2BR6A

Crystal structure of quorum-quenching n-acyl homoserine lactone lactonase
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
252
structure length
240
Chain Sequence
MDMTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIKTEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AIIA-LIKE PROTEIN
publication title The Molecular Structure and Catalytic Mechanism of a Quorum-Quenching N-Acyl-L-Homoserine Lactone Hydrolase.
pubmed doi rcsb
source organism Bacillus thuringiensis
molecule tags Hydrolase
total genus 70
structure length 240
sequence length 252
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2005-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2br6A01
1VGNA 2ZO4A 2Q0IA 2M5DA 2BIBA 3TP9A 1YCGA 2BTNA 1L9YA 2Q42A 2YNTB 3BV6A 4UWPB 4D02A 3X2ZA 5KIKA 4O98A 4EFZA 4RL0A 3KNSA 3T3OA 2Y8AA 3PY5A 2QDTA 5A87A 5K4MA 2FU7A 5ACRA 2FU6A 5HH6A 2BFKA 3I0VA 2XF4A 4PVOA 4GCWA 4UA4A 1WRAA 1KO3A 2YZ3A 4HKYA 4XUKA 1MQOA 3QH8A 3P2UA 5ACVA 5LCHA 4RAWA 2QEDA 4C1CA 4AX1B 1VMEA 2DKFA 5HIQA 4DILA 2YNUA 5LLDA 2Q0JA 4ZO2A 3ZR9A 3IEKA 5AYAA 2DOOA 4XWTA 3SRXA 4C09A 4NQ5A 5ACPA 2BFZA 2BG6A 3RPCA 2GFJA 5IQKA 3RKJA 2YNTA 2P4ZA 2YNWA 4EY2A 3SW3A 2BMIA 2NZFA 1VJNA 3X2YA 1X8GA 4GYQA 3IEMA 3A4YA 3MD7A 2GFKA 3IELA 2H6AA 3IDZA 5FQAA 3ZNBA 2UYXA 2BC2A 3KNRA 4H0DA 4D1UA 4Z5ZA 5ACTA 5EVKA 2BFLA 4YSKA 2P18A 4V0HA 5A0VA 3SPUA 3ZWFA 3ADRA 5KILA 4UWOB 5AXOA 4FSBA 2NYPA 4B87A 4YSBA 3DHCA 2P97A 5EVDA 4ZEJA 4EYFA 2BFZB 4EYLA 3PG4A 2A7MA 4LE6A 5B15A 2BG2A 5LMCA 2WYLA 4Z6XA 4HL1A 4NQ2A 4HL2A 2WHGA 1ZKPA 3DHBA 4UWSB 2NZEA 5LCAA 3I15A 1ZNBA 3FCZA 3S0ZA 5LS3A 4JO0A 2I7VA 1ZTCA 1HLKA 4AD9A 5B3RA 5ACWA 3AF5A 5B1UA 4U4LA 1XTOA 4C1HA 2NXAA 4Z5YA 3LVZA 2YCBA 4TYFA 4UAMA 4UBQA 3AF6A 3I13A 1K07A 5EHTA 4C1GA 4RBSA 5K4NA 4RAMA 2AIOA 1QH3A 3G1PA 1DDKA 5AHRA 4AWZA 2GMNA 3VPEA 1DXKA 4D1WA 3IOGA 4DIKA 4NQ4A 3T3NA 2I7TA 2QJSA 3DH8A 3BK1A 3L6NA 2OHJA 3SFPA 1JJEA 5EH9A 1M2XA 5A0TA 2GCUA 5HISA 4J5HA 3SBLA 2ZNBA 4P62A 2WYMC 3RKKA 2R2DA 4YSLA 4CHLA 4ZNBA 1WUOA 2GKLA 2HB9A 3IOFA 5A5ZA 1X8HA 2BGAA 4BZ3A 5EV6A 5AEBA 4TZBA 2YNVA 3BK2A 3DHAA 5FQCA 3ESHA 4GYUA 4UWRB 4AWYB 1Y44A 3AJ3A 3H3EA 4Z67A 2AZ4A 5EWAA 4KEQA 3SD9A 1JT1A 5EVBA 3KL7A 1YCHA 5EV8A 4ZO3A 3I14A 4Z60A 2QINA 4TZFA 2XR1A 5K4KA 3BC2A 2CBNA 5DPXA 1KO2A 2BG8A 2P1EA 5ACUA 3IE1A 5FQBA 2FU8A 1SMLA 3F9OA 5LSCA 1P9EA 5ACSA 4TZEA 5ACQA 2QDSA 2OHIA 2FHXA 2YNVB 4TYTA 2WYMA 4KEPA 3WXCA 2Q9UA 4C1EA 2FK6A 5ACXA 5LE1A 4AX0B 5HIOA 1XM8A 2FU9A 3R2UA 5AXRA 4RM5A 1A8TA 2Y87A 5EW0A 2WRSA 2ZZIA 3IE2A 5HIPA 4EXSA 3X2XA 1WUPA 4F6ZA 5LCFA 2BG8B 4C1FA 2VW8A 1QH5A 2ZWRA 1YCFA 2OHHA 4C1DA 4TZ9A 4Z7RA 1BMCA 1E5DA 2FHXB 4J5FA 1BC2A 4PVTA 2M5CA 2BG7A 4NQ6A 2E7YA 1BVTA 4EXYA 2I7XA 4EYBA 3IE0A 5AHOA 4XWWA 5HH5A 4D1VA 1DD6A 1JJTA 4WD6A 3T9MA 2Y8BA 4BP0A 4FEKA 3PY6A 2FM6A 2BR6A 3X30A 4D1TA 4FR7A 4RL2A 1X8IA 5HH4A 1A7TA 5K0WA 5LM6A 3I11A 3JXPA 3VQZA 1KR3A 3FAIA 3Q6VA 1WW1A 4F6HA 3ZQ4A
chains in the Genus database with same CATH superfamily
1VGNA 2ZO4A 2Q0IA 2M5DA 2BIBA 3TP9A 1YCGA 2BTNA 1L9YA 2Q42A 2YNTB 4AXHA 3BV6A 4UWPB 4D02A 3X2ZA 5KIKA 4O98A 4EFZA 4RL0A 3KNSA 5AIJA 3T3OA 2Y8AA 3PY5A 2QDTA 5A87A 5K4MA 2FU7A 5ACRA 2FU6A 5HH6A 2BFKA 3I0VA 2XF4A 4PVOA 4GCWA 4UA4A 1WRAA 2CG3A 1KO3A 2YZ3A 4HKYA 4XUKA 1MQOA 3QH8A 3P2UA 5ACVA 5LCHA 4RAWA 2QEDA 4C1CA 4AX1B 1VMEA 2DKFA 5HIQA 4DILA 2YNUA 5LLDA 2Q0JA 4ZO2A 3ZR9A 3IEKA 2CFZA 5AYAA 2DOOA 4XWTA 3SRXA 4C09A 4NQ5A 5ACPA 2BFZA 3RPCA 2BG6A 2GFJA 5IQKA 3RKJA 2YNTA 2P4ZA 2YNWA 4EY2A 3SW3A 2BMIA 2NZFA 1VJNA 3X2YA 1X8GA 4GYQA 3IEMA 3A4YA 3MD7A 2GFKA 3IELA 5AJLA 2H6AA 3IDZA 5FQAA 3ZNBA 2UYXA 2BC2A 3KNRA 4H0DA 4D1UA 4Z5ZA 5ACTA 5EVKA 2BFLA 4YSKA 2P18A 4V0HA 5A0VA 3SPUA 3ZWFA 3ADRA 5KILA 4UWOB 5AXOA 4FSBA 2NYPA 4B87A 4YSBA 3DHCA 2P97A 5EVDA 4ZEJA 4EYFA 2BFZB 4EYLA 3PG4A 2A7MA 4LE6A 5B15A 2BG2A 5LMCA 2WYLA 4Z6XA 4HL1A 4NQ2A 4HL2A 2WHGA 1ZKPA 3DHBA 4UWSB 2NZEA 2CFUA 5LCAA 3I15A 1ZNBA 3FCZA 3S0ZA 5LS3A 4JO0A 2I7VA 1ZTCA 1HLKA 4AD9A 5B3RA 5ACWA 3AF5A 5B1UA 4U4LA 4NURA 1XTOA 4C1HA 2NXAA 4Z5YA 3LVZA 2YCBA 4TYFA 4UAMA 4UBQA 3AF6A 3I13A 1K07A 5EHTA 4C1GA 4RBSA 5K4NA 4RAMA 2AIOA 1QH3A 3G1PA 1DDKA 5AHRA 4AWZA 2GMNA 3VPEA 1DXKA 4D1WA 3IOGA 4DIKA 4NQ4A 3T3NA 2I7TA 2QJSA 3DH8A 3BK1A 3L6NA 2OHJA 3SFPA 1JJEA 5EH9A 1M2XA 5A0TA 2GCUA 5HISA 4J5HA 3SBLA 2ZNBA 4P62A 2WYMC 3RKKA 2R2DA 5A23A 4YSLA 4CHLA 4ZNBA 1WUOA 2GKLA 2HB9A 3IOFA 5A5ZA 1X8HA 2BGAA 4BZ3A 5EV6A 5AEBA 4TZBA 2YNVA 3BK2A 3DHAA 5FQCA 3ESHA 4GYUA 4UWRB 4AWYB 1Y44A 3AJ3A 3H3EA 4Z67A 2AZ4A 5EWAA 4KEQA 3SD9A 1JT1A 5EVBA 3KL7A 1YCHA 5EV8A 4ZO3A 3I14A 4Z60A 2QINA 4AV7A 4TZFA 2XR1A 5K4KA 3BC2A 2CBNA 5DPXA 1KO2A 2CG2A 2BG8A 2P1EA 5ACUA 3IE1A 5FQBA 2FU8A 1SMLA 3F9OA 5LSCA 1P9EA 5ACSA 4TZEA 5ACQA 2QDSA 2OHIA 2FHXA 2YNVB 4TYTA 2WYMA 4KEPA 3WXCA 2Q9UA 4C1EA 4PDXA 2FK6A 5ACXA 5LE1A 4AX0B 5HIOA 1XM8A 2FU9A 3R2UA 5AXRA 4RM5A 1A8TA 2Y87A 5EW0A 2WRSA 2ZZIA 3IE2A 5HIPA 4EXSA 3X2XA 1WUPA 4F6ZA 5LCFA 2BG8B 4C1FA 2VW8A 1QH5A 2ZWRA 1YCFA 2YHEA 2OHHA 4C1DA 4TZ9A 4Z7RA 1BMCA 1E5DA 2FHXB 4J5FA 1BC2A 4PVTA 2M5CA 2BG7A 4NQ6A 2E7YA 1BVTA 4EXYA 2I7XA 4EYBA 3IE0A 5AHOA 4XWWA 5HH5A 4D1VA 1DD6A 1JJTA 4WD6A 3T9MA 2Y8BA 4BP0A 4FEKA 3PY6A 2FM6A 2BR6A 3X30A 4D1TA 4FR7A 4RL2A 1X8IA 5HH4A 1A7TA 5K0WA 5LM6A 3I11A 3JXPA 3VQZA 1KR3A 3FAIA 3Q6VA 1WW1A 4F6HA 3ZQ4A
chains in the Genus database with same CATH topology
1VGNA 2ZO4A 2Q0IA 2M5DA 2BIBA 3TP9A 1YCGA 2BTNA 1L9YA 2Q42A 2YNTB 3BV6A 4UWPB 4D02A 3X2ZA 5KIKA 4O98A 4EFZA 4RL0A 3KNSA 3T3OA 2Y8AA 3PY5A 2QDTA 5A87A 5K4MA 2FU7A 5ACRA 2FU6A 5HH6A 2BFKA 3I0VA 2XF4A 4PVOA 4GCWA 4UA4A 1WRAA 1KO3A 2YZ3A 4HKYA 4XUKA 1MQOA 3QH8A 3P2UA 5ACVA 5LCHA 4RAWA 2QEDA 4C1CA 4AX1B 1VMEA 2DKFA 5HIQA 4DILA 2YNUA 5LLDA 2Q0JA 4ZO2A 3ZR9A 3IEKA 5AYAA 2DOOA 4XWTA 3SRXA 4C09A 4NQ5A 5ACPA 2BFZA 2BG6A 3RPCA 2GFJA 5IQKA 3RKJA 2YNTA 2P4ZA 2YNWA 4EY2A 3SW3A 2BMIA 2NZFA 1VJNA 3X2YA 1X8GA 4GYQA 3IEMA 3A4YA 3MD7A 2GFKA 3IELA 2H6AA 3IDZA 5FQAA 3ZNBA 2UYXA 2BC2A 3KNRA 4H0DA 4D1UA 4Z5ZA 5ACTA 5EVKA 2BFLA 4YSKA 2P18A 4V0HA 5A0VA 3SPUA 3ZWFA 3ADRA 5KILA 4UWOB 5AXOA 4FSBA 2NYPA 4B87A 4YSBA 3DHCA 2P97A 5EVDA 4ZEJA 4EYFA 2BFZB 4EYLA 3PG4A 2A7MA 4LE6A 5B15A 2BG2A 5LMCA 2WYLA 4Z6XA 4HL1A 4NQ2A 4HL2A 2WHGA 1ZKPA 3DHBA 4UWSB 2NZEA 5LCAA 3I15A 1ZNBA 3FCZA 3S0ZA 5LS3A 4JO0A 2I7VA 1ZTCA 1HLKA 4AD9A 5B3RA 5ACWA 3AF5A 5B1UA 4U4LA 1XTOA 4C1HA 2NXAA 4Z5YA 3LVZA 2YCBA 4TYFA 4UAMA 4UBQA 3AF6A 3I13A 1K07A 5EHTA 4C1GA 4RBSA 5K4NA 4RAMA 2AIOA 1QH3A 3G1PA 1DDKA 5AHRA 4AWZA 2GMNA 3VPEA 1DXKA 4D1WA 3IOGA 4DIKA 4NQ4A 3T3NA 2I7TA 2QJSA 3DH8A 3BK1A 3L6NA 2OHJA 3SFPA 1JJEA 5EH9A 1M2XA 5A0TA 2GCUA 5HISA 4J5HA 3SBLA 2ZNBA 4P62A 2WYMC 3RKKA 2R2DA 4YSLA 4CHLA 4ZNBA 1WUOA 2GKLA 2HB9A 3IOFA 5A5ZA 1X8HA 2BGAA 4BZ3A 5EV6A 5AEBA 4TZBA 2YNVA 3BK2A 3DHAA 5FQCA 3ESHA 4GYUA 4UWRB 4AWYB 1Y44A 3AJ3A 3H3EA 4Z67A 2AZ4A 5EWAA 4KEQA 3SD9A 1JT1A 5EVBA 3KL7A 1YCHA 5EV8A 4ZO3A 3I14A 4Z60A 2QINA 4TZFA 2XR1A 5K4KA 3BC2A 2CBNA 5DPXA 1KO2A 2BG8A 2P1EA 5ACUA 3IE1A 5FQBA 2FU8A 1SMLA 3F9OA 5LSCA 1P9EA 5ACSA 4TZEA 5ACQA 2QDSA 2OHIA 2FHXA 2YNVB 4TYTA 2WYMA 4KEPA 3WXCA 2Q9UA 4C1EA 2FK6A 5ACXA 5LE1A 4AX0B 5HIOA 1XM8A 2FU9A 3R2UA 5AXRA 4RM5A 1A8TA 2Y87A 5EW0A 2WRSA 2ZZIA 3IE2A 5HIPA 4EXSA 3X2XA 1WUPA 4F6ZA 5LCFA 2BG8B 4C1FA 2VW8A 1QH5A 2ZWRA 1YCFA 2OHHA 4C1DA 4TZ9A 4Z7RA 1BMCA 1E5DA 2FHXB 4J5FA 1BC2A 4PVTA 2M5CA 2BG7A 4NQ6A 2E7YA 1BVTA 4EXYA 2I7XA 4EYBA 3IE0A 5AHOA 4XWWA 5HH5A 4D1VA 1DD6A 1JJTA 4WD6A 3T9MA 2Y8BA 4BP0A 4FEKA 3PY6A 2FM6A 2BR6A 3X30A 4D1TA 4FR7A 4RL2A 1X8IA 5HH4A 1A7TA 5K0WA 5LM6A 3I11A 3JXPA 3VQZA 1KR3A 3FAIA 3Q6VA 1WW1A 4F6HA 3ZQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VGN A;  2ZO4 A;  2Q0I A;  2M5D A;  2BIB A;  3TP9 A;  1YCG A;  2BTN A;  1L9Y A;  2Q42 A;  2YNT B;  3BV6 A;  4UWP B;  4D02 A;  3X2Z A;  5KIK A;  4O98 A;  4EFZ A;  4RL0 A;  3KNS A;  3T3O A;  2Y8A A;  3PY5 A;  2QDT A;  5A87 A;  5K4M A;  2FU7 A;  5ACR A;  2FU6 A;  5HH6 A;  2BFK A;  3I0V A;  2XF4 A;  4PVO A;  4GCW A;  4UA4 A;  1WRA A;  1KO3 A;  2YZ3 A;  4HKY A;  4XUK A;  1MQO A;  3QH8 A;  3P2U A;  5ACV A;  5LCH A;  4RAW A;  2QED A;  4C1C A;  4AX1 B;  1VME A;  2DKF A;  5HIQ A;  4DIL A;  2YNU A;  5LLD A;  2Q0J A;  4ZO2 A;  3ZR9 A;  3IEK A;  5AYA A;  2DOO A;  4XWT A;  3SRX A;  4C09 A;  4NQ5 A;  5ACP A;  2BFZ A;  2BG6 A;  3RPC A;  2GFJ A;  5IQK A;  3RKJ A;  2YNT A;  2P4Z A;  2YNW A;  4EY2 A;  3SW3 A;  2BMI A;  2NZF A;  1VJN A;  3X2Y A;  1X8G A;  4GYQ A;  3IEM A;  3A4Y A;  3MD7 A;  2GFK A;  3IEL A;  2H6A A;  3IDZ A;  5FQA A;  3ZNB A;  2UYX A;  2BC2 A;  3KNR A;  4H0D A;  4D1U A;  4Z5Z A;  5ACT A;  5EVK A;  2BFL A;  4YSK A;  2P18 A;  4V0H A;  5A0V A;  3SPU A;  3ZWF A;  3ADR A;  5KIL A;  4UWO B;  5AXO A;  4FSB A;  2NYP A;  4B87 A;  4YSB A;  3DHC A;  2P97 A;  5EVD A;  4ZEJ A;  4EYF A;  2BFZ B;  4EYL A;  3PG4 A;  2A7M A;  4LE6 A;  5B15 A;  2BG2 A;  5LMC A;  2WYL A;  4Z6X A;  4HL1 A;  4NQ2 A;  4HL2 A;  2WHG A;  1ZKP A;  3DHB A;  4UWS B;  2NZE A;  5LCA A;  3I15 A;  1ZNB A;  3FCZ A;  3S0Z A;  5LS3 A;  4JO0 A;  2I7V A;  1ZTC A;  1HLK A;  4AD9 A;  5B3R A;  5ACW A;  3AF5 A;  5B1U A;  4U4L A;  1XTO A;  4C1H A;  2NXA A;  4Z5Y A;  3LVZ A;  2YCB A;  4TYF A;  4UAM A;  4UBQ A;  3AF6 A;  3I13 A;  1K07 A;  5EHT A;  4C1G A;  4RBS A;  5K4N A;  4RAM A;  2AIO A;  1QH3 A;  3G1P A;  1DDK A;  5AHR A;  4AWZ A;  2GMN A;  3VPE A;  1DXK A;  4D1W A;  3IOG A;  4DIK A;  4NQ4 A;  3T3N A;  2I7T A;  2QJS A;  3DH8 A;  3BK1 A;  3L6N A;  2OHJ A;  3SFP A;  1JJE A;  5EH9 A;  1M2X A;  5A0T A;  2GCU A;  5HIS A;  4J5H A;  3SBL A;  2ZNB A;  4P62 A;  2WYM C;  3RKK A;  2R2D A;  4YSL A;  4CHL A;  4ZNB A;  1WUO A;  2GKL A;  2HB9 A;  3IOF A;  5A5Z A;  1X8H A;  2BGA A;  4BZ3 A;  5EV6 A;  5AEB A;  4TZB A;  2YNV A;  3BK2 A;  3DHA A;  5FQC A;  3ESH A;  4GYU A;  4UWR B;  4AWY B;  1Y44 A;  3AJ3 A;  3H3E A;  4Z67 A;  2AZ4 A;  5EWA A;  4KEQ A;  3SD9 A;  1JT1 A;  5EVB A;  3KL7 A;  1YCH A;  5EV8 A;  4ZO3 A;  3I14 A;  4Z60 A;  2QIN A;  4TZF A;  2XR1 A;  5K4K A;  3BC2 A;  2CBN A;  5DPX A;  1KO2 A;  2BG8 A;  2P1E A;  5ACU A;  3IE1 A;  5FQB A;  2FU8 A;  1SML A;  3F9O A;  5LSC A;  1P9E A;  5ACS A;  4TZE A;  5ACQ A;  2QDS A;  2OHI A;  2FHX A;  2YNV B;  4TYT A;  2WYM A;  4KEP A;  3WXC A;  2Q9U A;  4C1E A;  2FK6 A;  5ACX A;  5LE1 A;  4AX0 B;  5HIO A;  1XM8 A;  2FU9 A;  3R2U A;  5AXR A;  4RM5 A;  1A8T A;  2Y87 A;  5EW0 A;  2WRS A;  2ZZI A;  3IE2 A;  5HIP A;  4EXS A;  3X2X A;  1WUP A;  4F6Z A;  5LCF A;  2BG8 B;  4C1F A;  2VW8 A;  1QH5 A;  2ZWR A;  1YCF A;  2OHH A;  4C1D A;  4TZ9 A;  4Z7R A;  1BMC A;  1E5D A;  2FHX B;  4J5F A;  1BC2 A;  4PVT A;  2M5C A;  2BG7 A;  4NQ6 A;  2E7Y A;  1BVT A;  4EXY A;  2I7X A;  4EYB A;  3IE0 A;  5AHO A;  4XWW A;  5HH5 A;  4D1V A;  1DD6 A;  1JJT A;  4WD6 A;  3T9M A;  2Y8B A;  4BP0 A;  4FEK A;  3PY6 A;  2FM6 A;  2BR6 A;  3X30 A;  4D1T A;  4FR7 A;  4RL2 A;  1X8I A;  5HH4 A;  1A7T A;  5K0W A;  5LM6 A;  3I11 A;  3JXP A;  3VQZ A;  1KR3 A;  3FAI A;  3Q6V A;  1WW1 A;  4F6H A;  3ZQ4 A; 
#chains in the Genus database with same CATH topology
 1VGN A;  2ZO4 A;  2Q0I A;  2M5D A;  2BIB A;  3TP9 A;  1YCG A;  2BTN A;  1L9Y A;  2Q42 A;  2YNT B;  4AXH A;  3BV6 A;  4UWP B;  4D02 A;  3X2Z A;  5KIK A;  4O98 A;  4EFZ A;  4RL0 A;  3KNS A;  5AIJ A;  3T3O A;  2Y8A A;  3PY5 A;  2QDT A;  5A87 A;  5K4M A;  2FU7 A;  5ACR A;  2FU6 A;  5HH6 A;  2BFK A;  3I0V A;  2XF4 A;  4PVO A;  4GCW A;  4UA4 A;  1WRA A;  2CG3 A;  1KO3 A;  2YZ3 A;  4HKY A;  4XUK A;  1MQO A;  3QH8 A;  3P2U A;  5ACV A;  5LCH A;  4RAW A;  2QED A;  4C1C A;  4AX1 B;  1VME A;  2DKF A;  5HIQ A;  4DIL A;  2YNU A;  5LLD A;  2Q0J A;  4ZO2 A;  3ZR9 A;  3IEK A;  2CFZ A;  5AYA A;  2DOO A;  4XWT A;  3SRX A;  4C09 A;  4NQ5 A;  5ACP A;  2BFZ A;  3RPC A;  2BG6 A;  2GFJ A;  5IQK A;  3RKJ A;  2YNT A;  2P4Z A;  2YNW A;  4EY2 A;  3SW3 A;  2BMI A;  2NZF A;  1VJN A;  3X2Y A;  1X8G A;  4GYQ A;  3IEM A;  3A4Y A;  3MD7 A;  2GFK A;  3IEL A;  5AJL A;  2H6A A;  3IDZ A;  5FQA A;  3ZNB A;  2UYX A;  2BC2 A;  3KNR A;  4H0D A;  4D1U A;  4Z5Z A;  5ACT A;  5EVK A;  2BFL A;  4YSK A;  2P18 A;  4V0H A;  5A0V A;  3SPU A;  3ZWF A;  3ADR A;  5KIL A;  4UWO B;  5AXO A;  4FSB A;  2NYP A;  4B87 A;  4YSB A;  3DHC A;  2P97 A;  5EVD A;  4ZEJ A;  4EYF A;  2BFZ B;  4EYL A;  3PG4 A;  2A7M A;  4LE6 A;  5B15 A;  2BG2 A;  5LMC A;  2WYL A;  4Z6X A;  4HL1 A;  4NQ2 A;  4HL2 A;  2WHG A;  1ZKP A;  3DHB A;  4UWS B;  2NZE A;  2CFU A;  5LCA A;  3I15 A;  1ZNB A;  3FCZ A;  3S0Z A;  5LS3 A;  4JO0 A;  2I7V A;  1ZTC A;  1HLK A;  4AD9 A;  5B3R A;  5ACW A;  3AF5 A;  5B1U A;  4U4L A;  4NUR A;  1XTO A;  4C1H A;  2NXA A;  4Z5Y A;  3LVZ A;  2YCB A;  4TYF A;  4UAM A;  4UBQ A;  3AF6 A;  3I13 A;  1K07 A;  5EHT A;  4C1G A;  4RBS A;  5K4N A;  4RAM A;  2AIO A;  1QH3 A;  3G1P A;  1DDK A;  5AHR A;  4AWZ A;  2GMN A;  3VPE A;  1DXK A;  4D1W A;  3IOG A;  4DIK A;  4NQ4 A;  3T3N A;  2I7T A;  2QJS A;  3DH8 A;  3BK1 A;  3L6N A;  2OHJ A;  3SFP A;  1JJE A;  5EH9 A;  1M2X A;  5A0T A;  2GCU A;  5HIS A;  4J5H A;  3SBL A;  2ZNB A;  4P62 A;  2WYM C;  3RKK A;  2R2D A;  5A23 A;  4YSL A;  4CHL A;  4ZNB A;  1WUO A;  2GKL A;  2HB9 A;  3IOF A;  5A5Z A;  1X8H A;  2BGA A;  4BZ3 A;  5EV6 A;  5AEB A;  4TZB A;  2YNV A;  3BK2 A;  3DHA A;  5FQC A;  3ESH A;  4GYU A;  4UWR B;  4AWY B;  1Y44 A;  3AJ3 A;  3H3E A;  4Z67 A;  2AZ4 A;  5EWA A;  4KEQ A;  3SD9 A;  1JT1 A;  5EVB A;  3KL7 A;  1YCH A;  5EV8 A;  4ZO3 A;  3I14 A;  4Z60 A;  2QIN A;  4AV7 A;  4TZF A;  2XR1 A;  5K4K A;  3BC2 A;  2CBN A;  5DPX A;  1KO2 A;  2CG2 A;  2BG8 A;  2P1E A;  5ACU A;  3IE1 A;  5FQB A;  2FU8 A;  1SML A;  3F9O A;  5LSC A;  1P9E A;  5ACS A;  4TZE A;  5ACQ A;  2QDS A;  2OHI A;  2FHX A;  2YNV B;  4TYT A;  2WYM A;  4KEP A;  3WXC A;  2Q9U A;  4C1E A;  4PDX A;  2FK6 A;  5ACX A;  5LE1 A;  4AX0 B;  5HIO A;  1XM8 A;  2FU9 A;  3R2U A;  5AXR A;  4RM5 A;  1A8T A;  2Y87 A;  5EW0 A;  2WRS A;  2ZZI A;  3IE2 A;  5HIP A;  4EXS A;  3X2X A;  1WUP A;  4F6Z A;  5LCF A;  2BG8 B;  4C1F A;  2VW8 A;  1QH5 A;  2ZWR A;  1YCF A;  2YHE A;  2OHH A;  4C1D A;  4TZ9 A;  4Z7R A;  1BMC A;  1E5D A;  2FHX B;  4J5F A;  1BC2 A;  4PVT A;  2M5C A;  2BG7 A;  4NQ6 A;  2E7Y A;  1BVT A;  4EXY A;  2I7X A;  4EYB A;  3IE0 A;  5AHO A;  4XWW A;  5HH5 A;  4D1V A;  1DD6 A;  1JJT A;  4WD6 A;  3T9M A;  2Y8B A;  4BP0 A;  4FEK A;  3PY6 A;  2FM6 A;  2BR6 A;  3X30 A;  4D1T A;  4FR7 A;  4RL2 A;  1X8I A;  5HH4 A;  1A7T A;  5K0W A;  5LM6 A;  3I11 A;  3JXP A;  3VQZ A;  1KR3 A;  3FAI A;  3Q6V A;  1WW1 A;  4F6H A;  3ZQ4 A; 
#chains in the Genus database with same CATH homology
 1VGN A;  2ZO4 A;  2Q0I A;  2M5D A;  2BIB A;  3TP9 A;  1YCG A;  2BTN A;  1L9Y A;  2Q42 A;  2YNT B;  3BV6 A;  4UWP B;  4D02 A;  3X2Z A;  5KIK A;  4O98 A;  4EFZ A;  4RL0 A;  3KNS A;  3T3O A;  2Y8A A;  3PY5 A;  2QDT A;  5A87 A;  5K4M A;  2FU7 A;  5ACR A;  2FU6 A;  5HH6 A;  2BFK A;  3I0V A;  2XF4 A;  4PVO A;  4GCW A;  4UA4 A;  1WRA A;  1KO3 A;  2YZ3 A;  4HKY A;  4XUK A;  1MQO A;  3QH8 A;  3P2U A;  5ACV A;  5LCH A;  4RAW A;  2QED A;  4C1C A;  4AX1 B;  1VME A;  2DKF A;  5HIQ A;  4DIL A;  2YNU A;  5LLD A;  2Q0J A;  4ZO2 A;  3ZR9 A;  3IEK A;  5AYA A;  2DOO A;  4XWT A;  3SRX A;  4C09 A;  4NQ5 A;  5ACP A;  2BFZ A;  2BG6 A;  3RPC A;  2GFJ A;  5IQK A;  3RKJ A;  2YNT A;  2P4Z A;  2YNW A;  4EY2 A;  3SW3 A;  2BMI A;  2NZF A;  1VJN A;  3X2Y A;  1X8G A;  4GYQ A;  3IEM A;  3A4Y A;  3MD7 A;  2GFK A;  3IEL A;  2H6A A;  3IDZ A;  5FQA A;  3ZNB A;  2UYX A;  2BC2 A;  3KNR A;  4H0D A;  4D1U A;  4Z5Z A;  5ACT A;  5EVK A;  2BFL A;  4YSK A;  2P18 A;  4V0H A;  5A0V A;  3SPU A;  3ZWF A;  3ADR A;  5KIL A;  4UWO B;  5AXO A;  4FSB A;  2NYP A;  4B87 A;  4YSB A;  3DHC A;  2P97 A;  5EVD A;  4ZEJ A;  4EYF A;  2BFZ B;  4EYL A;  3PG4 A;  2A7M A;  4LE6 A;  5B15 A;  2BG2 A;  5LMC A;  2WYL A;  4Z6X A;  4HL1 A;  4NQ2 A;  4HL2 A;  2WHG A;  1ZKP A;  3DHB A;  4UWS B;  2NZE A;  5LCA A;  3I15 A;  1ZNB A;  3FCZ A;  3S0Z A;  5LS3 A;  4JO0 A;  2I7V A;  1ZTC A;  1HLK A;  4AD9 A;  5B3R A;  5ACW A;  3AF5 A;  5B1U A;  4U4L A;  1XTO A;  4C1H A;  2NXA A;  4Z5Y A;  3LVZ A;  2YCB A;  4TYF A;  4UAM A;  4UBQ A;  3AF6 A;  3I13 A;  1K07 A;  5EHT A;  4C1G A;  4RBS A;  5K4N A;  4RAM A;  2AIO A;  1QH3 A;  3G1P A;  1DDK A;  5AHR A;  4AWZ A;  2GMN A;  3VPE A;  1DXK A;  4D1W A;  3IOG A;  4DIK A;  4NQ4 A;  3T3N A;  2I7T A;  2QJS A;  3DH8 A;  3BK1 A;  3L6N A;  2OHJ A;  3SFP A;  1JJE A;  5EH9 A;  1M2X A;  5A0T A;  2GCU A;  5HIS A;  4J5H A;  3SBL A;  2ZNB A;  4P62 A;  2WYM C;  3RKK A;  2R2D A;  4YSL A;  4CHL A;  4ZNB A;  1WUO A;  2GKL A;  2HB9 A;  3IOF A;  5A5Z A;  1X8H A;  2BGA A;  4BZ3 A;  5EV6 A;  5AEB A;  4TZB A;  2YNV A;  3BK2 A;  3DHA A;  5FQC A;  3ESH A;  4GYU A;  4UWR B;  4AWY B;  1Y44 A;  3AJ3 A;  3H3E A;  4Z67 A;  2AZ4 A;  5EWA A;  4KEQ A;  3SD9 A;  1JT1 A;  5EVB A;  3KL7 A;  1YCH A;  5EV8 A;  4ZO3 A;  3I14 A;  4Z60 A;  2QIN A;  4TZF A;  2XR1 A;  5K4K A;  3BC2 A;  2CBN A;  5DPX A;  1KO2 A;  2BG8 A;  2P1E A;  5ACU A;  3IE1 A;  5FQB A;  2FU8 A;  1SML A;  3F9O A;  5LSC A;  1P9E A;  5ACS A;  4TZE A;  5ACQ A;  2QDS A;  2OHI A;  2FHX A;  2YNV B;  4TYT A;  2WYM A;  4KEP A;  3WXC A;  2Q9U A;  4C1E A;  2FK6 A;  5ACX A;  5LE1 A;  4AX0 B;  5HIO A;  1XM8 A;  2FU9 A;  3R2U A;  5AXR A;  4RM5 A;  1A8T A;  2Y87 A;  5EW0 A;  2WRS A;  2ZZI A;  3IE2 A;  5HIP A;  4EXS A;  3X2X A;  1WUP A;  4F6Z A;  5LCF A;  2BG8 B;  4C1F A;  2VW8 A;  1QH5 A;  2ZWR A;  1YCF A;  2OHH A;  4C1D A;  4TZ9 A;  4Z7R A;  1BMC A;  1E5D A;  2FHX B;  4J5F A;  1BC2 A;  4PVT A;  2M5C A;  2BG7 A;  4NQ6 A;  2E7Y A;  1BVT A;  4EXY A;  2I7X A;  4EYB A;  3IE0 A;  5AHO A;  4XWW A;  5HH5 A;  4D1V A;  1DD6 A;  1JJT A;  4WD6 A;  3T9M A;  2Y8B A;  4BP0 A;  4FEK A;  3PY6 A;  2FM6 A;  2BR6 A;  3X30 A;  4D1T A;  4FR7 A;  4RL2 A;  1X8I A;  5HH4 A;  1A7T A;  5K0W A;  5LM6 A;  3I11 A;  3JXP A;  3VQZ A;  1KR3 A;  3FAI A;  3Q6V A;  1WW1 A;  4F6H A;  3ZQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...