3ESHA

Crystal structure of a probable metal-dependent hydrolase from staphylococcus aureus. northeast structural genomics target zr314
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
277
structure length
277
Chain Sequence
MKIGDISIHYLNGGNTKMDGGAMFGVVPKPLWSKQYNANERNQINLPTHPILIQTAQYNLIIDAGIGNGKLSEKQLRNFGVDEESHIIADLANYNLTPKDIDYVLMTHMHFDHAAGLTDQAGHAIFENAIHVVQQDEWHEFIAPNIRSKSTYWDKNKGDYSNKLILFEKHFEPVPGIKMQHSGGHSFGHTIITIESQGDKAVHMGDIFPTTAHKNPLWVTAYDDYPMQSIREKERMIPYFIQQQYWFLFYHDENYFAVKYSDDGENIDAYILRETLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Protein similar to metal-dependent hydrolase
publication title Crystal structure of a probable metal-dependent hydrolase from Staphylococcus aureus. Northeast Structural Genomics target ZR314
rcsb
source organism Staphylococcus aureus subsp. aureus mu50
total genus 72
structure length 277
sequence length 277
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3eshA01
3IELA 5A0VA 2FM6A 2A7MA 2BFZB 4EFZA 5ACPA 1BC2A 4LE6A 2I7TA 1ZTCA 4TZBA 4EYBA 5EV8A 4CHLA 4Z60A 2Y8BA 2ZZIA 3ADRA 1QH3A 2BG8B 4RL0A 1XM8A 1X8HA 4AX0B 5K4MA 2BC2A 3SPUA 4AWYB 3PG4A 3ESHA 4XUKA 2FU8A 5AHRA 2ZWRA 2BMIA 3IOFA 5HIOA 3ZR9A 3RKKA 4J5FA 4PVOA 3DHBA 3F9OA 5AHOA 2P97A 2GKLA 4WD6A 4TZ9A 3RKJA 4UBQA 2OHJA 1E5DA 2E7YA 2BTNA 5LE1A 4P62A 2BG6A 2FU9A 2BR6A 2Q0IA 2P1EA 4FEKA 3KL7A 3I15A 5EWAA 3BK1A 4TZFA 3PY6A 3X2YA 4GYUA 5EVBA 5AXOA 3VQZA 1KR3A 3I13A 4BP0A 2VW8A 5ACWA 2CBNA 3KNRA 2BIBA 2GFJA 5B15A 4TZEA 2YNTA 5HH5A 3X2XA 2FHXB 1P9EA 3SD9A 5KIKA 5FQAA 4EXSA 5EVDA 4EYLA 4Z5ZA 3I14A 4RL2A 4XWWA 5ACUA 2AZ4A 2BFZA 2YNVA 2WYLA 4EYFA 1L9YA 2XR1A 5LLDA 1BVTA 2WHGA 3A4YA 3SBLA 1X8IA 1JJEA 1KO2A 4D02A 3DHAA 4TYFA 2WYMC 4KEQA 4NQ2A 5ACRA 3VPEA 2Q9UA 5A5ZA 5IQKA 5LM6A 5HISA 2Y87A 3BK2A 1VGNA 5HIQA 2BG8A 4J5HA 5LS3A 3X30A 2BGAA 1YCFA 2OHIA 3H3EA 4UWRB 5AXRA 4NQ5A 3QH8A 4HL1A 5ACVA 5A0TA 4AX1B 5KILA 4U4LA 4UAMA 4YSKA 5DPXA 2NYPA 4C1FA 2P18A 2NZEA 5K4NA 3BV6A 1JT1A 1ZKPA 1VMEA 4D1WA 3FCZA 3IDZA 2YZ3A 3LVZA 3JXPA 3WXCA 4V0HA 4F6HA 3ZWFA 2QDTA 4H0DA 2GCUA 5K0WA 1XTOA 2XF4A 1WW1A 4D1VA 3SRXA 1WRAA 2WYMA 3G1PA 2I7VA 1JJTA 5EH9A 2YNUA 3AJ3A 4Z5YA 2FHXA 1VJNA 1DD6A 4RAMA 2DKFA 4UWPB 5HH6A 4NQ4A 3SW3A 3T9MA 5ACSA 4Z7RA 5LCFA 3IE2A 5LSCA 5LCAA 2QEDA 3IEMA 3R2UA 1BMCA 5AEBA 2GMNA 3TP9A 5ACTA 2ZNBA 4O98A 2YNWA 4RBSA 1QH5A 5EVKA 4AD9A 4Z6XA 2BFLA 2Y8AA 3BC2A 4JO0A 4ZNBA 4ZO3A 2ZO4A 4C09A 1YCHA 1A7TA 1Y44A 2GFKA 3IE1A 4C1CA 4F6ZA 2YNVB 3I11A 4GCWA 4DIKA 2R2DA 4ZEJA 3ZNBA 5K4KA 5EV6A 4KEPA 1X8GA 4TYTA 5ACQA 2HB9A 4XWTA 1KO3A 1DDKA 3AF5A 1HLKA 3PY5A 3AF6A 4UWOB 2H6AA 4C1GA 1WUOA 5FQBA 4DILA 3ZQ4A 5LMCA 1K07A 1MQOA 2QINA 2WRSA 2FU6A 2M5DA 3SFPA 5AYAA 3S0ZA 2FK6A 2QJSA 1ZNBA 3RPCA 1YCGA 4UA4A 2BG7A 2OHHA 4FR7A 2AIOA 3L6NA 3Q6VA 4B87A 4AWZA 4D1UA 3T3OA 1M2XA 4Z67A 2Q42A 4FSBA 3KNSA 1A8TA 2NZFA 3DHCA 3DH8A 4UWSB 2DOOA 3IE0A 4YSLA 4C1EA 3MD7A 4C1DA 2YCBA 5EW0A 5A87A 4HL2A 1DXKA 4EXYA 3T3NA 5HIPA 5B3RA 2P4ZA 2BFKA 2BG2A 3X2ZA 3IEKA 4ZO2A 2Q0JA 2NXAA 5ACXA 5B1UA 5HH4A 2UYXA 4RM5A 4BZ3A 5FQCA 4GYQA 3IOGA 1SMLA 3FAIA 4PVTA 4C1HA 4NQ6A 4EY2A 3P2UA 2YNTB 4YSBA 2M5CA 3I0VA 2QDSA 4D1TA 4HKYA 5LCHA 2FU7A 2I7XA 1WUPA 5EHTA 4RAWA
chains in the Genus database with same CATH superfamily
3IELA 5A0VA 2FM6A 2A7MA 2BFZB 4EFZA 5ACPA 1BC2A 4LE6A 2I7TA 1ZTCA 4TZBA 4EYBA 5EV8A 4CHLA 4Z60A 2Y8BA 2ZZIA 3ADRA 1QH3A 2BG8B 4RL0A 1XM8A 1X8HA 4AX0B 5K4MA 2BC2A 3SPUA 4AWYB 3PG4A 3ESHA 4XUKA 2FU8A 5AHRA 2ZWRA 2BMIA 3IOFA 5HIOA 3ZR9A 3RKKA 4J5FA 4PVOA 3DHBA 2YHEA 3F9OA 5AHOA 2P97A 2GKLA 4WD6A 4TZ9A 3RKJA 4UBQA 2OHJA 1E5DA 2E7YA 2BTNA 5LE1A 4P62A 2BG6A 2FU9A 2BR6A 2Q0IA 2P1EA 4FEKA 3KL7A 3I15A 5EWAA 3BK1A 4TZFA 3PY6A 3X2YA 4GYUA 5EVBA 5AXOA 3VQZA 1KR3A 3I13A 4BP0A 2VW8A 5ACWA 2CBNA 3KNRA 2BIBA 2GFJA 5B15A 4TZEA 2YNTA 2CG3A 5HH5A 3X2XA 2FHXB 1P9EA 3SD9A 5KIKA 5FQAA 4EXSA 5EVDA 4EYLA 4Z5ZA 3I14A 4RL2A 4XWWA 5ACUA 2AZ4A 4PDXA 2BFZA 2YNVA 2WYLA 2CFZA 4EYFA 1L9YA 2XR1A 5LLDA 1BVTA 2WHGA 3A4YA 3SBLA 1X8IA 1JJEA 1KO2A 5AJLA 4D02A 3DHAA 4TYFA 2WYMC 4KEQA 4NQ2A 5ACRA 3VPEA 2Q9UA 5A5ZA 5IQKA 5LM6A 5HISA 2Y87A 3BK2A 1VGNA 5HIQA 2BG8A 4J5HA 5LS3A 3X30A 2BGAA 1YCFA 2OHIA 3H3EA 4UWRB 5AXRA 4NQ5A 3QH8A 4HL1A 5ACVA 5A0TA 4AX1B 5KILA 4U4LA 4UAMA 4YSKA 5DPXA 2NYPA 4C1FA 2P18A 2NZEA 5K4NA 3BV6A 1JT1A 1ZKPA 1VMEA 4D1WA 3FCZA 3IDZA 2YZ3A 3LVZA 3JXPA 3WXCA 4V0HA 4F6HA 3ZWFA 2QDTA 4H0DA 2GCUA 5K0WA 1XTOA 2XF4A 1WW1A 4D1VA 3SRXA 5AIJA 1WRAA 2WYMA 3G1PA 2I7VA 1JJTA 5EH9A 2YNUA 3AJ3A 4Z5YA 2FHXA 1VJNA 1DD6A 4RAMA 2DKFA 4UWPB 5HH6A 4NQ4A 3SW3A 3T9MA 5ACSA 4Z7RA 5LCFA 3IE2A 5LSCA 5LCAA 2QEDA 3IEMA 3R2UA 1BMCA 5AEBA 2GMNA 3TP9A 5ACTA 2ZNBA 4O98A 2YNWA 4RBSA 1QH5A 5EVKA 4AD9A 4Z6XA 2BFLA 4NURA 2Y8AA 3BC2A 4JO0A 4ZNBA 4ZO3A 2ZO4A 4C09A 1YCHA 1A7TA 1Y44A 2GFKA 3IE1A 4C1CA 4F6ZA 2YNVB 3I11A 4GCWA 4DIKA 2R2DA 4ZEJA 3ZNBA 5K4KA 5EV6A 4KEPA 1X8GA 4TYTA 5ACQA 2HB9A 4XWTA 1KO3A 1DDKA 3AF5A 1HLKA 3PY5A 3AF6A 4UWOB 2H6AA 4C1GA 1WUOA 5FQBA 4DILA 3ZQ4A 5LMCA 1K07A 1MQOA 2QINA 2WRSA 2FU6A 2M5DA 3SFPA 5AYAA 3S0ZA 2FK6A 2QJSA 1ZNBA 3RPCA 1YCGA 4UA4A 2BG7A 2OHHA 4FR7A 2AIOA 3L6NA 3Q6VA 4B87A 4AWZA 4D1UA 3T3OA 1M2XA 4Z67A 2Q42A 4FSBA 3KNSA 1A8TA 2NZFA 3DHCA 3DH8A 4UWSB 2DOOA 3IE0A 4YSLA 4C1EA 3MD7A 4C1DA 2YCBA 4AXHA 5EW0A 5A87A 4HL2A 1DXKA 4EXYA 3T3NA 4AV7A 5HIPA 5B3RA 2P4ZA 2CFUA 2BFKA 2BG2A 3X2ZA 3IEKA 5A23A 4ZO2A 2Q0JA 2NXAA 5ACXA 5B1UA 5HH4A 2CG2A 2UYXA 4RM5A 4BZ3A 5FQCA 4GYQA 3IOGA 1SMLA 3FAIA 4PVTA 4C1HA 4NQ6A 4EY2A 3P2UA 2YNTB 4YSBA 2M5CA 3I0VA 2QDSA 4D1TA 4HKYA 5LCHA 2FU7A 2I7XA 1WUPA 5EHTA 4RAWA
chains in the Genus database with same CATH topology
3IELA 5A0VA 2FM6A 2A7MA 2BFZB 4EFZA 5ACPA 1BC2A 4LE6A 2I7TA 1ZTCA 4TZBA 4EYBA 5EV8A 4CHLA 4Z60A 2Y8BA 2ZZIA 3ADRA 1QH3A 2BG8B 4RL0A 1XM8A 1X8HA 4AX0B 5K4MA 2BC2A 3SPUA 4AWYB 3PG4A 3ESHA 4XUKA 2FU8A 5AHRA 2ZWRA 2BMIA 3IOFA 5HIOA 3ZR9A 3RKKA 4J5FA 4PVOA 3DHBA 3F9OA 5AHOA 2P97A 2GKLA 4WD6A 4TZ9A 3RKJA 4UBQA 2OHJA 1E5DA 2E7YA 2BTNA 5LE1A 4P62A 2BG6A 2FU9A 2BR6A 2Q0IA 2P1EA 4FEKA 3KL7A 3I15A 5EWAA 3BK1A 4TZFA 3PY6A 3X2YA 4GYUA 5EVBA 5AXOA 3VQZA 1KR3A 3I13A 4BP0A 2VW8A 5ACWA 2CBNA 3KNRA 2BIBA 2GFJA 5B15A 4TZEA 2YNTA 5HH5A 3X2XA 2FHXB 1P9EA 3SD9A 5KIKA 5FQAA 4EXSA 5EVDA 4EYLA 4Z5ZA 3I14A 4RL2A 4XWWA 5ACUA 2AZ4A 2BFZA 2YNVA 2WYLA 4EYFA 1L9YA 2XR1A 5LLDA 1BVTA 2WHGA 3A4YA 3SBLA 1X8IA 1JJEA 1KO2A 4D02A 3DHAA 4TYFA 2WYMC 4KEQA 4NQ2A 5ACRA 3VPEA 2Q9UA 5A5ZA 5IQKA 5LM6A 5HISA 2Y87A 3BK2A 1VGNA 5HIQA 2BG8A 4J5HA 5LS3A 3X30A 2BGAA 1YCFA 2OHIA 3H3EA 4UWRB 5AXRA 4NQ5A 3QH8A 4HL1A 5ACVA 5A0TA 4AX1B 5KILA 4U4LA 4UAMA 4YSKA 5DPXA 2NYPA 4C1FA 2P18A 2NZEA 5K4NA 3BV6A 1JT1A 1ZKPA 1VMEA 4D1WA 3FCZA 3IDZA 2YZ3A 3LVZA 3JXPA 3WXCA 4V0HA 4F6HA 3ZWFA 2QDTA 4H0DA 2GCUA 5K0WA 1XTOA 2XF4A 1WW1A 4D1VA 3SRXA 1WRAA 2WYMA 3G1PA 2I7VA 1JJTA 5EH9A 2YNUA 3AJ3A 4Z5YA 2FHXA 1VJNA 1DD6A 4RAMA 2DKFA 4UWPB 5HH6A 4NQ4A 3SW3A 3T9MA 5ACSA 4Z7RA 5LCFA 3IE2A 5LSCA 5LCAA 2QEDA 3IEMA 3R2UA 1BMCA 5AEBA 2GMNA 3TP9A 5ACTA 2ZNBA 4O98A 2YNWA 4RBSA 1QH5A 5EVKA 4AD9A 4Z6XA 2BFLA 2Y8AA 3BC2A 4JO0A 4ZNBA 4ZO3A 2ZO4A 4C09A 1YCHA 1A7TA 1Y44A 2GFKA 3IE1A 4C1CA 4F6ZA 2YNVB 3I11A 4GCWA 4DIKA 2R2DA 4ZEJA 3ZNBA 5K4KA 5EV6A 4KEPA 1X8GA 4TYTA 5ACQA 2HB9A 4XWTA 1KO3A 1DDKA 3AF5A 1HLKA 3PY5A 3AF6A 4UWOB 2H6AA 4C1GA 1WUOA 5FQBA 4DILA 3ZQ4A 5LMCA 1K07A 1MQOA 2QINA 2WRSA 2FU6A 2M5DA 3SFPA 5AYAA 3S0ZA 2FK6A 2QJSA 1ZNBA 3RPCA 1YCGA 4UA4A 2BG7A 2OHHA 4FR7A 2AIOA 3L6NA 3Q6VA 4B87A 4AWZA 4D1UA 3T3OA 1M2XA 4Z67A 2Q42A 4FSBA 3KNSA 1A8TA 2NZFA 3DHCA 3DH8A 4UWSB 2DOOA 3IE0A 4YSLA 4C1EA 3MD7A 4C1DA 2YCBA 5EW0A 5A87A 4HL2A 1DXKA 4EXYA 3T3NA 5HIPA 5B3RA 2P4ZA 2BFKA 2BG2A 3X2ZA 3IEKA 4ZO2A 2Q0JA 2NXAA 5ACXA 5B1UA 5HH4A 2UYXA 4RM5A 4BZ3A 5FQCA 4GYQA 3IOGA 1SMLA 3FAIA 4PVTA 4C1HA 4NQ6A 4EY2A 3P2UA 2YNTB 4YSBA 2M5CA 3I0VA 2QDSA 4D1TA 4HKYA 5LCHA 2FU7A 2I7XA 1WUPA 5EHTA 4RAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IEL A;  5A0V A;  2FM6 A;  2A7M A;  2BFZ B;  4EFZ A;  5ACP A;  1BC2 A;  4LE6 A;  2I7T A;  1ZTC A;  4TZB A;  4EYB A;  5EV8 A;  4CHL A;  4Z60 A;  2Y8B A;  2ZZI A;  3ADR A;  1QH3 A;  2BG8 B;  4RL0 A;  1XM8 A;  1X8H A;  4AX0 B;  5K4M A;  2BC2 A;  3SPU A;  4AWY B;  3PG4 A;  3ESH A;  4XUK A;  2FU8 A;  5AHR A;  2ZWR A;  2BMI A;  3IOF A;  5HIO A;  3ZR9 A;  3RKK A;  4J5F A;  4PVO A;  3DHB A;  3F9O A;  5AHO A;  2P97 A;  2GKL A;  4WD6 A;  4TZ9 A;  3RKJ A;  4UBQ A;  2OHJ A;  1E5D A;  2E7Y A;  2BTN A;  5LE1 A;  4P62 A;  2BG6 A;  2FU9 A;  2BR6 A;  2Q0I A;  2P1E A;  4FEK A;  3KL7 A;  3I15 A;  5EWA A;  3BK1 A;  4TZF A;  3PY6 A;  3X2Y A;  4GYU A;  5EVB A;  5AXO A;  3VQZ A;  1KR3 A;  3I13 A;  4BP0 A;  2VW8 A;  5ACW A;  2CBN A;  3KNR A;  2BIB A;  2GFJ A;  5B15 A;  4TZE A;  2YNT A;  5HH5 A;  3X2X A;  2FHX B;  1P9E A;  3SD9 A;  5KIK A;  5FQA A;  4EXS A;  5EVD A;  4EYL A;  4Z5Z A;  3I14 A;  4RL2 A;  4XWW A;  5ACU A;  2AZ4 A;  2BFZ A;  2YNV A;  2WYL A;  4EYF A;  1L9Y A;  2XR1 A;  5LLD A;  1BVT A;  2WHG A;  3A4Y A;  3SBL A;  1X8I A;  1JJE A;  1KO2 A;  4D02 A;  3DHA A;  4TYF A;  2WYM C;  4KEQ A;  4NQ2 A;  5ACR A;  3VPE A;  2Q9U A;  5A5Z A;  5IQK A;  5LM6 A;  5HIS A;  2Y87 A;  3BK2 A;  1VGN A;  5HIQ A;  2BG8 A;  4J5H A;  5LS3 A;  3X30 A;  2BGA A;  1YCF A;  2OHI A;  3H3E A;  4UWR B;  5AXR A;  4NQ5 A;  3QH8 A;  4HL1 A;  5ACV A;  5A0T A;  4AX1 B;  5KIL A;  4U4L A;  4UAM A;  4YSK A;  5DPX A;  2NYP A;  4C1F A;  2P18 A;  2NZE A;  5K4N A;  3BV6 A;  1JT1 A;  1ZKP A;  1VME A;  4D1W A;  3FCZ A;  3IDZ A;  2YZ3 A;  3LVZ A;  3JXP A;  3WXC A;  4V0H A;  4F6H A;  3ZWF A;  2QDT A;  4H0D A;  2GCU A;  5K0W A;  1XTO A;  2XF4 A;  1WW1 A;  4D1V A;  3SRX A;  1WRA A;  2WYM A;  3G1P A;  2I7V A;  1JJT A;  5EH9 A;  2YNU A;  3AJ3 A;  4Z5Y A;  2FHX A;  1VJN A;  1DD6 A;  4RAM A;  2DKF A;  4UWP B;  5HH6 A;  4NQ4 A;  3SW3 A;  3T9M A;  5ACS A;  4Z7R A;  5LCF A;  3IE2 A;  5LSC A;  5LCA A;  2QED A;  3IEM A;  3R2U A;  1BMC A;  5AEB A;  2GMN A;  3TP9 A;  5ACT A;  2ZNB A;  4O98 A;  2YNW A;  4RBS A;  1QH5 A;  5EVK A;  4AD9 A;  4Z6X A;  2BFL A;  2Y8A A;  3BC2 A;  4JO0 A;  4ZNB A;  4ZO3 A;  2ZO4 A;  4C09 A;  1YCH A;  1A7T A;  1Y44 A;  2GFK A;  3IE1 A;  4C1C A;  4F6Z A;  2YNV B;  3I11 A;  4GCW A;  4DIK A;  2R2D A;  4ZEJ A;  3ZNB A;  5K4K A;  5EV6 A;  4KEP A;  1X8G A;  4TYT A;  5ACQ A;  2HB9 A;  4XWT A;  1KO3 A;  1DDK A;  3AF5 A;  1HLK A;  3PY5 A;  3AF6 A;  4UWO B;  2H6A A;  4C1G A;  1WUO A;  5FQB A;  4DIL A;  3ZQ4 A;  5LMC A;  1K07 A;  1MQO A;  2QIN A;  2WRS A;  2FU6 A;  2M5D A;  3SFP A;  5AYA A;  3S0Z A;  2FK6 A;  2QJS A;  1ZNB A;  3RPC A;  1YCG A;  4UA4 A;  2BG7 A;  2OHH A;  4FR7 A;  2AIO A;  3L6N A;  3Q6V A;  4B87 A;  4AWZ A;  4D1U A;  3T3O A;  1M2X A;  4Z67 A;  2Q42 A;  4FSB A;  3KNS A;  1A8T A;  2NZF A;  3DHC A;  3DH8 A;  4UWS B;  2DOO A;  3IE0 A;  4YSL A;  4C1E A;  3MD7 A;  4C1D A;  2YCB A;  5EW0 A;  5A87 A;  4HL2 A;  1DXK A;  4EXY A;  3T3N A;  5HIP A;  5B3R A;  2P4Z A;  2BFK A;  2BG2 A;  3X2Z A;  3IEK A;  4ZO2 A;  2Q0J A;  2NXA A;  5ACX A;  5B1U A;  5HH4 A;  2UYX A;  4RM5 A;  4BZ3 A;  5FQC A;  4GYQ A;  3IOG A;  1SML A;  3FAI A;  4PVT A;  4C1H A;  4NQ6 A;  4EY2 A;  3P2U A;  2YNT B;  4YSB A;  2M5C A;  3I0V A;  2QDS A;  4D1T A;  4HKY A;  5LCH A;  2FU7 A;  2I7X A;  1WUP A;  5EHT A;  4RAW A; 
#chains in the Genus database with same CATH topology
 3IEL A;  5A0V A;  2FM6 A;  2A7M A;  2BFZ B;  4EFZ A;  5ACP A;  1BC2 A;  4LE6 A;  2I7T A;  1ZTC A;  4TZB A;  4EYB A;  5EV8 A;  4CHL A;  4Z60 A;  2Y8B A;  2ZZI A;  3ADR A;  1QH3 A;  2BG8 B;  4RL0 A;  1XM8 A;  1X8H A;  4AX0 B;  5K4M A;  2BC2 A;  3SPU A;  4AWY B;  3PG4 A;  3ESH A;  4XUK A;  2FU8 A;  5AHR A;  2ZWR A;  2BMI A;  3IOF A;  5HIO A;  3ZR9 A;  3RKK A;  4J5F A;  4PVO A;  3DHB A;  2YHE A;  3F9O A;  5AHO A;  2P97 A;  2GKL A;  4WD6 A;  4TZ9 A;  3RKJ A;  4UBQ A;  2OHJ A;  1E5D A;  2E7Y A;  2BTN A;  5LE1 A;  4P62 A;  2BG6 A;  2FU9 A;  2BR6 A;  2Q0I A;  2P1E A;  4FEK A;  3KL7 A;  3I15 A;  5EWA A;  3BK1 A;  4TZF A;  3PY6 A;  3X2Y A;  4GYU A;  5EVB A;  5AXO A;  3VQZ A;  1KR3 A;  3I13 A;  4BP0 A;  2VW8 A;  5ACW A;  2CBN A;  3KNR A;  2BIB A;  2GFJ A;  5B15 A;  4TZE A;  2YNT A;  2CG3 A;  5HH5 A;  3X2X A;  2FHX B;  1P9E A;  3SD9 A;  5KIK A;  5FQA A;  4EXS A;  5EVD A;  4EYL A;  4Z5Z A;  3I14 A;  4RL2 A;  4XWW A;  5ACU A;  2AZ4 A;  4PDX A;  2BFZ A;  2YNV A;  2WYL A;  2CFZ A;  4EYF A;  1L9Y A;  2XR1 A;  5LLD A;  1BVT A;  2WHG A;  3A4Y A;  3SBL A;  1X8I A;  1JJE A;  1KO2 A;  5AJL A;  4D02 A;  3DHA A;  4TYF A;  2WYM C;  4KEQ A;  4NQ2 A;  5ACR A;  3VPE A;  2Q9U A;  5A5Z A;  5IQK A;  5LM6 A;  5HIS A;  2Y87 A;  3BK2 A;  1VGN A;  5HIQ A;  2BG8 A;  4J5H A;  5LS3 A;  3X30 A;  2BGA A;  1YCF A;  2OHI A;  3H3E A;  4UWR B;  5AXR A;  4NQ5 A;  3QH8 A;  4HL1 A;  5ACV A;  5A0T A;  4AX1 B;  5KIL A;  4U4L A;  4UAM A;  4YSK A;  5DPX A;  2NYP A;  4C1F A;  2P18 A;  2NZE A;  5K4N A;  3BV6 A;  1JT1 A;  1ZKP A;  1VME A;  4D1W A;  3FCZ A;  3IDZ A;  2YZ3 A;  3LVZ A;  3JXP A;  3WXC A;  4V0H A;  4F6H A;  3ZWF A;  2QDT A;  4H0D A;  2GCU A;  5K0W A;  1XTO A;  2XF4 A;  1WW1 A;  4D1V A;  3SRX A;  5AIJ A;  1WRA A;  2WYM A;  3G1P A;  2I7V A;  1JJT A;  5EH9 A;  2YNU A;  3AJ3 A;  4Z5Y A;  2FHX A;  1VJN A;  1DD6 A;  4RAM A;  2DKF A;  4UWP B;  5HH6 A;  4NQ4 A;  3SW3 A;  3T9M A;  5ACS A;  4Z7R A;  5LCF A;  3IE2 A;  5LSC A;  5LCA A;  2QED A;  3IEM A;  3R2U A;  1BMC A;  5AEB A;  2GMN A;  3TP9 A;  5ACT A;  2ZNB A;  4O98 A;  2YNW A;  4RBS A;  1QH5 A;  5EVK A;  4AD9 A;  4Z6X A;  2BFL A;  4NUR A;  2Y8A A;  3BC2 A;  4JO0 A;  4ZNB A;  4ZO3 A;  2ZO4 A;  4C09 A;  1YCH A;  1A7T A;  1Y44 A;  2GFK A;  3IE1 A;  4C1C A;  4F6Z A;  2YNV B;  3I11 A;  4GCW A;  4DIK A;  2R2D A;  4ZEJ A;  3ZNB A;  5K4K A;  5EV6 A;  4KEP A;  1X8G A;  4TYT A;  5ACQ A;  2HB9 A;  4XWT A;  1KO3 A;  1DDK A;  3AF5 A;  1HLK A;  3PY5 A;  3AF6 A;  4UWO B;  2H6A A;  4C1G A;  1WUO A;  5FQB A;  4DIL A;  3ZQ4 A;  5LMC A;  1K07 A;  1MQO A;  2QIN A;  2WRS A;  2FU6 A;  2M5D A;  3SFP A;  5AYA A;  3S0Z A;  2FK6 A;  2QJS A;  1ZNB A;  3RPC A;  1YCG A;  4UA4 A;  2BG7 A;  2OHH A;  4FR7 A;  2AIO A;  3L6N A;  3Q6V A;  4B87 A;  4AWZ A;  4D1U A;  3T3O A;  1M2X A;  4Z67 A;  2Q42 A;  4FSB A;  3KNS A;  1A8T A;  2NZF A;  3DHC A;  3DH8 A;  4UWS B;  2DOO A;  3IE0 A;  4YSL A;  4C1E A;  3MD7 A;  4C1D A;  2YCB A;  4AXH A;  5EW0 A;  5A87 A;  4HL2 A;  1DXK A;  4EXY A;  3T3N A;  4AV7 A;  5HIP A;  5B3R A;  2P4Z A;  2CFU A;  2BFK A;  2BG2 A;  3X2Z A;  3IEK A;  5A23 A;  4ZO2 A;  2Q0J A;  2NXA A;  5ACX A;  5B1U A;  5HH4 A;  2CG2 A;  2UYX A;  4RM5 A;  4BZ3 A;  5FQC A;  4GYQ A;  3IOG A;  1SML A;  3FAI A;  4PVT A;  4C1H A;  4NQ6 A;  4EY2 A;  3P2U A;  2YNT B;  4YSB A;  2M5C A;  3I0V A;  2QDS A;  4D1T A;  4HKY A;  5LCH A;  2FU7 A;  2I7X A;  1WUP A;  5EHT A;  4RAW A; 
#chains in the Genus database with same CATH homology
 3IEL A;  5A0V A;  2FM6 A;  2A7M A;  2BFZ B;  4EFZ A;  5ACP A;  1BC2 A;  4LE6 A;  2I7T A;  1ZTC A;  4TZB A;  4EYB A;  5EV8 A;  4CHL A;  4Z60 A;  2Y8B A;  2ZZI A;  3ADR A;  1QH3 A;  2BG8 B;  4RL0 A;  1XM8 A;  1X8H A;  4AX0 B;  5K4M A;  2BC2 A;  3SPU A;  4AWY B;  3PG4 A;  3ESH A;  4XUK A;  2FU8 A;  5AHR A;  2ZWR A;  2BMI A;  3IOF A;  5HIO A;  3ZR9 A;  3RKK A;  4J5F A;  4PVO A;  3DHB A;  3F9O A;  5AHO A;  2P97 A;  2GKL A;  4WD6 A;  4TZ9 A;  3RKJ A;  4UBQ A;  2OHJ A;  1E5D A;  2E7Y A;  2BTN A;  5LE1 A;  4P62 A;  2BG6 A;  2FU9 A;  2BR6 A;  2Q0I A;  2P1E A;  4FEK A;  3KL7 A;  3I15 A;  5EWA A;  3BK1 A;  4TZF A;  3PY6 A;  3X2Y A;  4GYU A;  5EVB A;  5AXO A;  3VQZ A;  1KR3 A;  3I13 A;  4BP0 A;  2VW8 A;  5ACW A;  2CBN A;  3KNR A;  2BIB A;  2GFJ A;  5B15 A;  4TZE A;  2YNT A;  5HH5 A;  3X2X A;  2FHX B;  1P9E A;  3SD9 A;  5KIK A;  5FQA A;  4EXS A;  5EVD A;  4EYL A;  4Z5Z A;  3I14 A;  4RL2 A;  4XWW A;  5ACU A;  2AZ4 A;  2BFZ A;  2YNV A;  2WYL A;  4EYF A;  1L9Y A;  2XR1 A;  5LLD A;  1BVT A;  2WHG A;  3A4Y A;  3SBL A;  1X8I A;  1JJE A;  1KO2 A;  4D02 A;  3DHA A;  4TYF A;  2WYM C;  4KEQ A;  4NQ2 A;  5ACR A;  3VPE A;  2Q9U A;  5A5Z A;  5IQK A;  5LM6 A;  5HIS A;  2Y87 A;  3BK2 A;  1VGN A;  5HIQ A;  2BG8 A;  4J5H A;  5LS3 A;  3X30 A;  2BGA A;  1YCF A;  2OHI A;  3H3E A;  4UWR B;  5AXR A;  4NQ5 A;  3QH8 A;  4HL1 A;  5ACV A;  5A0T A;  4AX1 B;  5KIL A;  4U4L A;  4UAM A;  4YSK A;  5DPX A;  2NYP A;  4C1F A;  2P18 A;  2NZE A;  5K4N A;  3BV6 A;  1JT1 A;  1ZKP A;  1VME A;  4D1W A;  3FCZ A;  3IDZ A;  2YZ3 A;  3LVZ A;  3JXP A;  3WXC A;  4V0H A;  4F6H A;  3ZWF A;  2QDT A;  4H0D A;  2GCU A;  5K0W A;  1XTO A;  2XF4 A;  1WW1 A;  4D1V A;  3SRX A;  1WRA A;  2WYM A;  3G1P A;  2I7V A;  1JJT A;  5EH9 A;  2YNU A;  3AJ3 A;  4Z5Y A;  2FHX A;  1VJN A;  1DD6 A;  4RAM A;  2DKF A;  4UWP B;  5HH6 A;  4NQ4 A;  3SW3 A;  3T9M A;  5ACS A;  4Z7R A;  5LCF A;  3IE2 A;  5LSC A;  5LCA A;  2QED A;  3IEM A;  3R2U A;  1BMC A;  5AEB A;  2GMN A;  3TP9 A;  5ACT A;  2ZNB A;  4O98 A;  2YNW A;  4RBS A;  1QH5 A;  5EVK A;  4AD9 A;  4Z6X A;  2BFL A;  2Y8A A;  3BC2 A;  4JO0 A;  4ZNB A;  4ZO3 A;  2ZO4 A;  4C09 A;  1YCH A;  1A7T A;  1Y44 A;  2GFK A;  3IE1 A;  4C1C A;  4F6Z A;  2YNV B;  3I11 A;  4GCW A;  4DIK A;  2R2D A;  4ZEJ A;  3ZNB A;  5K4K A;  5EV6 A;  4KEP A;  1X8G A;  4TYT A;  5ACQ A;  2HB9 A;  4XWT A;  1KO3 A;  1DDK A;  3AF5 A;  1HLK A;  3PY5 A;  3AF6 A;  4UWO B;  2H6A A;  4C1G A;  1WUO A;  5FQB A;  4DIL A;  3ZQ4 A;  5LMC A;  1K07 A;  1MQO A;  2QIN A;  2WRS A;  2FU6 A;  2M5D A;  3SFP A;  5AYA A;  3S0Z A;  2FK6 A;  2QJS A;  1ZNB A;  3RPC A;  1YCG A;  4UA4 A;  2BG7 A;  2OHH A;  4FR7 A;  2AIO A;  3L6N A;  3Q6V A;  4B87 A;  4AWZ A;  4D1U A;  3T3O A;  1M2X A;  4Z67 A;  2Q42 A;  4FSB A;  3KNS A;  1A8T A;  2NZF A;  3DHC A;  3DH8 A;  4UWS B;  2DOO A;  3IE0 A;  4YSL A;  4C1E A;  3MD7 A;  4C1D A;  2YCB A;  5EW0 A;  5A87 A;  4HL2 A;  1DXK A;  4EXY A;  3T3N A;  5HIP A;  5B3R A;  2P4Z A;  2BFK A;  2BG2 A;  3X2Z A;  3IEK A;  4ZO2 A;  2Q0J A;  2NXA A;  5ACX A;  5B1U A;  5HH4 A;  2UYX A;  4RM5 A;  4BZ3 A;  5FQC A;  4GYQ A;  3IOG A;  1SML A;  3FAI A;  4PVT A;  4C1H A;  4NQ6 A;  4EY2 A;  3P2U A;  2YNT B;  4YSB A;  2M5C A;  3I0V A;  2QDS A;  4D1T A;  4HKY A;  5LCH A;  2FU7 A;  2I7X A;  1WUP A;  5EHT A;  4RAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...