3ESHA

Crystal structure of a probable metal-dependent hydrolase from staphylococcus aureus. northeast structural genomics target zr314
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
277
structure length
277
Chain Sequence
b'MKIGDISIHYLNGGNTKMDGGAMFGVVPKPLWSKQYNANERNQINLPTHPILIQTAQYNLIIDAGIGNGKLSEKQLRNFGVDEESHIIADLANYNLTPKDIDYVLMTHMHFDHAAGLTDQAGHAIFENAIHVVQQDEWHEFIAPNIRSKSTYWDKNKGDYSNKLILFEKHFEPVPGIKMQHSGGHSFGHTIITIESQGDKAVHMGDIFPTTAHKNPLWVTAYDDYPMQSIREKERMIPYFIQQQYWFLFYHDENYFAVKYSDDGENIDAYILRETLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein similar to metal-dependent hydrolase
molecule tags Hydrolase
source organism Staphylococcus aureus subsp. aureus mu50
publication title Crystal structure of a probable metal-dependent hydrolase from Staphylococcus aureus. Northeast Structural Genomics target ZR314
rcsb
total genus 72
structure length 277
sequence length 277
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3eshA01
2GKLA 3BV6A 3I13A 2I7TA 2YNTA 2AZ4A 4GCWA 3RKKA 4TZBA 3I14A 1YCFA 5B15A 5K0WA 5EV6A 2I7VA 5B3RA 1X8GA 4UBQA 1DDKA 2Q9UA 4FR7A 2FU8A 4UWOB 4PVOA 4H0DA 3IE1A 4C1EA 2YCBA 1E5DA 2BG7A 3SFPA 3SW3A 3T3NA 2ZO4A 1K07A 4D1TA 2P18A 3DH8A 5EVDA 5IQKA 4O98A 4YSBA 3I15A 1A8TA 1YCHA 2Y8AA 2WYMA 4NQ5A 5ACSA 2YNVB 4BP0A 3VQZA 2GCUA 2BG8B 5LCHA 5HIPA 5ACXA 3I0VA 2OHIA 2NXAA 2ZWRA 4UWRB 4Z67A 4D1WA 4JO0A 4TZFA 3IEKA 2Y87A 3L6NA 4PVTA 3PG4A 5A0TA 2FU9A 1JJTA 2P97A 1KR3A 2GFJA 4C1FA 1A7TA 5KIKA 2YZ3A 2R2DA 3IE2A 3IOGA 4NQ6A 4XWWA 2BFZB 5FQAA 4ZO3A 3SRXA 2HB9A 3SD9A 2FM6A 3BK2A 2AIOA 2OHJA 3X2YA 4GYQA 5K4NA 3KL7A 4CHLA 5AHRA 1ZTCA 3F9OA 3WXCA 3IEMA 5HIOA 2BG8A 5A5ZA 2YNTB 4YSKA 4RAMA 1DD6A 5ACUA 3ESHA 4YSLA 5FQCA 2GFKA 4EYLA 2XR1A 1X8HA 1BMCA 5HH5A 2WRSA 1BC2A 4HL2A 1BVTA 1QH3A 3FAIA 2QJSA 2NZFA 5LLDA 3IE0A 5DPXA 4C09A 2FHXB 3QH8A 4FSBA 4AX0B 1QH5A 3Q6VA 2QEDA 1VMEA 1XM8A 4RL0A 2BTNA 4C1GA 2ZNBA 2E7YA 2CBNA 3KNRA 4TYFA 5LCFA 3ZR9A 1VJNA 5AXRA 5B1UA 5ACPA 3SBLA 4P62A 3R2UA 4EY2A 2FU6A 2NYPA 3TP9A 5ACWA 1ZNBA 5HISA 1JJEA 3IELA 4DILA 4LE6A 2QDTA 4FEKA 4Z7RA 3ADRA 4EYFA 2DKFA 4RL2A 3SPUA 1L9YA 1HLKA 2NZEA 5AYAA 3RKJA 4Z6XA 2YNWA 2FK6A 4UWSB 4AX1B 1JT1A 5LE1A 4Z60A 4BZ3A 3H3EA 5AHOA 5EVBA 3I11A 3LVZA 3P2UA 4C1DA 2BIBA 5KILA 4F6ZA 4ZEJA 2FHXA 3VPEA 2BG6A 1MQOA 2I7XA 4AWYB 3X30A 4KEPA 1WRAA 1VGNA 1KO2A 5LS3A 4Z5YA 4XUKA 4ZNBA 4TZEA 3AF5A 4B87A 2BG2A 5HH4A 4Z5ZA 3BK1A 5K4MA 2Q0IA 4UA4A 4UAMA 2M5CA 4J5HA 1XTOA 2YNUA 3S0ZA 5LM6A 2P4ZA 2FU7A 1WUOA 4D1VA 2GMNA 2Q42A 2OHHA 1DXKA 5ACQA 3T3OA 2YNVA 5AXOA 4RM5A 5EVKA 3G1PA 4V0HA 4RAWA 5A87A 5ACRA 2QDSA 1ZKPA 3IDZA 4HL1A 1WUPA 3PY5A 3KNSA 4EXSA 2BGAA 4XWTA 3DHBA 2WHGA 5LCAA 2Q0JA 4DIKA 5A0VA 5FQBA 3BC2A 3T9MA 3ZWFA 3AJ3A 4AWZA 2P1EA 3IOFA 1M2XA 4D1UA 2H6AA 4HKYA 2BFLA 4AD9A 4TZ9A 5HIQA 3MD7A 2VW8A 4EFZA 3AF6A 4D02A 5EHTA 3X2ZA 4J5FA 3X2XA 2UYXA 3FCZA 3DHAA 5EH9A 2BFKA 4C1CA 4WD6A 2BR6A 5AEBA 1WW1A 1SMLA 1X8IA 3ZQ4A 4EXYA 3ZNBA 4GYUA 2BC2A 2Y8BA 5LSCA 4KEQA 2WYMC 1P9EA 4TYTA 2A7MA 3A4YA 4RBSA 1YCGA 2M5DA 3PY6A 1Y44A 4UWPB 2DOOA 4C1HA 4ZO2A 5LMCA 2XF4A 5EWAA 3DHCA 2BMIA 4NQ2A 1KO3A 4EYBA 5ACTA 2BFZA 2QINA 2ZZIA 4U4LA 2WYLA 5EV8A 5EW0A 5K4KA 4F6HA 3JXPA 3RPCA 5ACVA 5HH6A 4NQ4A
chains in the Genus database with same CATH superfamily
2GKLA 3BV6A 3I13A 2I7TA 2YNTA 2AZ4A 4GCWA 3RKKA 4TZBA 3I14A 1YCFA 5B15A 5K0WA 5EV6A 2I7VA 5B3RA 1X8GA 4UBQA 1DDKA 2Q9UA 4FR7A 2FU8A 4UWOB 4PVOA 4H0DA 3IE1A 4C1EA 2YCBA 1E5DA 2BG7A 3SFPA 3SW3A 2YHEA 3T3NA 2ZO4A 1K07A 4D1TA 2P18A 3DH8A 5EVDA 5IQKA 4O98A 4YSBA 3I15A 1A8TA 1YCHA 2Y8AA 2WYMA 4NQ5A 5ACSA 2YNVB 4BP0A 3VQZA 2GCUA 2BG8B 5LCHA 5HIPA 5ACXA 3I0VA 2OHIA 2NXAA 2ZWRA 4UWRB 4Z67A 4D1WA 4JO0A 4TZFA 3IEKA 2Y87A 3L6NA 4PVTA 3PG4A 5A0TA 2FU9A 2CFZA 1JJTA 2P97A 1KR3A 2GFJA 4C1FA 1A7TA 5KIKA 2YZ3A 2R2DA 3IE2A 3IOGA 4NQ6A 4XWWA 2BFZB 5FQAA 4ZO3A 3SRXA 2CFUA 2HB9A 3SD9A 2FM6A 3BK2A 2AIOA 2OHJA 3X2YA 4GYQA 5K4NA 3KL7A 4CHLA 5AHRA 1ZTCA 3F9OA 3WXCA 3IEMA 5HIOA 2BG8A 5A5ZA 2YNTB 4YSKA 4RAMA 1DD6A 5ACUA 3ESHA 4YSLA 5FQCA 2GFKA 4EYLA 2XR1A 1X8HA 1BMCA 5HH5A 2WRSA 1BC2A 4PDXA 4HL2A 1BVTA 1QH3A 3FAIA 2QJSA 2NZFA 5LLDA 3IE0A 5DPXA 4C09A 2FHXB 3QH8A 4FSBA 4AX0B 1QH5A 3Q6VA 2QEDA 1VMEA 1XM8A 4RL0A 2BTNA 4C1GA 2ZNBA 2E7YA 2CBNA 3KNRA 4TYFA 5LCFA 3ZR9A 1VJNA 5AXRA 5B1UA 5ACPA 3SBLA 4P62A 3R2UA 4EY2A 2FU6A 2NYPA 3TP9A 5ACWA 1ZNBA 5HISA 1JJEA 3IELA 4DILA 4LE6A 2QDTA 4FEKA 4Z7RA 4NURA 3ADRA 4EYFA 2DKFA 4RL2A 3SPUA 1L9YA 1HLKA 2NZEA 5AYAA 3RKJA 4Z6XA 2YNWA 2FK6A 4UWSB 4AX1B 1JT1A 5LE1A 4Z60A 4BZ3A 3H3EA 5AHOA 5EVBA 3I11A 3LVZA 3P2UA 4C1DA 2BIBA 5KILA 4F6ZA 5A23A 4ZEJA 2FHXA 3VPEA 2BG6A 1MQOA 2I7XA 4AWYB 3X30A 4KEPA 1WRAA 1VGNA 1KO2A 5LS3A 4Z5YA 4XUKA 4ZNBA 4TZEA 3AF5A 4B87A 2BG2A 5HH4A 4Z5ZA 3BK1A 5K4MA 2Q0IA 4UA4A 4UAMA 2M5CA 4J5HA 1XTOA 2YNUA 3S0ZA 5LM6A 2P4ZA 5AJLA 2FU7A 1WUOA 4D1VA 2GMNA 2Q42A 5AIJA 2OHHA 1DXKA 5ACQA 3T3OA 2YNVA 5AXOA 4RM5A 5EVKA 3G1PA 4V0HA 4RAWA 4AV7A 5A87A 5ACRA 2QDSA 1ZKPA 3IDZA 4HL1A 1WUPA 3PY5A 3KNSA 4EXSA 2BGAA 4XWTA 3DHBA 2WHGA 5LCAA 2Q0JA 4DIKA 5A0VA 5FQBA 3BC2A 3T9MA 3ZWFA 3AJ3A 4AWZA 2P1EA 3IOFA 1M2XA 4D1UA 2H6AA 4HKYA 2BFLA 4AD9A 4TZ9A 5HIQA 3MD7A 2VW8A 4EFZA 3AF6A 4D02A 5EHTA 3X2ZA 4J5FA 3X2XA 2UYXA 3FCZA 3DHAA 5EH9A 2BFKA 4C1CA 4WD6A 2BR6A 5AEBA 1WW1A 1SMLA 1X8IA 3ZQ4A 4EXYA 3ZNBA 4GYUA 2BC2A 2Y8BA 5LSCA 2CG3A 4KEQA 2WYMC 1P9EA 4TYTA 2A7MA 3A4YA 4RBSA 1YCGA 2M5DA 3PY6A 1Y44A 4UWPB 2DOOA 4C1HA 4AXHA 4ZO2A 5LMCA 2XF4A 5EWAA 3DHCA 2BMIA 4NQ2A 1KO3A 4EYBA 5ACTA 2BFZA 2QINA 2ZZIA 4U4LA 2WYLA 5EV8A 5EW0A 5K4KA 4F6HA 3JXPA 3RPCA 5ACVA 2CG2A 5HH6A 4NQ4A
chains in the Genus database with same CATH topology
2GKLA 3BV6A 3I13A 2I7TA 2YNTA 2AZ4A 4GCWA 3RKKA 4TZBA 3I14A 1YCFA 5B15A 5K0WA 5EV6A 2I7VA 5B3RA 1X8GA 4UBQA 1DDKA 2Q9UA 4FR7A 2FU8A 4UWOB 4PVOA 4H0DA 3IE1A 4C1EA 2YCBA 1E5DA 2BG7A 3SFPA 3SW3A 3T3NA 2ZO4A 1K07A 4D1TA 2P18A 3DH8A 5EVDA 5IQKA 4O98A 4YSBA 3I15A 1A8TA 1YCHA 2Y8AA 2WYMA 4NQ5A 5ACSA 2YNVB 4BP0A 3VQZA 2GCUA 2BG8B 5LCHA 5HIPA 5ACXA 3I0VA 2OHIA 2NXAA 2ZWRA 4UWRB 4Z67A 4D1WA 4JO0A 4TZFA 3IEKA 2Y87A 3L6NA 4PVTA 3PG4A 5A0TA 2FU9A 1JJTA 2P97A 1KR3A 2GFJA 4C1FA 1A7TA 5KIKA 2YZ3A 2R2DA 3IE2A 3IOGA 4NQ6A 4XWWA 2BFZB 5FQAA 4ZO3A 3SRXA 2HB9A 3SD9A 2FM6A 3BK2A 2AIOA 2OHJA 3X2YA 4GYQA 5K4NA 3KL7A 4CHLA 5AHRA 1ZTCA 3F9OA 3WXCA 3IEMA 5HIOA 2BG8A 5A5ZA 2YNTB 4YSKA 4RAMA 1DD6A 5ACUA 3ESHA 4YSLA 5FQCA 2GFKA 4EYLA 2XR1A 1X8HA 1BMCA 5HH5A 2WRSA 1BC2A 4HL2A 1BVTA 1QH3A 3FAIA 2QJSA 2NZFA 5LLDA 3IE0A 5DPXA 4C09A 2FHXB 3QH8A 4FSBA 4AX0B 1QH5A 3Q6VA 2QEDA 1VMEA 1XM8A 4RL0A 2BTNA 4C1GA 2ZNBA 2E7YA 2CBNA 3KNRA 4TYFA 5LCFA 3ZR9A 1VJNA 5AXRA 5B1UA 5ACPA 3SBLA 4P62A 3R2UA 4EY2A 2FU6A 2NYPA 3TP9A 5ACWA 1ZNBA 5HISA 1JJEA 3IELA 4DILA 4LE6A 2QDTA 4FEKA 4Z7RA 3ADRA 4EYFA 2DKFA 4RL2A 3SPUA 1L9YA 1HLKA 2NZEA 5AYAA 3RKJA 4Z6XA 2YNWA 2FK6A 4UWSB 4AX1B 1JT1A 5LE1A 4Z60A 4BZ3A 3H3EA 5AHOA 5EVBA 3I11A 3LVZA 3P2UA 4C1DA 2BIBA 5KILA 4F6ZA 4ZEJA 2FHXA 3VPEA 2BG6A 1MQOA 2I7XA 4AWYB 3X30A 4KEPA 1WRAA 1VGNA 1KO2A 5LS3A 4Z5YA 4XUKA 4ZNBA 4TZEA 3AF5A 4B87A 2BG2A 5HH4A 4Z5ZA 3BK1A 5K4MA 2Q0IA 4UA4A 4UAMA 2M5CA 4J5HA 1XTOA 2YNUA 3S0ZA 5LM6A 2P4ZA 2FU7A 1WUOA 4D1VA 2GMNA 2Q42A 2OHHA 1DXKA 5ACQA 3T3OA 2YNVA 5AXOA 4RM5A 5EVKA 3G1PA 4V0HA 4RAWA 5A87A 5ACRA 2QDSA 1ZKPA 3IDZA 4HL1A 1WUPA 3PY5A 3KNSA 4EXSA 2BGAA 4XWTA 3DHBA 2WHGA 5LCAA 2Q0JA 4DIKA 5A0VA 5FQBA 3BC2A 3T9MA 3ZWFA 3AJ3A 4AWZA 2P1EA 3IOFA 1M2XA 4D1UA 2H6AA 4HKYA 2BFLA 4AD9A 4TZ9A 5HIQA 3MD7A 2VW8A 4EFZA 3AF6A 4D02A 5EHTA 3X2ZA 4J5FA 3X2XA 2UYXA 3FCZA 3DHAA 5EH9A 2BFKA 4C1CA 4WD6A 2BR6A 5AEBA 1WW1A 1SMLA 1X8IA 3ZQ4A 4EXYA 3ZNBA 4GYUA 2BC2A 2Y8BA 5LSCA 4KEQA 2WYMC 1P9EA 4TYTA 2A7MA 3A4YA 4RBSA 1YCGA 2M5DA 3PY6A 1Y44A 4UWPB 2DOOA 4C1HA 4ZO2A 5LMCA 2XF4A 5EWAA 3DHCA 2BMIA 4NQ2A 1KO3A 4EYBA 5ACTA 2BFZA 2QINA 2ZZIA 4U4LA 2WYLA 5EV8A 5EW0A 5K4KA 4F6HA 3JXPA 3RPCA 5ACVA 5HH6A 4NQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GKL A;  3BV6 A;  3I13 A;  2I7T A;  2YNT A;  2AZ4 A;  4GCW A;  3RKK A;  4TZB A;  3I14 A;  1YCF A;  5B15 A;  5K0W A;  5EV6 A;  2I7V A;  5B3R A;  1X8G A;  4UBQ A;  1DDK A;  2Q9U A;  4FR7 A;  2FU8 A;  4UWO B;  4PVO A;  4H0D A;  3IE1 A;  4C1E A;  2YCB A;  1E5D A;  2BG7 A;  3SFP A;  3SW3 A;  3T3N A;  2ZO4 A;  1K07 A;  4D1T A;  2P18 A;  3DH8 A;  5EVD A;  5IQK A;  4O98 A;  4YSB A;  3I15 A;  1A8T A;  1YCH A;  2Y8A A;  2WYM A;  4NQ5 A;  5ACS A;  2YNV B;  4BP0 A;  3VQZ A;  2GCU A;  2BG8 B;  5LCH A;  5HIP A;  5ACX A;  3I0V A;  2OHI A;  2NXA A;  2ZWR A;  4UWR B;  4Z67 A;  4D1W A;  4JO0 A;  4TZF A;  3IEK A;  2Y87 A;  3L6N A;  4PVT A;  3PG4 A;  5A0T A;  2FU9 A;  1JJT A;  2P97 A;  1KR3 A;  2GFJ A;  4C1F A;  1A7T A;  5KIK A;  2YZ3 A;  2R2D A;  3IE2 A;  3IOG A;  4NQ6 A;  4XWW A;  2BFZ B;  5FQA A;  4ZO3 A;  3SRX A;  2HB9 A;  3SD9 A;  2FM6 A;  3BK2 A;  2AIO A;  2OHJ A;  3X2Y A;  4GYQ A;  5K4N A;  3KL7 A;  4CHL A;  5AHR A;  1ZTC A;  3F9O A;  3WXC A;  3IEM A;  5HIO A;  2BG8 A;  5A5Z A;  2YNT B;  4YSK A;  4RAM A;  1DD6 A;  5ACU A;  3ESH A;  4YSL A;  5FQC A;  2GFK A;  4EYL A;  2XR1 A;  1X8H A;  1BMC A;  5HH5 A;  2WRS A;  1BC2 A;  4HL2 A;  1BVT A;  1QH3 A;  3FAI A;  2QJS A;  2NZF A;  5LLD A;  3IE0 A;  5DPX A;  4C09 A;  2FHX B;  3QH8 A;  4FSB A;  4AX0 B;  1QH5 A;  3Q6V A;  2QED A;  1VME A;  1XM8 A;  4RL0 A;  2BTN A;  4C1G A;  2ZNB A;  2E7Y A;  2CBN A;  3KNR A;  4TYF A;  5LCF A;  3ZR9 A;  1VJN A;  5AXR A;  5B1U A;  5ACP A;  3SBL A;  4P62 A;  3R2U A;  4EY2 A;  2FU6 A;  2NYP A;  3TP9 A;  5ACW A;  1ZNB A;  5HIS A;  1JJE A;  3IEL A;  4DIL A;  4LE6 A;  2QDT A;  4FEK A;  4Z7R A;  3ADR A;  4EYF A;  2DKF A;  4RL2 A;  3SPU A;  1L9Y A;  1HLK A;  2NZE A;  5AYA A;  3RKJ A;  4Z6X A;  2YNW A;  2FK6 A;  4UWS B;  4AX1 B;  1JT1 A;  5LE1 A;  4Z60 A;  4BZ3 A;  3H3E A;  5AHO A;  5EVB A;  3I11 A;  3LVZ A;  3P2U A;  4C1D A;  2BIB A;  5KIL A;  4F6Z A;  4ZEJ A;  2FHX A;  3VPE A;  2BG6 A;  1MQO A;  2I7X A;  4AWY B;  3X30 A;  4KEP A;  1WRA A;  1VGN A;  1KO2 A;  5LS3 A;  4Z5Y A;  4XUK A;  4ZNB A;  4TZE A;  3AF5 A;  4B87 A;  2BG2 A;  5HH4 A;  4Z5Z A;  3BK1 A;  5K4M A;  2Q0I A;  4UA4 A;  4UAM A;  2M5C A;  4J5H A;  1XTO A;  2YNU A;  3S0Z A;  5LM6 A;  2P4Z A;  2FU7 A;  1WUO A;  4D1V A;  2GMN A;  2Q42 A;  2OHH A;  1DXK A;  5ACQ A;  3T3O A;  2YNV A;  5AXO A;  4RM5 A;  5EVK A;  3G1P A;  4V0H A;  4RAW A;  5A87 A;  5ACR A;  2QDS A;  1ZKP A;  3IDZ A;  4HL1 A;  1WUP A;  3PY5 A;  3KNS A;  4EXS A;  2BGA A;  4XWT A;  3DHB A;  2WHG A;  5LCA A;  2Q0J A;  4DIK A;  5A0V A;  5FQB A;  3BC2 A;  3T9M A;  3ZWF A;  3AJ3 A;  4AWZ A;  2P1E A;  3IOF A;  1M2X A;  4D1U A;  2H6A A;  4HKY A;  2BFL A;  4AD9 A;  4TZ9 A;  5HIQ A;  3MD7 A;  2VW8 A;  4EFZ A;  3AF6 A;  4D02 A;  5EHT A;  3X2Z A;  4J5F A;  3X2X A;  2UYX A;  3FCZ A;  3DHA A;  5EH9 A;  2BFK A;  4C1C A;  4WD6 A;  2BR6 A;  5AEB A;  1WW1 A;  1SML A;  1X8I A;  3ZQ4 A;  4EXY A;  3ZNB A;  4GYU A;  2BC2 A;  2Y8B A;  5LSC A;  4KEQ A;  2WYM C;  1P9E A;  4TYT A;  2A7M A;  3A4Y A;  4RBS A;  1YCG A;  2M5D A;  3PY6 A;  1Y44 A;  4UWP B;  2DOO A;  4C1H A;  4ZO2 A;  5LMC A;  2XF4 A;  5EWA A;  3DHC A;  2BMI A;  4NQ2 A;  1KO3 A;  4EYB A;  5ACT A;  2BFZ A;  2QIN A;  2ZZI A;  4U4L A;  2WYL A;  5EV8 A;  5EW0 A;  5K4K A;  4F6H A;  3JXP A;  3RPC A;  5ACV A;  5HH6 A;  4NQ4 A; 
#chains in the Genus database with same CATH topology
 2GKL A;  3BV6 A;  3I13 A;  2I7T A;  2YNT A;  2AZ4 A;  4GCW A;  3RKK A;  4TZB A;  3I14 A;  1YCF A;  5B15 A;  5K0W A;  5EV6 A;  2I7V A;  5B3R A;  1X8G A;  4UBQ A;  1DDK A;  2Q9U A;  4FR7 A;  2FU8 A;  4UWO B;  4PVO A;  4H0D A;  3IE1 A;  4C1E A;  2YCB A;  1E5D A;  2BG7 A;  3SFP A;  3SW3 A;  2YHE A;  3T3N A;  2ZO4 A;  1K07 A;  4D1T A;  2P18 A;  3DH8 A;  5EVD A;  5IQK A;  4O98 A;  4YSB A;  3I15 A;  1A8T A;  1YCH A;  2Y8A A;  2WYM A;  4NQ5 A;  5ACS A;  2YNV B;  4BP0 A;  3VQZ A;  2GCU A;  2BG8 B;  5LCH A;  5HIP A;  5ACX A;  3I0V A;  2OHI A;  2NXA A;  2ZWR A;  4UWR B;  4Z67 A;  4D1W A;  4JO0 A;  4TZF A;  3IEK A;  2Y87 A;  3L6N A;  4PVT A;  3PG4 A;  5A0T A;  2FU9 A;  2CFZ A;  1JJT A;  2P97 A;  1KR3 A;  2GFJ A;  4C1F A;  1A7T A;  5KIK A;  2YZ3 A;  2R2D A;  3IE2 A;  3IOG A;  4NQ6 A;  4XWW A;  2BFZ B;  5FQA A;  4ZO3 A;  3SRX A;  2CFU A;  2HB9 A;  3SD9 A;  2FM6 A;  3BK2 A;  2AIO A;  2OHJ A;  3X2Y A;  4GYQ A;  5K4N A;  3KL7 A;  4CHL A;  5AHR A;  1ZTC A;  3F9O A;  3WXC A;  3IEM A;  5HIO A;  2BG8 A;  5A5Z A;  2YNT B;  4YSK A;  4RAM A;  1DD6 A;  5ACU A;  3ESH A;  4YSL A;  5FQC A;  2GFK A;  4EYL A;  2XR1 A;  1X8H A;  1BMC A;  5HH5 A;  2WRS A;  1BC2 A;  4PDX A;  4HL2 A;  1BVT A;  1QH3 A;  3FAI A;  2QJS A;  2NZF A;  5LLD A;  3IE0 A;  5DPX A;  4C09 A;  2FHX B;  3QH8 A;  4FSB A;  4AX0 B;  1QH5 A;  3Q6V A;  2QED A;  1VME A;  1XM8 A;  4RL0 A;  2BTN A;  4C1G A;  2ZNB A;  2E7Y A;  2CBN A;  3KNR A;  4TYF A;  5LCF A;  3ZR9 A;  1VJN A;  5AXR A;  5B1U A;  5ACP A;  3SBL A;  4P62 A;  3R2U A;  4EY2 A;  2FU6 A;  2NYP A;  3TP9 A;  5ACW A;  1ZNB A;  5HIS A;  1JJE A;  3IEL A;  4DIL A;  4LE6 A;  2QDT A;  4FEK A;  4Z7R A;  4NUR A;  3ADR A;  4EYF A;  2DKF A;  4RL2 A;  3SPU A;  1L9Y A;  1HLK A;  2NZE A;  5AYA A;  3RKJ A;  4Z6X A;  2YNW A;  2FK6 A;  4UWS B;  4AX1 B;  1JT1 A;  5LE1 A;  4Z60 A;  4BZ3 A;  3H3E A;  5AHO A;  5EVB A;  3I11 A;  3LVZ A;  3P2U A;  4C1D A;  2BIB A;  5KIL A;  4F6Z A;  5A23 A;  4ZEJ A;  2FHX A;  3VPE A;  2BG6 A;  1MQO A;  2I7X A;  4AWY B;  3X30 A;  4KEP A;  1WRA A;  1VGN A;  1KO2 A;  5LS3 A;  4Z5Y A;  4XUK A;  4ZNB A;  4TZE A;  3AF5 A;  4B87 A;  2BG2 A;  5HH4 A;  4Z5Z A;  3BK1 A;  5K4M A;  2Q0I A;  4UA4 A;  4UAM A;  2M5C A;  4J5H A;  1XTO A;  2YNU A;  3S0Z A;  5LM6 A;  2P4Z A;  5AJL A;  2FU7 A;  1WUO A;  4D1V A;  2GMN A;  2Q42 A;  5AIJ A;  2OHH A;  1DXK A;  5ACQ A;  3T3O A;  2YNV A;  5AXO A;  4RM5 A;  5EVK A;  3G1P A;  4V0H A;  4RAW A;  4AV7 A;  5A87 A;  5ACR A;  2QDS A;  1ZKP A;  3IDZ A;  4HL1 A;  1WUP A;  3PY5 A;  3KNS A;  4EXS A;  2BGA A;  4XWT A;  3DHB A;  2WHG A;  5LCA A;  2Q0J A;  4DIK A;  5A0V A;  5FQB A;  3BC2 A;  3T9M A;  3ZWF A;  3AJ3 A;  4AWZ A;  2P1E A;  3IOF A;  1M2X A;  4D1U A;  2H6A A;  4HKY A;  2BFL A;  4AD9 A;  4TZ9 A;  5HIQ A;  3MD7 A;  2VW8 A;  4EFZ A;  3AF6 A;  4D02 A;  5EHT A;  3X2Z A;  4J5F A;  3X2X A;  2UYX A;  3FCZ A;  3DHA A;  5EH9 A;  2BFK A;  4C1C A;  4WD6 A;  2BR6 A;  5AEB A;  1WW1 A;  1SML A;  1X8I A;  3ZQ4 A;  4EXY A;  3ZNB A;  4GYU A;  2BC2 A;  2Y8B A;  5LSC A;  2CG3 A;  4KEQ A;  2WYM C;  1P9E A;  4TYT A;  2A7M A;  3A4Y A;  4RBS A;  1YCG A;  2M5D A;  3PY6 A;  1Y44 A;  4UWP B;  2DOO A;  4C1H A;  4AXH A;  4ZO2 A;  5LMC A;  2XF4 A;  5EWA A;  3DHC A;  2BMI A;  4NQ2 A;  1KO3 A;  4EYB A;  5ACT A;  2BFZ A;  2QIN A;  2ZZI A;  4U4L A;  2WYL A;  5EV8 A;  5EW0 A;  5K4K A;  4F6H A;  3JXP A;  3RPC A;  5ACV A;  2CG2 A;  5HH6 A;  4NQ4 A; 
#chains in the Genus database with same CATH homology
 2GKL A;  3BV6 A;  3I13 A;  2I7T A;  2YNT A;  2AZ4 A;  4GCW A;  3RKK A;  4TZB A;  3I14 A;  1YCF A;  5B15 A;  5K0W A;  5EV6 A;  2I7V A;  5B3R A;  1X8G A;  4UBQ A;  1DDK A;  2Q9U A;  4FR7 A;  2FU8 A;  4UWO B;  4PVO A;  4H0D A;  3IE1 A;  4C1E A;  2YCB A;  1E5D A;  2BG7 A;  3SFP A;  3SW3 A;  3T3N A;  2ZO4 A;  1K07 A;  4D1T A;  2P18 A;  3DH8 A;  5EVD A;  5IQK A;  4O98 A;  4YSB A;  3I15 A;  1A8T A;  1YCH A;  2Y8A A;  2WYM A;  4NQ5 A;  5ACS A;  2YNV B;  4BP0 A;  3VQZ A;  2GCU A;  2BG8 B;  5LCH A;  5HIP A;  5ACX A;  3I0V A;  2OHI A;  2NXA A;  2ZWR A;  4UWR B;  4Z67 A;  4D1W A;  4JO0 A;  4TZF A;  3IEK A;  2Y87 A;  3L6N A;  4PVT A;  3PG4 A;  5A0T A;  2FU9 A;  1JJT A;  2P97 A;  1KR3 A;  2GFJ A;  4C1F A;  1A7T A;  5KIK A;  2YZ3 A;  2R2D A;  3IE2 A;  3IOG A;  4NQ6 A;  4XWW A;  2BFZ B;  5FQA A;  4ZO3 A;  3SRX A;  2HB9 A;  3SD9 A;  2FM6 A;  3BK2 A;  2AIO A;  2OHJ A;  3X2Y A;  4GYQ A;  5K4N A;  3KL7 A;  4CHL A;  5AHR A;  1ZTC A;  3F9O A;  3WXC A;  3IEM A;  5HIO A;  2BG8 A;  5A5Z A;  2YNT B;  4YSK A;  4RAM A;  1DD6 A;  5ACU A;  3ESH A;  4YSL A;  5FQC A;  2GFK A;  4EYL A;  2XR1 A;  1X8H A;  1BMC A;  5HH5 A;  2WRS A;  1BC2 A;  4HL2 A;  1BVT A;  1QH3 A;  3FAI A;  2QJS A;  2NZF A;  5LLD A;  3IE0 A;  5DPX A;  4C09 A;  2FHX B;  3QH8 A;  4FSB A;  4AX0 B;  1QH5 A;  3Q6V A;  2QED A;  1VME A;  1XM8 A;  4RL0 A;  2BTN A;  4C1G A;  2ZNB A;  2E7Y A;  2CBN A;  3KNR A;  4TYF A;  5LCF A;  3ZR9 A;  1VJN A;  5AXR A;  5B1U A;  5ACP A;  3SBL A;  4P62 A;  3R2U A;  4EY2 A;  2FU6 A;  2NYP A;  3TP9 A;  5ACW A;  1ZNB A;  5HIS A;  1JJE A;  3IEL A;  4DIL A;  4LE6 A;  2QDT A;  4FEK A;  4Z7R A;  3ADR A;  4EYF A;  2DKF A;  4RL2 A;  3SPU A;  1L9Y A;  1HLK A;  2NZE A;  5AYA A;  3RKJ A;  4Z6X A;  2YNW A;  2FK6 A;  4UWS B;  4AX1 B;  1JT1 A;  5LE1 A;  4Z60 A;  4BZ3 A;  3H3E A;  5AHO A;  5EVB A;  3I11 A;  3LVZ A;  3P2U A;  4C1D A;  2BIB A;  5KIL A;  4F6Z A;  4ZEJ A;  2FHX A;  3VPE A;  2BG6 A;  1MQO A;  2I7X A;  4AWY B;  3X30 A;  4KEP A;  1WRA A;  1VGN A;  1KO2 A;  5LS3 A;  4Z5Y A;  4XUK A;  4ZNB A;  4TZE A;  3AF5 A;  4B87 A;  2BG2 A;  5HH4 A;  4Z5Z A;  3BK1 A;  5K4M A;  2Q0I A;  4UA4 A;  4UAM A;  2M5C A;  4J5H A;  1XTO A;  2YNU A;  3S0Z A;  5LM6 A;  2P4Z A;  2FU7 A;  1WUO A;  4D1V A;  2GMN A;  2Q42 A;  2OHH A;  1DXK A;  5ACQ A;  3T3O A;  2YNV A;  5AXO A;  4RM5 A;  5EVK A;  3G1P A;  4V0H A;  4RAW A;  5A87 A;  5ACR A;  2QDS A;  1ZKP A;  3IDZ A;  4HL1 A;  1WUP A;  3PY5 A;  3KNS A;  4EXS A;  2BGA A;  4XWT A;  3DHB A;  2WHG A;  5LCA A;  2Q0J A;  4DIK A;  5A0V A;  5FQB A;  3BC2 A;  3T9M A;  3ZWF A;  3AJ3 A;  4AWZ A;  2P1E A;  3IOF A;  1M2X A;  4D1U A;  2H6A A;  4HKY A;  2BFL A;  4AD9 A;  4TZ9 A;  5HIQ A;  3MD7 A;  2VW8 A;  4EFZ A;  3AF6 A;  4D02 A;  5EHT A;  3X2Z A;  4J5F A;  3X2X A;  2UYX A;  3FCZ A;  3DHA A;  5EH9 A;  2BFK A;  4C1C A;  4WD6 A;  2BR6 A;  5AEB A;  1WW1 A;  1SML A;  1X8I A;  3ZQ4 A;  4EXY A;  3ZNB A;  4GYU A;  2BC2 A;  2Y8B A;  5LSC A;  4KEQ A;  2WYM C;  1P9E A;  4TYT A;  2A7M A;  3A4Y A;  4RBS A;  1YCG A;  2M5D A;  3PY6 A;  1Y44 A;  4UWP B;  2DOO A;  4C1H A;  4ZO2 A;  5LMC A;  2XF4 A;  5EWA A;  3DHC A;  2BMI A;  4NQ2 A;  1KO3 A;  4EYB A;  5ACT A;  2BFZ A;  2QIN A;  2ZZI A;  4U4L A;  2WYL A;  5EV8 A;  5EW0 A;  5K4K A;  4F6H A;  3JXP A;  3RPC A;  5ACV A;  5HH6 A;  4NQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...