;  4NQ4 A;  4BP0 A;  1YCF A;  3X2X A;  5LSC A;  3A4Y A;  4Z5Z A;  3IOG A;  5EH9 A;  5EWA A;  4HKY A;  1WW1 A;  3KNS A;  5AXO A;  5LS3 A;  3WXC A;  2AIO A;  2BC2 A;  5EV8 A;  4YSB A;  2BG6 A;  4BZ3 A;  4DIK A;  4C1F A;  1JT1 A;  4B87 A;  2QDS A;  3SFP A;  1KO2 A;  5AYA A;  5HIQ A;  3IDZ A;  2BR6 A;  4AX1 B;  4NQ5 A;  5LLD A;  2GMN A;  3SBL A;  1QH5 A;  2OHJ A;  3BK2 A;  4FSB A;  4XUK A;  3T3O A;  5LCA A;  2P1E A;  3DH8 A;  4YSK A;  4YSL A;  2WYM C;  2P4Z A;  2M5C A;  2FU7 A;  3FCZ A;  3LVZ A;  2YCB A;  3R2U A;  4NQ6 A;  3IE1 A;  5ACR A;  2QDT A;  2FHX A;  3ZNB A;  4GCW A;  4HL1 A;  2YNV A;  3IEL A;  2E7Y A;  2BFZ A;  4KEP A;  2P97 A;  4UBQ A;  4D1W A;  2BG2 A;  5FQA A;  1X8G A;  1DDK A;  2YNT B;  3IEK A;  2WHG A;  4D1V A;  2BG8 B;  2FK6 A;  1JJT A;  2A7M A;  4GYU A;  3S0Z A;  3DHA A;  2XF4 A;  2UYX A;  4AX0 B;  4J5F A;  4D1T A;  1A7T A;  1BC2 A;  4LE6 A;  4U4L A;  4Z6X A;  1WUO A;  5HH5 A;  4AWY B;  1K07 A;  1BVT A;  5KIK A;  3I14 A;  5HIP A;  4EXY A;  1WUP A;  2BTN A;  4DIL A;  2NXA A;  1DXK A;  3I0V A;  2M5D A;  3QH8 A;  5DPX A;  4FEK A;  1Y44 A;  2GCU A;  5EVB A;  4P62 A;  2ZWR A;  5AHO A;  2FU8 A;  3AF6 A;  5ACS A;  1X8H A;  3AJ3 A;  4GYQ A;  4TZE A;  1M2X A;  3IOF A;  5EVK A;  5K4K A;  4EYF A;  4C1H A;  3KNR A;  2FU9 A;  3MD7 A;  4XWW A;  4EY2 A;  4WD6 A;  2FM6 A;  4ZEJ A;  1KO3 A;  2OHI A;  3SD9 A;  4ZO3 A;  4UWS B;  5LM6 A;  1A8T A;  4UAM A;  4TZF A;  2VW8 A;  4Z67 A;  2QJS A;  5HH4 A;  5ACW A;  4C09 A;  5LCF A;  4AWZ A;  1XM8 A;  3X2Z A;  2I7X A;  4TZB A;  3ZWF A;  3PY6 A;  4D1U A;  3RKJ A;  3VPE A;  3PY5 A;  2I7T A;  1VJN A;  5AHR A;  5ACT A;  4HL2 A;  5ACP A;  4F6Z A;  5A5Z A;  1KR3 A;  2YNW A;  2GFK A;  2Y8A A;  2BG8 A;  4C1D A;  4RL2 A;  5AXR A;  2FHX B;  5LCH A;  5A0T A;  2YNV B;  5EHT A;  2BFZ B;  4EXS A;  4PVO A;  3FAI A;  1SML A;  3I13 A;  4RAW A;  5ACV A;  4NQ2 A;  4EYL A;  1ZKP A;  1JJE A;  5K0W A;  1VGN A;  2QIN A;  5KIL A;  3H3E A;  5ACQ A;  2YZ3 A;  3RPC A;  2BIB A;  2DOO A;  5K4N A;  3BV6 A;  3JXP A;  1HLK A;  4ZO2 A;  2NYP A;  4PVT A;  2NZE A;  1ZTC A;  2P18 A;  4EFZ A;  3SPU A;  5IQK A;  1XTO A;  1E5D A;  2CBN A;  5B3R A;  4EYB A;  5K4M A;  4D02 A;  4Z7R A;  2AZ4 A;  3KL7 A;  2ZZI A;  2ZNB A;  3F9O A;  2NZF A;  5ACU A;  2R2D A;  2XR1 A;  4XWT A;  3SRX A;  5FQC A;  4TYF A;  4TZ9 A;  1QH3 A;  4ZNB A;  2BG7 A;  5FQB A;  5EVD A;  2GKL A;  2FU6 A;  5LE1 A;  4UWR B;  3RKK A;  5ACX A;  4RM5 A;  2YNU A;  3P2U A;  4Z5Y A;  3I11 A;  3BK1 A;  5EW0 A;  2Q42 A;  5HIO A;  3IE0 A;  4H0D A;  5A0V A;  3SW3 A;  3T9M A;  5HH6 A;  2I7V A;  1BMC A;  1P9E A;  4UA4 A;  4UWO B;  2QED A;  4TYT A;  3X2Y A;  3L6N A;  4J5H A;  2OHH A;  3I15 A;  5LMC A;  1MQO A;  2BFL A;  5EV6 A;  2YNT A;  1ZNB A;  3ADR A;  1VME A;  2WYM A;  2WYL A;  1DD6 A;  5B1U A;  3IEM A;  1YCG A;  2BFK A;  4Z60 A;  2DKF A;  2Q9U A;  2BGA A;  5A87 A;  2BMI A;  3T3N A;  3ZQ4 A;  2Q0I A;  3DHB A;  1YCH A;  5HIS A;  3IE2 A;  3X30 A;  3ESH A;  4RL0 A;  2Y87 A;  3Q6V A;  3TP9 A;  2HB9 A;  4KEQ A;  3DHC A;  3G1P A;  4V0H A;  4F6H A;  4RAM A;  2Q0J A;  3PG4 A;  4AD9 A;  4UWP B;  4RBS A;  5AEB A;  4C1G A;  1WRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...