3ESHA

Crystal structure of a probable metal-dependent hydrolase from staphylococcus aureus. northeast structural genomics target zr314
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
277
structure length
277
Chain Sequence
MKIGDISIHYLNGGNTKMDGGAMFGVVPKPLWSKQYNANERNQINLPTHPILIQTAQYNLIIDAGIGNGKLSEKQLRNFGVDEESHIIADLANYNLTPKDIDYVLMTHMHFDHAAGLTDQAGHAIFENAIHVVQQDEWHEFIAPNIRSKSTYWDKNKGDYSNKLILFEKHFEPVPGIKMQHSGGHSFGHTIITIESQGDKAVHMGDIFPTTAHKNPLWVTAYDDYPMQSIREKERMIPYFIQQQYWFLFYHDENYFAVKYSDDGENIDAYILRETLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a probable metal-dependent hydrolase from Staphylococcus aureus. Northeast Structural Genomics target ZR314
rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Hydrolase
molecule keywords Protein similar to metal-dependent hydrolase
total genus 72
structure length 277
sequence length 277
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3eshA01
4D1VA 2NZEA 2FU6A 3PY5A 4ZEJA 5ACUA 4GYUA 2ZWRA 4UBQA 2BG8A 3SFPA 4F6ZA 2YNVB 4AD9A 2P18A 2OHJA 3WXCA 4EYFA 2Q0JA 3AF6A 4P62A 5AXOA 4LE6A 1BC2A 2Q0IA 3H3EA 1WW1A 4DIKA 2CBNA 2BMIA 3T3NA 2H6AA 4Z7RA 3SD9A 3DH8A 4ZO2A 1VGNA 3IEMA 4D02A 5ACTA 2YNWA 1A8TA 4UWPB 1WUPA 4TZ9A 5KIKA 5AHOA 4KEQA 2YCBA 5B1UA 5LLDA 1Y44A 4RBSA 3ZNBA 2YNVA 5ACWA 3FCZA 2M5CA 2P97A 3BV6A 4C1FA 4KEPA 2YNTB 5EWAA 4TZEA 4GYQA 2HB9A 2FK6A 1KO3A 4EYBA 3T9MA 1K07A 3FAIA 4JO0A 2DKFA 4Z5ZA 2BG2A 4TZFA 3RKKA 5HH5A 1DDKA 3JXPA 4D1UA 3RPCA 4RL0A 1DXKA 4XUKA 3VQZA 5KILA 4XWWA 4J5FA 3LVZA 1ZNBA 5DPXA 3IE1A 1XTOA 3L6NA 2WRSA 2BG6A 3KNRA 3SPUA 3TP9A 4AX1B 4C09A 3DHCA 5A0VA 3IELA 5B15A 2QINA 5FQCA 3BK2A 2GFJA 2GFKA 1ZTCA 2QDSA 5B3RA 2NYPA 5EVKA 2BTNA 5ACQA 2FU9A 4U4LA 2AIOA 5HH4A 5K4MA 4EY2A 4EXYA 5LCAA 3KNSA 3X2ZA 5A0TA 2BG8B 4UWOB 2WHGA 1JJTA 4NQ2A 3A4YA 4RL2A 2GCUA 1KO2A 3DHBA 2AZ4A 3P2UA 3IEKA 5FQAA 3I13A 3R2UA 5ACVA 4YSBA 2A7MA 4RAWA 4GCWA 5EVDA 5EH9A 1VMEA 2BR6A 4HL1A 1WRAA 3Q6VA 3X2YA 5K0WA 2Y87A 4BP0A 1P9EA 4TYTA 1YCGA 2E7YA 5FQBA 2WYLA 4Z67A 2P4ZA 4C1GA 1X8GA 1ZKPA 1QH3A 2BIBA 1A7TA 1JJEA 5LM6A 2Y8BA 2QJSA 3ZR9A 3IOGA 3S0ZA 5HISA 5ACPA 5AHRA 2BFKA 3I0VA 3X2XA 4UWRB 2FU8A 1DD6A 4Z60A 5HIOA 3BK1A 4O98A 2P1EA 3I15A 2XF4A 4F6HA 2Q42A 1HLKA 2UYXA 2ZZIA 4RAMA 4AWZA 3IOFA 4PVOA 2FHXA 1E5DA 4B87A 2GKLA 2I7XA 2I7VA 3SBLA 1WUOA 5LS3A 2ZNBA 4NQ4A 5HIQA 3DHAA 4WD6A 2QDTA 3ZWFA 2FHXB 5EHTA 2BC2A 2BGAA 2FU7A 5A5ZA 3BC2A 3I11A 4C1EA 2BFZB 3ESHA 4Z5YA 2WYMC 5LMCA 5LCFA 5EV8A 4H0DA 4HL2A 3IE0A 4ZO3A 2NZFA 2OHIA 5AEBA 1X8IA 2OHHA 5ACSA 3F9OA 1YCHA 4C1HA 1MQOA 2DOOA 2QEDA 3IE2A 4CHLA 4ZNBA 3X30A 5ACRA 2WYMA 1X8HA 5IQKA 4NQ5A 4UWSB 3SRXA 4Z6XA 5K4KA 4YSKA 3T3OA 3SW3A 4PVTA 4XWTA 2BFLA 5EVBA 4RM5A 2XR1A 4J5HA 1YCFA 5HH6A 2FM6A 1L9YA 2M5DA 2YNTA 3G1PA 4D1TA 5AXRA 1JT1A 2BG7A 5K4NA 4HKYA 2VW8A 3AF5A 4TYFA 4V0HA 5ACXA 4EXSA 1XM8A 1KR3A 4C1CA 2ZO4A 1M2XA 3PG4A 5HIPA 5A87A 4EFZA 4BZ3A 5LE1A 3VPEA 3QH8A 2R2DA 3I14A 5LCHA 4AWYB 4UAMA 4FR7A 2YNUA 1BVTA 3MD7A 5AYAA 1SMLA 4FEKA 5EW0A 3IDZA 1BMCA 4C1DA 2GMNA 4FSBA 3KL7A 1QH5A 2Y8AA 3RKJA 4AX0B 3ADRA 4TZBA 2NXAA 4EYLA 4YSLA 2BFZA 4DILA 2YZ3A 5LSCA 3PY6A 3AJ3A 3ZQ4A 4NQ6A 5EV6A 4UA4A 1VJNA 4D1WA 2I7TA 2Q9UA
chains in the Genus database with same CATH superfamily
4D1VA 2NZEA 2FU6A 3PY5A 4ZEJA 5ACUA 4GYUA 2ZWRA 4UBQA 2BG8A 3SFPA 4F6ZA 2YNVB 4AD9A 2P18A 2OHJA 3WXCA 4EYFA 2Q0JA 3AF6A 4P62A 5AXOA 4LE6A 1BC2A 2Q0IA 3H3EA 1WW1A 4DIKA 2CBNA 2BMIA 3T3NA 2H6AA 4Z7RA 3SD9A 3DH8A 4ZO2A 1VGNA 3IEMA 4D02A 5ACTA 2YNWA 1A8TA 4UWPB 1WUPA 4TZ9A 5KIKA 5AHOA 4KEQA 2YCBA 5B1UA 5LLDA 1Y44A 4RBSA 4AV7A 3ZNBA 2YNVA 5ACWA 3FCZA 2M5CA 2P97A 3BV6A 4C1FA 4KEPA 2YNTB 5EWAA 4TZEA 4GYQA 2HB9A 2FK6A 1KO3A 4EYBA 3T9MA 1K07A 3FAIA 4JO0A 2DKFA 4Z5ZA 2BG2A 2CG3A 4TZFA 3RKKA 5HH5A 1DDKA 3JXPA 4D1UA 3RPCA 4RL0A 1DXKA 4XUKA 2YHEA 3VQZA 5KILA 4XWWA 4J5FA 3LVZA 1ZNBA 5DPXA 3IE1A 1XTOA 3L6NA 2WRSA 2BG6A 3KNRA 3SPUA 3TP9A 4AX1B 4C09A 3DHCA 5A0VA 3IELA 5B15A 2QINA 5FQCA 3BK2A 2GFJA 2GFKA 1ZTCA 2QDSA 5B3RA 2NYPA 5EVKA 4PDXA 2BTNA 5ACQA 2FU9A 4U4LA 2AIOA 5HH4A 5K4MA 4EY2A 4EXYA 5LCAA 3KNSA 3X2ZA 5A0TA 2BG8B 4UWOB 2WHGA 1JJTA 4NQ2A 3A4YA 4RL2A 2GCUA 1KO2A 3DHBA 2AZ4A 3P2UA 3IEKA 5FQAA 3I13A 3R2UA 5ACVA 4YSBA 2A7MA 4RAWA 4GCWA 5EVDA 5AJLA 5EH9A 1VMEA 4AXHA 2BR6A 4HL1A 1WRAA 3Q6VA 3X2YA 5K0WA 2Y87A 4BP0A 1P9EA 4TYTA 1YCGA 2E7YA 5FQBA 2CFUA 2WYLA 4Z67A 2P4ZA 4C1GA 1X8GA 1ZKPA 1QH3A 2BIBA 1A7TA 1JJEA 5LM6A 2Y8BA 2QJSA 3ZR9A 3IOGA 3S0ZA 5HISA 5ACPA 5AHRA 2BFKA 3I0VA 3X2XA 4UWRB 2FU8A 1DD6A 4Z60A 5HIOA 3BK1A 4O98A 2P1EA 3I15A 2XF4A 4F6HA 2Q42A 1HLKA 2UYXA 2ZZIA 4RAMA 4AWZA 5A23A 3IOFA 4PVOA 2FHXA 1E5DA 4B87A 2GKLA 2I7XA 2I7VA 3SBLA 1WUOA 5LS3A 2ZNBA 4NQ4A 5AIJA 5HIQA 3DHAA 4WD6A 2QDTA 3ZWFA 2FHXB 5EHTA 2BC2A 2BGAA 2FU7A 5A5ZA 3BC2A 3I11A 4C1EA 2BFZB 3ESHA 4Z5YA 2WYMC 5LMCA 5LCFA 5EV8A 4H0DA 4HL2A 3IE0A 4ZO3A 2NZFA 2OHIA 5AEBA 1X8IA 2OHHA 5ACSA 3F9OA 1YCHA 4C1HA 1MQOA 2DOOA 2QEDA 3IE2A 4CHLA 4ZNBA 3X30A 5ACRA 2WYMA 1X8HA 5IQKA 4NQ5A 4UWSB 3SRXA 4Z6XA 5K4KA 4YSKA 3T3OA 4NURA 3SW3A 4PVTA 4XWTA 2BFLA 5EVBA 4RM5A 2XR1A 2CFZA 4J5HA 1YCFA 5HH6A 2FM6A 1L9YA 2M5DA 2YNTA 3G1PA 4D1TA 5AXRA 1JT1A 2BG7A 5K4NA 4HKYA 2VW8A 3AF5A 4TYFA 4V0HA 5ACXA 4EXSA 1XM8A 1KR3A 4C1CA 2ZO4A 1M2XA 3PG4A 5HIPA 5A87A 4EFZA 4BZ3A 5LE1A 3VPEA 3QH8A 2R2DA 3I14A 5LCHA 4AWYB 4UAMA 4FR7A 2YNUA 2CG2A 1BVTA 3MD7A 5AYAA 1SMLA 4FEKA 5EW0A 3IDZA 1BMCA 4C1DA 2GMNA 4FSBA 3KL7A 1QH5A 2Y8AA 3RKJA 4AX0B 3ADRA 4TZBA 2NXAA 4EYLA 4YSLA 2BFZA 4DILA 2YZ3A 5LSCA 3PY6A 3AJ3A 3ZQ4A 4NQ6A 5EV6A 4UA4A 1VJNA 4D1WA 2I7TA 2Q9UA
chains in the Genus database with same CATH topology
4D1VA 2NZEA 2FU6A 3PY5A 4ZEJA 5ACUA 4GYUA 2ZWRA 4UBQA 2BG8A 3SFPA 4F6ZA 2YNVB 4AD9A 2P18A 2OHJA 3WXCA 4EYFA 2Q0JA 3AF6A 4P62A 5AXOA 4LE6A 1BC2A 2Q0IA 3H3EA 1WW1A 4DIKA 2CBNA 2BMIA 3T3NA 2H6AA 4Z7RA 3SD9A 3DH8A 4ZO2A 1VGNA 3IEMA 4D02A 5ACTA 2YNWA 1A8TA 4UWPB 1WUPA 4TZ9A 5KIKA 5AHOA 4KEQA 2YCBA 5B1UA 5LLDA 1Y44A 4RBSA 3ZNBA 2YNVA 5ACWA 3FCZA 2M5CA 2P97A 3BV6A 4C1FA 4KEPA 2YNTB 5EWAA 4TZEA 4GYQA 2HB9A 2FK6A 1KO3A 4EYBA 3T9MA 1K07A 3FAIA 4JO0A 2DKFA 4Z5ZA 2BG2A 4TZFA 3RKKA 5HH5A 1DDKA 3JXPA 4D1UA 3RPCA 4RL0A 1DXKA 4XUKA 3VQZA 5KILA 4XWWA 4J5FA 3LVZA 1ZNBA 5DPXA 3IE1A 1XTOA 3L6NA 2WRSA 2BG6A 3KNRA 3SPUA 3TP9A 4AX1B 4C09A 3DHCA 5A0VA 3IELA 5B15A 2QINA 5FQCA 3BK2A 2GFJA 2GFKA 1ZTCA 2QDSA 5B3RA 2NYPA 5EVKA 2BTNA 5ACQA 2FU9A 4U4LA 2AIOA 5HH4A 5K4MA 4EY2A 4EXYA 5LCAA 3KNSA 3X2ZA 5A0TA 2BG8B 4UWOB 2WHGA 1JJTA 4NQ2A 3A4YA 4RL2A 2GCUA 1KO2A 3DHBA 2AZ4A 3P2UA 3IEKA 5FQAA 3I13A 3R2UA 5ACVA 4YSBA 2A7MA 4RAWA 4GCWA 5EVDA 5EH9A 1VMEA 2BR6A 4HL1A 1WRAA 3Q6VA 3X2YA 5K0WA 2Y87A 4BP0A 1P9EA 4TYTA 1YCGA 2E7YA 5FQBA 2WYLA 4Z67A 2P4ZA 4C1GA 1X8GA 1ZKPA 1QH3A 2BIBA 1A7TA 1JJEA 5LM6A 2Y8BA 2QJSA 3ZR9A 3IOGA 3S0ZA 5HISA 5ACPA 5AHRA 2BFKA 3I0VA 3X2XA 4UWRB 2FU8A 1DD6A 4Z60A 5HIOA 3BK1A 4O98A 2P1EA 3I15A 2XF4A 4F6HA 2Q42A 1HLKA 2UYXA 2ZZIA 4RAMA 4AWZA 3IOFA 4PVOA 2FHXA 1E5DA 4B87A 2GKLA 2I7XA 2I7VA 3SBLA 1WUOA 5LS3A 2ZNBA 4NQ4A 5HIQA 3DHAA 4WD6A 2QDTA 3ZWFA 2FHXB 5EHTA 2BC2A 2BGAA 2FU7A 5A5ZA 3BC2A 3I11A 4C1EA 2BFZB 3ESHA 4Z5YA 2WYMC 5LMCA 5LCFA 5EV8A 4H0DA 4HL2A 3IE0A 4ZO3A 2NZFA 2OHIA 5AEBA 1X8IA 2OHHA 5ACSA 3F9OA 1YCHA 4C1HA 1MQOA 2DOOA 2QEDA 3IE2A 4CHLA 4ZNBA 3X30A 5ACRA 2WYMA 1X8HA 5IQKA 4NQ5A 4UWSB 3SRXA 4Z6XA 5K4KA 4YSKA 3T3OA 3SW3A 4PVTA 4XWTA 2BFLA 5EVBA 4RM5A 2XR1A 4J5HA 1YCFA 5HH6A 2FM6A 1L9YA 2M5DA 2YNTA 3G1PA 4D1TA 5AXRA 1JT1A 2BG7A 5K4NA 4HKYA 2VW8A 3AF5A 4TYFA 4V0HA 5ACXA 4EXSA 1XM8A 1KR3A 4C1CA 2ZO4A 1M2XA 3PG4A 5HIPA 5A87A 4EFZA 4BZ3A 5LE1A 3VPEA 3QH8A 2R2DA 3I14A 5LCHA 4AWYB 4UAMA 4FR7A 2YNUA 1BVTA 3MD7A 5AYAA 1SMLA 4FEKA 5EW0A 3IDZA 1BMCA 4C1DA 2GMNA 4FSBA 3KL7A 1QH5A 2Y8AA 3RKJA 4AX0B 3ADRA 4TZBA 2NXAA 4EYLA 4YSLA 2BFZA 4DILA 2YZ3A 5LSCA 3PY6A 3AJ3A 3ZQ4A 4NQ6A 5EV6A 4UA4A 1VJNA 4D1WA 2I7TA 2Q9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D1V A;  2NZE A;  2FU6 A;  3PY5 A;  4ZEJ A;  5ACU A;  4GYU A;  2ZWR A;  4UBQ A;  2BG8 A;  3SFP A;  4F6Z A;  2YNV B;  4AD9 A;  2P18 A;  2OHJ A;  3WXC A;  4EYF A;  2Q0J A;  3AF6 A;  4P62 A;  5AXO A;  4LE6 A;  1BC2 A;  2Q0I A;  3H3E A;  1WW1 A;  4DIK A;  2CBN A;  2BMI A;  3T3N A;  2H6A A;  4Z7R A;  3SD9 A;  3DH8 A;  4ZO2 A;  1VGN A;  3IEM A;  4D02 A;  5ACT A;  2YNW A;  1A8T A;  4UWP B;  1WUP A;  4TZ9 A;  5KIK A;  5AHO A;  4KEQ A;  2YCB A;  5B1U A;  5LLD A;  1Y44 A;  4RBS A;  3ZNB A;  2YNV A;  5ACW A;  3FCZ A;  2M5C A;  2P97 A;  3BV6 A;  4C1F A;  4KEP A;  2YNT B;  5EWA A;  4TZE A;  4GYQ A;  2HB9 A;  2FK6 A;  1KO3 A;  4EYB A;  3T9M A;  1K07 A;  3FAI A;  4JO0 A;  2DKF A;  4Z5Z A;  2BG2 A;  4TZF A;  3RKK A;  5HH5 A;  1DDK A;  3JXP A;  4D1U A;  3RPC A;  4RL0 A;  1DXK A;  4XUK A;  3VQZ A;  5KIL A;  4XWW A;  4J5F A;  3LVZ A;  1ZNB A;  5DPX A;  3IE1 A;  1XTO A;  3L6N A;  2WRS A;  2BG6 A;  3KNR A;  3SPU A;  3TP9 A;  4AX1 B;  4C09 A;  3DHC A;  5A0V A;  3IEL A;  5B15 A;  2QIN A;  5FQC A;  3BK2 A;  2GFJ A;  2GFK A;  1ZTC A;  2QDS A;  5B3R A;  2NYP A;  5EVK A;  2BTN A;  5ACQ A;  2FU9 A;  4U4L A;  2AIO A;  5HH4 A;  5K4M A;  4EY2 A;  4EXY A;  5LCA A;  3KNS A;  3X2Z A;  5A0T A;  2BG8 B;  4UWO B;  2WHG A;  1JJT A;  4NQ2 A;  3A4Y A;  4RL2 A;  2GCU A;  1KO2 A;  3DHB A;  2AZ4 A;  3P2U A;  3IEK A;  5FQA A;  3I13 A;  3R2U A;  5ACV A;  4YSB A;  2A7M A;  4RAW A;  4GCW A;  5EVD A;  5EH9 A;  1VME A;  2BR6 A;  4HL1 A;  1WRA A;  3Q6V A;  3X2Y A;  5K0W A;  2Y87 A;  4BP0 A;  1P9E A;  4TYT A;  1YCG A;  2E7Y A;  5FQB A;  2WYL A;  4Z67 A;  2P4Z A;  4C1G A;  1X8G A;  1ZKP A;  1QH3 A;  2BIB A;  1A7T A;  1JJE A;  5LM6 A;  2Y8B A;  2QJS A;  3ZR9 A;  3IOG A;  3S0Z A;  5HIS A;  5ACP A;  5AHR A;  2BFK A;  3I0V A;  3X2X A;  4UWR B;  2FU8 A;  1DD6 A;  4Z60 A;  5HIO A;  3BK1 A;  4O98 A;  2P1E A;  3I15 A;  2XF4 A;  4F6H A;  2Q42 A;  1HLK A;  2UYX A;  2ZZI A;  4RAM A;  4AWZ A;  3IOF A;  4PVO A;  2FHX A;  1E5D A;  4B87 A;  2GKL A;  2I7X A;  2I7V A;  3SBL A;  1WUO A;  5LS3 A;  2ZNB A;  4NQ4 A;  5HIQ A;  3DHA A;  4WD6 A;  2QDT A;  3ZWF A;  2FHX B;  5EHT A;  2BC2 A;  2BGA A;  2FU7 A;  5A5Z A;  3BC2 A;  3I11 A;  4C1E A;  2BFZ B;  3ESH A;  4Z5Y A;  2WYM C;  5LMC A;  5LCF A;  5EV8 A;  4H0D A;  4HL2 A;  3IE0 A;  4ZO3 A;  2NZF A;  2OHI A;  5AEB A;  1X8I A;  2OHH A;  5ACS A;  3F9O A;  1YCH A;  4C1H A;  1MQO A;  2DOO A;  2QED A;  3IE2 A;  4CHL A;  4ZNB A;  3X30 A;  5ACR A;  2WYM A;  1X8H A;  5IQK A;  4NQ5 A;  4UWS B;  3SRX A;  4Z6X A;  5K4K A;  4YSK A;  3T3O A;  3SW3 A;  4PVT A;  4XWT A;  2BFL A;  5EVB A;  4RM5 A;  2XR1 A;  4J5H A;  1YCF A;  5HH6 A;  2FM6 A;  1L9Y A;  2M5D A;  2YNT A;  3G1P A;  4D1T A;  5AXR A;  1JT1 A;  2BG7 A;  5K4N A;  4HKY A;  2VW8 A;  3AF5 A;  4TYF A;  4V0H A;  5ACX A;  4EXS A;  1XM8 A;  1KR3 A;  4C1C A;  2ZO4 A;  1M2X A;  3PG4 A;  5HIP A;  5A87 A;  4EFZ A;  4BZ3 A;  5LE1 A;  3VPE A;  3QH8 A;  2R2D A;  3I14 A;  5LCH A;  4AWY B;  4UAM A;  4FR7 A;  2YNU A;  1BVT A;  3MD7 A;  5AYA A;  1SML A;  4FEK A;  5EW0 A;  3IDZ A;  1BMC A;  4C1D A;  2GMN A;  4FSB A;  3KL7 A;  1QH5 A;  2Y8A A;  3RKJ A;  4AX0 B;  3ADR A;  4TZB A;  2NXA A;  4EYL A;  4YSL A;  2BFZ A;  4DIL A;  2YZ3 A;  5LSC A;  3PY6 A;  3AJ3 A;  3ZQ4 A;  4NQ6 A;  5EV6 A;  4UA4 A;  1VJN A;  4D1W A;  2I7T A;  2Q9U A; 
#chains in the Genus database with same CATH topology
 4D1V A;  2NZE A;  2FU6 A;  3PY5 A;  4ZEJ A;  5ACU A;  4GYU A;  2ZWR A;  4UBQ A;  2BG8 A;  3SFP A;  4F6Z A;  2YNV B;  4AD9 A;  2P18 A;  2OHJ A;  3WXC A;  4EYF A;  2Q0J A;  3AF6 A;  4P62 A;  5AXO A;  4LE6 A;  1BC2 A;  2Q0I A;  3H3E A;  1WW1 A;  4DIK A;  2CBN A;  2BMI A;  3T3N A;  2H6A A;  4Z7R A;  3SD9 A;  3DH8 A;  4ZO2 A;  1VGN A;  3IEM A;  4D02 A;  5ACT A;  2YNW A;  1A8T A;  4UWP B;  1WUP A;  4TZ9 A;  5KIK A;  5AHO A;  4KEQ A;  2YCB A;  5B1U A;  5LLD A;  1Y44 A;  4RBS A;  4AV7 A;  3ZNB A;  2YNV A;  5ACW A;  3FCZ A;  2M5C A;  2P97 A;  3BV6 A;  4C1F A;  4KEP A;  2YNT B;  5EWA A;  4TZE A;  4GYQ A;  2HB9 A;  2FK6 A;  1KO3 A;  4EYB A;  3T9M A;  1K07 A;  3FAI A;  4JO0 A;  2DKF A;  4Z5Z A;  2BG2 A;  2CG3 A;  4TZF A;  3RKK A;  5HH5 A;  1DDK A;  3JXP A;  4D1U A;  3RPC A;  4RL0 A;  1DXK A;  4XUK A;  2YHE A;  3VQZ A;  5KIL A;  4XWW A;  4J5F A;  3LVZ A;  1ZNB A;  5DPX A;  3IE1 A;  1XTO A;  3L6N A;  2WRS A;  2BG6 A;  3KNR A;  3SPU A;  3TP9 A;  4AX1 B;  4C09 A;  3DHC A;  5A0V A;  3IEL A;  5B15 A;  2QIN A;  5FQC A;  3BK2 A;  2GFJ A;  2GFK A;  1ZTC A;  2QDS A;  5B3R A;  2NYP A;  5EVK A;  4PDX A;  2BTN A;  5ACQ A;  2FU9 A;  4U4L A;  2AIO A;  5HH4 A;  5K4M A;  4EY2 A;  4EXY A;  5LCA A;  3KNS A;  3X2Z A;  5A0T A;  2BG8 B;  4UWO B;  2WHG A;  1JJT A;  4NQ2 A;  3A4Y A;  4RL2 A;  2GCU A;  1KO2 A;  3DHB A;  2AZ4 A;  3P2U A;  3IEK A;  5FQA A;  3I13 A;  3R2U A;  5ACV A;  4YSB A;  2A7M A;  4RAW A;  4GCW A;  5EVD A;  5AJL A;  5EH9 A;  1VME A;  4AXH A;  2BR6 A;  4HL1 A;  1WRA A;  3Q6V A;  3X2Y A;  5K0W A;  2Y87 A;  4BP0 A;  1P9E A;  4TYT A;  1YCG A;  2E7Y A;  5FQB A;  2CFU A;  2WYL A;  4Z67 A;  2P4Z A;  4C1G A;  1X8G A;  1ZKP A;  1QH3 A;  2BIB A;  1A7T A;  1JJE A;  5LM6 A;  2Y8B A;  2QJS A;  3ZR9 A;  3IOG A;  3S0Z A;  5HIS A;  5ACP A;  5AHR A;  2BFK A;  3I0V A;  3X2X A;  4UWR B;  2FU8 A;  1DD6 A;  4Z60 A;  5HIO A;  3BK1 A;  4O98 A;  2P1E A;  3I15 A;  2XF4 A;  4F6H A;  2Q42 A;  1HLK A;  2UYX A;  2ZZI A;  4RAM A;  4AWZ A;  5A23 A;  3IOF A;  4PVO A;  2FHX A;  1E5D A;  4B87 A;  2GKL A;  2I7X A;  2I7V A;  3SBL A;  1WUO A;  5LS3 A;  2ZNB A;  4NQ4 A;  5AIJ A;  5HIQ A;  3DHA A;  4WD6 A;  2QDT A;  3ZWF A;  2FHX B;  5EHT A;  2BC2 A;  2BGA A;  2FU7 A;  5A5Z A;  3BC2 A;  3I11 A;  4C1E A;  2BFZ B;  3ESH A;  4Z5Y A;  2WYM C;  5LMC A;  5LCF A;  5EV8 A;  4H0D A;  4HL2 A;  3IE0 A;  4ZO3 A;  2NZF A;  2OHI A;  5AEB A;  1X8I A;  2OHH A;  5ACS A;  3F9O A;  1YCH A;  4C1H A;  1MQO A;  2DOO A;  2QED A;  3IE2 A;  4CHL A;  4ZNB A;  3X30 A;  5ACR A;  2WYM A;  1X8H A;  5IQK A;  4NQ5 A;  4UWS B;  3SRX A;  4Z6X A;  5K4K A;  4YSK A;  3T3O A;  4NUR A;  3SW3 A;  4PVT A;  4XWT A;  2BFL A;  5EVB A;  4RM5 A;  2XR1 A;  2CFZ A;  4J5H A;  1YCF A;  5HH6 A;  2FM6 A;  1L9Y A;  2M5D A;  2YNT A;  3G1P A;  4D1T A;  5AXR A;  1JT1 A;  2BG7 A;  5K4N A;  4HKY A;  2VW8 A;  3AF5 A;  4TYF A;  4V0H A;  5ACX A;  4EXS A;  1XM8 A;  1KR3 A;  4C1C A;  2ZO4 A;  1M2X A;  3PG4 A;  5HIP A;  5A87 A;  4EFZ A;  4BZ3 A;  5LE1 A;  3VPE A;  3QH8 A;  2R2D A;  3I14 A;  5LCH A;  4AWY B;  4UAM A;  4FR7 A;  2YNU A;  2CG2 A;  1BVT A;  3MD7 A;  5AYA A;  1SML A;  4FEK A;  5EW0 A;  3IDZ A;  1BMC A;  4C1D A;  2GMN A;  4FSB A;  3KL7 A;  1QH5 A;  2Y8A A;  3RKJ A;  4AX0 B;  3ADR A;  4TZB A;  2NXA A;  4EYL A;  4YSL A;  2BFZ A;  4DIL A;  2YZ3 A;  5LSC A;  3PY6 A;  3AJ3 A;  3ZQ4 A;  4NQ6 A;  5EV6 A;  4UA4 A;  1VJN A;  4D1W A;  2I7T A;  2Q9U A; 
#chains in the Genus database with same CATH homology
 4D1V A;  2NZE A;  2FU6 A;  3PY5 A;  4ZEJ A;  5ACU A;  4GYU A;  2ZWR A;  4UBQ A;  2BG8 A;  3SFP A;  4F6Z A;  2YNV B;  4AD9 A;  2P18 A;  2OHJ A;  3WXC A;  4EYF A;  2Q0J A;  3AF6 A;  4P62 A;  5AXO A;  4LE6 A;  1BC2 A;  2Q0I A;  3H3E A;  1WW1 A;  4DIK A;  2CBN A;  2BMI A;  3T3N A;  2H6A A;  4Z7R A;  3SD9 A;  3DH8 A;  4ZO2 A;  1VGN A;  3IEM A;  4D02 A;  5ACT A;  2YNW A;  1A8T A;  4UWP B;  1WUP A;  4TZ9 A;  5KIK A;  5AHO A;  4KEQ A;  2YCB A;  5B1U A;  5LLD A;  1Y44 A;  4RBS A;  3ZNB A;  2YNV A;  5ACW A;  3FCZ A;  2M5C A;  2P97 A;  3BV6 A;  4C1F A;  4KEP A;  2YNT B;  5EWA A;  4TZE A;  4GYQ A;  2HB9 A;  2FK6 A;  1KO3 A;  4EYB A;  3T9M A;  1K07 A;  3FAI A;  4JO0 A;  2DKF A;  4Z5Z A;  2BG2 A;  4TZF A;  3RKK A;  5HH5 A;  1DDK A;  3JXP A;  4D1U A;  3RPC A;  4RL0 A;  1DXK A;  4XUK A;  3VQZ A;  5KIL A;  4XWW A;  4J5F A;  3LVZ A;  1ZNB A;  5DPX A;  3IE1 A;  1XTO A;  3L6N A;  2WRS A;  2BG6 A;  3KNR A;  3SPU A;  3TP9 A;  4AX1 B;  4C09 A;  3DHC A;  5A0V A;  3IEL A;  5B15 A;  2QIN A;  5FQC A;  3BK2 A;  2GFJ A;  2GFK A;  1ZTC A;  2QDS A;  5B3R A;  2NYP A;  5EVK A;  2BTN A;  5ACQ A;  2FU9 A;  4U4L A;  2AIO A;  5HH4 A;  5K4M A;  4EY2 A;  4EXY A;  5LCA A;  3KNS A;  3X2Z A;  5A0T A;  2BG8 B;  4UWO B;  2WHG A;  1JJT A;  4NQ2 A;  3A4Y A;  4RL2 A;  2GCU A;  1KO2 A;  3DHB A;  2AZ4 A;  3P2U A;  3IEK A;  5FQA A;  3I13 A;  3R2U A;  5ACV A;  4YSB A;  2A7M A;  4RAW A;  4GCW A;  5EVD A;  5EH9 A;  1VME A;  2BR6 A;  4HL1 A;  1WRA A;  3Q6V A;  3X2Y A;  5K0W A;  2Y87 A;  4BP0 A;  1P9E A;  4TYT A;  1YCG A;  2E7Y A;  5FQB A;  2WYL A;  4Z67 A;  2P4Z A;  4C1G A;  1X8G A;  1ZKP A;  1QH3 A;  2BIB A;  1A7T A;  1JJE A;  5LM6 A;  2Y8B A;  2QJS A;  3ZR9 A;  3IOG A;  3S0Z A;  5HIS A;  5ACP A;  5AHR A;  2BFK A;  3I0V A;  3X2X A;  4UWR B;  2FU8 A;  1DD6 A;  4Z60 A;  5HIO A;  3BK1 A;  4O98 A;  2P1E A;  3I15 A;  2XF4 A;  4F6H A;  2Q42 A;  1HLK A;  2UYX A;  2ZZI A;  4RAM A;  4AWZ A;  3IOF A;  4PVO A;  2FHX A;  1E5D A;  4B87 A;  2GKL A;  2I7X A;  2I7V A;  3SBL A;  1WUO A;  5LS3 A;  2ZNB A;  4NQ4 A;  5HIQ A;  3DHA A;  4WD6 A;  2QDT A;  3ZWF A;  2FHX B;  5EHT A;  2BC2 A;  2BGA A;  2FU7 A;  5A5Z A;  3BC2 A;  3I11 A;  4C1E A;  2BFZ B;  3ESH A;  4Z5Y A;  2WYM C;  5LMC A;  5LCF A;  5EV8 A;  4H0D A;  4HL2 A;  3IE0 A;  4ZO3 A;  2NZF A;  2OHI A;  5AEB A;  1X8I A;  2OHH A;  5ACS A;  3F9O A;  1YCH A;  4C1H A;  1MQO A;  2DOO A;  2QED A;  3IE2 A;  4CHL A;  4ZNB A;  3X30 A;  5ACR A;  2WYM A;  1X8H A;  5IQK A;  4NQ5 A;  4UWS B;  3SRX A;  4Z6X A;  5K4K A;  4YSK A;  3T3O A;  3SW3 A;  4PVT A;  4XWT A;  2BFL A;  5EVB A;  4RM5 A;  2XR1 A;  4J5H A;  1YCF A;  5HH6 A;  2FM6 A;  1L9Y A;  2M5D A;  2YNT A;  3G1P A;  4D1T A;  5AXR A;  1JT1 A;  2BG7 A;  5K4N A;  4HKY A;  2VW8 A;  3AF5 A;  4TYF A;  4V0H A;  5ACX A;  4EXS A;  1XM8 A;  1KR3 A;  4C1C A;  2ZO4 A;  1M2X A;  3PG4 A;  5HIP A;  5A87 A;  4EFZ A;  4BZ3 A;  5LE1 A;  3VPE A;  3QH8 A;  2R2D A;  3I14 A;  5LCH A;  4AWY B;  4UAM A;  4FR7 A;  2YNU A;  1BVT A;  3MD7 A;  5AYA A;  1SML A;  4FEK A;  5EW0 A;  3IDZ A;  1BMC A;  4C1D A;  2GMN A;  4FSB A;  3KL7 A;  1QH5 A;  2Y8A A;  3RKJ A;  4AX0 B;  3ADR A;  4TZB A;  2NXA A;  4EYL A;  4YSL A;  2BFZ A;  4DIL A;  2YZ3 A;  5LSC A;  3PY6 A;  3AJ3 A;  3ZQ4 A;  4NQ6 A;  5EV6 A;  4UA4 A;  1VJN A;  4D1W A;  2I7T A;  2Q9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...