2BR6A

Crystal structure of quorum-quenching n-acyl homoserine lactone lactonase
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
252
structure length
240
Chain Sequence
MDMTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIKTEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Molecular Structure and Catalytic Mechanism of a Quorum-Quenching N-Acyl-L-Homoserine Lactone Hydrolase.
pubmed doi rcsb
source organism Bacillus thuringiensis
molecule tags Hydrolase
molecule keywords AIIA-LIKE PROTEIN
total genus 70
structure length 240
sequence length 252
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2005-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2br6A01
2WRSA 5FQAA 3Q6VA 5EHTA 5EW0A 5HIOA 3A4YA 4D1VA 3RKJA 3VQZA 2NYPA 4UAMA 4PVOA 3ZR9A 2YNTB 2Q0JA 4C1DA 5HISA 3AJ3A 3I15A 2M5CA 5ACWA 4BP0A 3T3NA 2QEDA 1QH5A 2ZNBA 1YCHA 2YNVA 3BV6A 3SFPA 5KIKA 3FAIA 5AEBA 1WUOA 4EXYA 1ZNBA 5EH9A 3JXPA 3X30A 1A8TA 3QH8A 4NQ5A 2DOOA 4P62A 1XTOA 5B1UA 3ZNBA 4Z5YA 3SW3A 1BC2A 3DHAA 2BGAA 5LMCA 5AXRA 4V0HA 2BG7A 5A5ZA 1HLKA 4FR7A 5AHOA 4AD9A 3SD9A 4EXSA 5AYAA 2NZFA 4ZO2A 3SRXA 4EYFA 2YCBA 2BFLA 1X8IA 4UWPB 1YCFA 5FQCA 2BC2A 3I14A 2YZ3A 1M2XA 5HIQA 2WYMC 4XUKA 2BFZB 4XWTA 4KEPA 1L9YA 4HL1A 3I11A 4LE6A 3G1PA 5A0VA 2BIBA 5EVKA 4XWWA 2A7MA 4UWOB 4AX0B 5K0WA 2OHJA 4B87A 2XR1A 4JO0A 4FSBA 1DXKA 3ESHA 3KL7A 5ACRA 1VJNA 5EWAA 3KNSA 4TZ9A 2P18A 5HH6A 5ACUA 1QH3A 2NXAA 4WD6A 3X2YA 4U4LA 2I7XA 3IE1A 2GFKA 4Z7RA 2M5DA 2BG6A 2Q42A 4TYTA 4GYQA 1K07A 3R2UA 2BTNA 2GMNA 5K4MA 5ACXA 4GYUA 3DHBA 2DKFA 5HH5A 3PY6A 4J5FA 5AXOA 4EYLA 4Z6XA 5LSCA 3SPUA 2ZZIA 5K4NA 4HL2A 4TZFA 2FU7A 5ACSA 2FHXB 3TP9A 3FCZA 2NZEA 4Z67A 2I7TA 4AWZA 1DDKA 3WXCA 3ZQ4A 2BMIA 3X2XA 4D1WA 4O98A 3AF5A 4RL0A 2H6AA 4HKYA 5LCAA 4H0DA 4NQ6A 2AZ4A 1JJEA 2R2DA 1X8HA 4DILA 3AF6A 2FU6A 4FEKA 4NQ4A 1KO3A 2Y8AA 1WUPA 4UWRB 4YSBA 2OHHA 4J5HA 5EVBA 2ZO4A 5ACVA 5A0TA 1ZTCA 3BC2A 2YNVB 2BG8A 2I7VA 5B15A 3L6NA 5LS3A 1Y44A 3DHCA 5K4KA 4KEQA 4TZBA 3I0VA 4TZEA 4D1UA 4DIKA 4TYFA 5B3RA 5EV8A 2YNTA 5LLDA 5AHRA 2WYMA 2YNWA 3ZWFA 2Y8BA 5EV6A 1WW1A 1DD6A 1KO2A 4RL2A 3DH8A 3P2UA 2Y87A 3IEMA 3IDZA 1YCGA 3IEKA 2E7YA 4RAMA 3IOGA 3T9MA 4RM5A 1A7TA 2HB9A 4UBQA 2AIOA 2UYXA 2QJSA 2GKLA 4C1CA 2QDTA 1BVTA 2GCUA 2GFJA 2WHGA 4D02A 4C09A 3RKKA 2QDSA 3LVZA 1MQOA 5FQBA 1WRAA 1JT1A 4ZNBA 3X2ZA 2FHXA 1P9EA 3KNRA 4EYBA 4C1HA 4UA4A 4EY2A 2QINA 2P97A 5HIPA 4ZO3A 4YSKA 3PY5A 3IE2A 3RPCA 5ACPA 1E5DA 4C1FA 2BG2A 5DPXA 3MD7A 5IQKA 4ZEJA 1JJTA 3IE0A 2FM6A 3ADRA 2P1EA 1KR3A 4RAWA 5LM6A 2VW8A 4F6HA 4Z60A 1BMCA 2BFZA 2WYLA 1VGNA 3PG4A 1XM8A 4UWSB 2BG8B 4CHLA 3IELA 1VMEA 2OHIA 1SMLA 2Q0IA 4AWYB 5HH4A 5LCHA 4RBSA 4Z5ZA 5ACTA 2Q9UA 5EVDA 3F9OA 1ZKPA 4GCWA 5KILA 1X8GA 4C1GA 4F6ZA 2ZWRA 3I13A 4BZ3A 4PVTA 3IOFA 4YSLA 4AX1B 4EFZA 4C1EA 4NQ2A 2YNUA 5ACQA 2BFKA 3S0ZA 5A87A 2FK6A 2FU8A 5LCFA 3H3EA 4D1TA 2P4ZA 2FU9A 2XF4A 2CBNA 3T3OA 5LE1A 3VPEA 3BK2A 3BK1A 3SBLA 2BR6A
chains in the Genus database with same CATH superfamily
2WRSA 5FQAA 3Q6VA 5EHTA 5EW0A 5HIOA 3A4YA 4D1VA 3RKJA 3VQZA 2NYPA 4UAMA 4PVOA 3ZR9A 2YNTB 2CG3A 2Q0JA 4C1DA 5HISA 3AJ3A 3I15A 2M5CA 5ACWA 2CG2A 4BP0A 3T3NA 2QEDA 1QH5A 2ZNBA 1YCHA 2YNVA 3BV6A 3SFPA 5KIKA 3FAIA 5AEBA 1WUOA 4EXYA 1ZNBA 5EH9A 3JXPA 3X30A 1A8TA 3QH8A 4NQ5A 2DOOA 4P62A 1XTOA 5B1UA 3ZNBA 4Z5YA 3SW3A 1BC2A 4NURA 3DHAA 2BGAA 5LMCA 5AXRA 4V0HA 2BG7A 5A5ZA 1HLKA 4FR7A 5AHOA 4AD9A 3SD9A 4EXSA 2CFUA 5AYAA 2NZFA 4ZO2A 3SRXA 4EYFA 2YCBA 2BFLA 1X8IA 4UWPB 1YCFA 5FQCA 2BC2A 3I14A 2YZ3A 1M2XA 4AXHA 5AIJA 5HIQA 2WYMC 4XUKA 2BFZB 4XWTA 4KEPA 1L9YA 4HL1A 3I11A 4LE6A 3G1PA 5A0VA 2BIBA 5EVKA 4XWWA 2A7MA 4UWOB 4AX0B 5K0WA 2OHJA 4B87A 2XR1A 4JO0A 4FSBA 1DXKA 3ESHA 3KL7A 5ACRA 1VJNA 5EWAA 3KNSA 4TZ9A 2P18A 5HH6A 5ACUA 1QH3A 2NXAA 4WD6A 3X2YA 4U4LA 2I7XA 4AV7A 3IE1A 2GFKA 4Z7RA 2M5DA 2BG6A 2Q42A 4TYTA 4GYQA 1K07A 2YHEA 3R2UA 2BTNA 2GMNA 5K4MA 5ACXA 4GYUA 3DHBA 2DKFA 5HH5A 3PY6A 4J5FA 5AXOA 4EYLA 4Z6XA 5LSCA 3SPUA 2ZZIA 5K4NA 4HL2A 4TZFA 2FU7A 5ACSA 2FHXB 3TP9A 3FCZA 2NZEA 4Z67A 2I7TA 4AWZA 1DDKA 3WXCA 3ZQ4A 2BMIA 3X2XA 4D1WA 4O98A 3AF5A 4RL0A 2H6AA 4HKYA 5LCAA 4H0DA 4NQ6A 2AZ4A 1JJEA 2R2DA 1X8HA 4DILA 3AF6A 2FU6A 4FEKA 4NQ4A 1KO3A 2Y8AA 1WUPA 4UWRB 4YSBA 2OHHA 4J5HA 5EVBA 2ZO4A 5ACVA 5A0TA 1ZTCA 3BC2A 2YNVB 2BG8A 2I7VA 5B15A 3L6NA 5LS3A 1Y44A 3DHCA 5K4KA 4KEQA 4TZBA 3I0VA 4TZEA 4D1UA 4DIKA 4TYFA 5B3RA 5EV8A 2YNTA 5LLDA 5AHRA 2WYMA 2YNWA 3ZWFA 2Y8BA 5EV6A 1WW1A 1DD6A 1KO2A 4RL2A 3DH8A 3P2UA 2Y87A 3IEMA 3IDZA 1YCGA 3IEKA 2E7YA 4RAMA 3IOGA 3T9MA 4RM5A 1A7TA 2HB9A 4UBQA 2AIOA 2UYXA 2QJSA 2GKLA 4C1CA 2QDTA 1BVTA 2GCUA 2GFJA 2WHGA 4D02A 4C09A 3RKKA 2QDSA 3LVZA 1MQOA 5FQBA 1WRAA 1JT1A 4ZNBA 3X2ZA 2FHXA 1P9EA 3KNRA 4EYBA 4C1HA 4UA4A 4EY2A 2QINA 2P97A 5HIPA 4ZO3A 4YSKA 3PY5A 3IE2A 3RPCA 5ACPA 1E5DA 4C1FA 2BG2A 5DPXA 3MD7A 5IQKA 4ZEJA 1JJTA 3IE0A 2FM6A 3ADRA 2P1EA 1KR3A 4RAWA 5LM6A 2VW8A 4F6HA 4Z60A 1BMCA 2BFZA 2WYLA 1VGNA 3PG4A 1XM8A 4UWSB 2BG8B 4CHLA 3IELA 1VMEA 2OHIA 4PDXA 1SMLA 2Q0IA 2CFZA 4AWYB 5HH4A 5LCHA 4RBSA 4Z5ZA 5AJLA 5ACTA 2Q9UA 5EVDA 3F9OA 1ZKPA 4GCWA 5KILA 1X8GA 4C1GA 4F6ZA 2ZWRA 3I13A 4BZ3A 4PVTA 3IOFA 4YSLA 4AX1B 4EFZA 4C1EA 4NQ2A 2YNUA 5ACQA 2BFKA 3S0ZA 5A87A 2FK6A 2FU8A 5LCFA 5A23A 3H3EA 4D1TA 2P4ZA 2FU9A 2XF4A 2CBNA 3T3OA 5LE1A 3VPEA 3BK2A 3BK1A 3SBLA 2BR6A
chains in the Genus database with same CATH topology
2WRSA 5FQAA 3Q6VA 5EHTA 5EW0A 5HIOA 3A4YA 4D1VA 3RKJA 3VQZA 2NYPA 4UAMA 4PVOA 3ZR9A 2YNTB 2Q0JA 4C1DA 5HISA 3AJ3A 3I15A 2M5CA 5ACWA 4BP0A 3T3NA 2QEDA 1QH5A 2ZNBA 1YCHA 2YNVA 3BV6A 3SFPA 5KIKA 3FAIA 5AEBA 1WUOA 4EXYA 1ZNBA 5EH9A 3JXPA 3X30A 1A8TA 3QH8A 4NQ5A 2DOOA 4P62A 1XTOA 5B1UA 3ZNBA 4Z5YA 3SW3A 1BC2A 3DHAA 2BGAA 5LMCA 5AXRA 4V0HA 2BG7A 5A5ZA 1HLKA 4FR7A 5AHOA 4AD9A 3SD9A 4EXSA 5AYAA 2NZFA 4ZO2A 3SRXA 4EYFA 2YCBA 2BFLA 1X8IA 4UWPB 1YCFA 5FQCA 2BC2A 3I14A 2YZ3A 1M2XA 5HIQA 2WYMC 4XUKA 2BFZB 4XWTA 4KEPA 1L9YA 4HL1A 3I11A 4LE6A 3G1PA 5A0VA 2BIBA 5EVKA 4XWWA 2A7MA 4UWOB 4AX0B 5K0WA 2OHJA 4B87A 2XR1A 4JO0A 4FSBA 1DXKA 3ESHA 3KL7A 5ACRA 1VJNA 5EWAA 3KNSA 4TZ9A 2P18A 5HH6A 5ACUA 1QH3A 2NXAA 4WD6A 3X2YA 4U4LA 2I7XA 3IE1A 2GFKA 4Z7RA 2M5DA 2BG6A 2Q42A 4TYTA 4GYQA 1K07A 3R2UA 2BTNA 2GMNA 5K4MA 5ACXA 4GYUA 3DHBA 2DKFA 5HH5A 3PY6A 4J5FA 5AXOA 4EYLA 4Z6XA 5LSCA 3SPUA 2ZZIA 5K4NA 4HL2A 4TZFA 2FU7A 5ACSA 2FHXB 3TP9A 3FCZA 2NZEA 4Z67A 2I7TA 4AWZA 1DDKA 3WXCA 3ZQ4A 2BMIA 3X2XA 4D1WA 4O98A 3AF5A 4RL0A 2H6AA 4HKYA 5LCAA 4H0DA 4NQ6A 2AZ4A 1JJEA 2R2DA 1X8HA 4DILA 3AF6A 2FU6A 4FEKA 4NQ4A 1KO3A 2Y8AA 1WUPA 4UWRB 4YSBA 2OHHA 4J5HA 5EVBA 2ZO4A 5ACVA 5A0TA 1ZTCA 3BC2A 2YNVB 2BG8A 2I7VA 5B15A 3L6NA 5LS3A 1Y44A 3DHCA 5K4KA 4KEQA 4TZBA 3I0VA 4TZEA 4D1UA 4DIKA 4TYFA 5B3RA 5EV8A 2YNTA 5LLDA 5AHRA 2WYMA 2YNWA 3ZWFA 2Y8BA 5EV6A 1WW1A 1DD6A 1KO2A 4RL2A 3DH8A 3P2UA 2Y87A 3IEMA 3IDZA 1YCGA 3IEKA 2E7YA 4RAMA 3IOGA 3T9MA 4RM5A 1A7TA 2HB9A 4UBQA 2AIOA 2UYXA 2QJSA 2GKLA 4C1CA 2QDTA 1BVTA 2GCUA 2GFJA 2WHGA 4D02A 4C09A 3RKKA 2QDSA 3LVZA 1MQOA 5FQBA 1WRAA 1JT1A 4ZNBA 3X2ZA 2FHXA 1P9EA 3KNRA 4EYBA 4C1HA 4UA4A 4EY2A 2QINA 2P97A 5HIPA 4ZO3A 4YSKA 3PY5A 3IE2A 3RPCA 5ACPA 1E5DA 4C1FA 2BG2A 5DPXA 3MD7A 5IQKA 4ZEJA 1JJTA 3IE0A 2FM6A 3ADRA 2P1EA 1KR3A 4RAWA 5LM6A 2VW8A 4F6HA 4Z60A 1BMCA 2BFZA 2WYLA 1VGNA 3PG4A 1XM8A 4UWSB 2BG8B 4CHLA 3IELA 1VMEA 2OHIA 1SMLA 2Q0IA 4AWYB 5HH4A 5LCHA 4RBSA 4Z5ZA 5ACTA 2Q9UA 5EVDA 3F9OA 1ZKPA 4GCWA 5KILA 1X8GA 4C1GA 4F6ZA 2ZWRA 3I13A 4BZ3A 4PVTA 3IOFA 4YSLA 4AX1B 4EFZA 4C1EA 4NQ2A 2YNUA 5ACQA 2BFKA 3S0ZA 5A87A 2FK6A 2FU8A 5LCFA 3H3EA 4D1TA 2P4ZA 2FU9A 2XF4A 2CBNA 3T3OA 5LE1A 3VPEA 3BK2A 3BK1A 3SBLA 2BR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WRS A;  5FQA A;  3Q6V A;  5EHT A;  5EW0 A;  5HIO A;  3A4Y A;  4D1V A;  3RKJ A;  3VQZ A;  2NYP A;  4UAM A;  4PVO A;  3ZR9 A;  2YNT B;  2Q0J A;  4C1D A;  5HIS A;  3AJ3 A;  3I15 A;  2M5C A;  5ACW A;  4BP0 A;  3T3N A;  2QED A;  1QH5 A;  2ZNB A;  1YCH A;  2YNV A;  3BV6 A;  3SFP A;  5KIK A;  3FAI A;  5AEB A;  1WUO A;  4EXY A;  1ZNB A;  5EH9 A;  3JXP A;  3X30 A;  1A8T A;  3QH8 A;  4NQ5 A;  2DOO A;  4P62 A;  1XTO A;  5B1U A;  3ZNB A;  4Z5Y A;  3SW3 A;  1BC2 A;  3DHA A;  2BGA A;  5LMC A;  5AXR A;  4V0H A;  2BG7 A;  5A5Z A;  1HLK A;  4FR7 A;  5AHO A;  4AD9 A;  3SD9 A;  4EXS A;  5AYA A;  2NZF A;  4ZO2 A;  3SRX A;  4EYF A;  2YCB A;  2BFL A;  1X8I A;  4UWP B;  1YCF A;  5FQC A;  2BC2 A;  3I14 A;  2YZ3 A;  1M2X A;  5HIQ A;  2WYM C;  4XUK A;  2BFZ B;  4XWT A;  4KEP A;  1L9Y A;  4HL1 A;  3I11 A;  4LE6 A;  3G1P A;  5A0V A;  2BIB A;  5EVK A;  4XWW A;  2A7M A;  4UWO B;  4AX0 B;  5K0W A;  2OHJ A;  4B87 A;  2XR1 A;  4JO0 A;  4FSB A;  1DXK A;  3ESH A;  3KL7 A;  5ACR A;  1VJN A;  5EWA A;  3KNS A;  4TZ9 A;  2P18 A;  5HH6 A;  5ACU A;  1QH3 A;  2NXA A;  4WD6 A;  3X2Y A;  4U4L A;  2I7X A;  3IE1 A;  2GFK A;  4Z7R A;  2M5D A;  2BG6 A;  2Q42 A;  4TYT A;  4GYQ A;  1K07 A;  3R2U A;  2BTN A;  2GMN A;  5K4M A;  5ACX A;  4GYU A;  3DHB A;  2DKF A;  5HH5 A;  3PY6 A;  4J5F A;  5AXO A;  4EYL A;  4Z6X A;  5LSC A;  3SPU A;  2ZZI A;  5K4N A;  4HL2 A;  4TZF A;  2FU7 A;  5ACS A;  2FHX B;  3TP9 A;  3FCZ A;  2NZE A;  4Z67 A;  2I7T A;  4AWZ A;  1DDK A;  3WXC A;  3ZQ4 A;  2BMI A;  3X2X A;  4D1W A;  4O98 A;  3AF5 A;  4RL0 A;  2H6A A;  4HKY A;  5LCA A;  4H0D A;  4NQ6 A;  2AZ4 A;  1JJE A;  2R2D A;  1X8H A;  4DIL A;  3AF6 A;  2FU6 A;  4FEK A;  4NQ4 A;  1KO3 A;  2Y8A A;  1WUP A;  4UWR B;  4YSB A;  2OHH A;  4J5H A;  5EVB A;  2ZO4 A;  5ACV A;  5A0T A;  1ZTC A;  3BC2 A;  2YNV B;  2BG8 A;  2I7V A;  5B15 A;  3L6N A;  5LS3 A;  1Y44 A;  3DHC A;  5K4K A;  4KEQ A;  4TZB A;  3I0V A;  4TZE A;  4D1U A;  4DIK A;  4TYF A;  5B3R A;  5EV8 A;  2YNT A;  5LLD A;  5AHR A;  2WYM A;  2YNW A;  3ZWF A;  2Y8B A;  5EV6 A;  1WW1 A;  1DD6 A;  1KO2 A;  4RL2 A;  3DH8 A;  3P2U A;  2Y87 A;  3IEM A;  3IDZ A;  1YCG A;  3IEK A;  2E7Y A;  4RAM A;  3IOG A;  3T9M A;  4RM5 A;  1A7T A;  2HB9 A;  4UBQ A;  2AIO A;  2UYX A;  2QJS A;  2GKL A;  4C1C A;  2QDT A;  1BVT A;  2GCU A;  2GFJ A;  2WHG A;  4D02 A;  4C09 A;  3RKK A;  2QDS A;  3LVZ A;  1MQO A;  5FQB A;  1WRA A;  1JT1 A;  4ZNB A;  3X2Z A;  2FHX A;  1P9E A;  3KNR A;  4EYB A;  4C1H A;  4UA4 A;  4EY2 A;  2QIN A;  2P97 A;  5HIP A;  4ZO3 A;  4YSK A;  3PY5 A;  3IE2 A;  3RPC A;  5ACP A;  1E5D A;  4C1F A;  2BG2 A;  5DPX A;  3MD7 A;  5IQK A;  4ZEJ A;  1JJT A;  3IE0 A;  2FM6 A;  3ADR A;  2P1E A;  1KR3 A;  4RAW A;  5LM6 A;  2VW8 A;  4F6H A;  4Z60 A;  1BMC A;  2BFZ A;  2WYL A;  1VGN A;  3PG4 A;  1XM8 A;  4UWS B;  2BG8 B;  4CHL A;  3IEL A;  1VME A;  2OHI A;  1SML A;  2Q0I A;  4AWY B;  5HH4 A;  5LCH A;  4RBS A;  4Z5Z A;  5ACT A;  2Q9U A;  5EVD A;  3F9O A;  1ZKP A;  4GCW A;  5KIL A;  1X8G A;  4C1G A;  4F6Z A;  2ZWR A;  3I13 A;  4BZ3 A;  4PVT A;  3IOF A;  4YSL A;  4AX1 B;  4EFZ A;  4C1E A;  4NQ2 A;  2YNU A;  5ACQ A;  2BFK A;  3S0Z A;  5A87 A;  2FK6 A;  2FU8 A;  5LCF A;  3H3E A;  4D1T A;  2P4Z A;  2FU9 A;  2XF4 A;  2CBN A;  3T3O A;  5LE1 A;  3VPE A;  3BK2 A;  3BK1 A;  3SBL A;  2BR6 A; 
#chains in the Genus database with same CATH topology
 2WRS A;  5FQA A;  3Q6V A;  5EHT A;  5EW0 A;  5HIO A;  3A4Y A;  4D1V A;  3RKJ A;  3VQZ A;  2NYP A;  4UAM A;  4PVO A;  3ZR9 A;  2YNT B;  2CG3 A;  2Q0J A;  4C1D A;  5HIS A;  3AJ3 A;  3I15 A;  2M5C A;  5ACW A;  2CG2 A;  4BP0 A;  3T3N A;  2QED A;  1QH5 A;  2ZNB A;  1YCH A;  2YNV A;  3BV6 A;  3SFP A;  5KIK A;  3FAI A;  5AEB A;  1WUO A;  4EXY A;  1ZNB A;  5EH9 A;  3JXP A;  3X30 A;  1A8T A;  3QH8 A;  4NQ5 A;  2DOO A;  4P62 A;  1XTO A;  5B1U A;  3ZNB A;  4Z5Y A;  3SW3 A;  1BC2 A;  4NUR A;  3DHA A;  2BGA A;  5LMC A;  5AXR A;  4V0H A;  2BG7 A;  5A5Z A;  1HLK A;  4FR7 A;  5AHO A;  4AD9 A;  3SD9 A;  4EXS A;  2CFU A;  5AYA A;  2NZF A;  4ZO2 A;  3SRX A;  4EYF A;  2YCB A;  2BFL A;  1X8I A;  4UWP B;  1YCF A;  5FQC A;  2BC2 A;  3I14 A;  2YZ3 A;  1M2X A;  4AXH A;  5AIJ A;  5HIQ A;  2WYM C;  4XUK A;  2BFZ B;  4XWT A;  4KEP A;  1L9Y A;  4HL1 A;  3I11 A;  4LE6 A;  3G1P A;  5A0V A;  2BIB A;  5EVK A;  4XWW A;  2A7M A;  4UWO B;  4AX0 B;  5K0W A;  2OHJ A;  4B87 A;  2XR1 A;  4JO0 A;  4FSB A;  1DXK A;  3ESH A;  3KL7 A;  5ACR A;  1VJN A;  5EWA A;  3KNS A;  4TZ9 A;  2P18 A;  5HH6 A;  5ACU A;  1QH3 A;  2NXA A;  4WD6 A;  3X2Y A;  4U4L A;  2I7X A;  4AV7 A;  3IE1 A;  2GFK A;  4Z7R A;  2M5D A;  2BG6 A;  2Q42 A;  4TYT A;  4GYQ A;  1K07 A;  2YHE A;  3R2U A;  2BTN A;  2GMN A;  5K4M A;  5ACX A;  4GYU A;  3DHB A;  2DKF A;  5HH5 A;  3PY6 A;  4J5F A;  5AXO A;  4EYL A;  4Z6X A;  5LSC A;  3SPU A;  2ZZI A;  5K4N A;  4HL2 A;  4TZF A;  2FU7 A;  5ACS A;  2FHX B;  3TP9 A;  3FCZ A;  2NZE A;  4Z67 A;  2I7T A;  4AWZ A;  1DDK A;  3WXC A;  3ZQ4 A;  2BMI A;  3X2X A;  4D1W A;  4O98 A;  3AF5 A;  4RL0 A;  2H6A A;  4HKY A;  5LCA A;  4H0D A;  4NQ6 A;  2AZ4 A;  1JJE A;  2R2D A;  1X8H A;  4DIL A;  3AF6 A;  2FU6 A;  4FEK A;  4NQ4 A;  1KO3 A;  2Y8A A;  1WUP A;  4UWR B;  4YSB A;  2OHH A;  4J5H A;  5EVB A;  2ZO4 A;  5ACV A;  5A0T A;  1ZTC A;  3BC2 A;  2YNV B;  2BG8 A;  2I7V A;  5B15 A;  3L6N A;  5LS3 A;  1Y44 A;  3DHC A;  5K4K A;  4KEQ A;  4TZB A;  3I0V A;  4TZE A;  4D1U A;  4DIK A;  4TYF A;  5B3R A;  5EV8 A;  2YNT A;  5LLD A;  5AHR A;  2WYM A;  2YNW A;  3ZWF A;  2Y8B A;  5EV6 A;  1WW1 A;  1DD6 A;  1KO2 A;  4RL2 A;  3DH8 A;  3P2U A;  2Y87 A;  3IEM A;  3IDZ A;  1YCG A;  3IEK A;  2E7Y A;  4RAM A;  3IOG A;  3T9M A;  4RM5 A;  1A7T A;  2HB9 A;  4UBQ A;  2AIO A;  2UYX A;  2QJS A;  2GKL A;  4C1C A;  2QDT A;  1BVT A;  2GCU A;  2GFJ A;  2WHG A;  4D02 A;  4C09 A;  3RKK A;  2QDS A;  3LVZ A;  1MQO A;  5FQB A;  1WRA A;  1JT1 A;  4ZNB A;  3X2Z A;  2FHX A;  1P9E A;  3KNR A;  4EYB A;  4C1H A;  4UA4 A;  4EY2 A;  2QIN A;  2P97 A;  5HIP A;  4ZO3 A;  4YSK A;  3PY5 A;  3IE2 A;  3RPC A;  5ACP A;  1E5D A;  4C1F A;  2BG2 A;  5DPX A;  3MD7 A;  5IQK A;  4ZEJ A;  1JJT A;  3IE0 A;  2FM6 A;  3ADR A;  2P1E A;  1KR3 A;  4RAW A;  5LM6 A;  2VW8 A;  4F6H A;  4Z60 A;  1BMC A;  2BFZ A;  2WYL A;  1VGN A;  3PG4 A;  1XM8 A;  4UWS B;  2BG8 B;  4CHL A;  3IEL A;  1VME A;  2OHI A;  4PDX A;  1SML A;  2Q0I A;  2CFZ A;  4AWY B;  5HH4 A;  5LCH A;  4RBS A;  4Z5Z A;  5AJL A;  5ACT A;  2Q9U A;  5EVD A;  3F9O A;  1ZKP A;  4GCW A;  5KIL A;  1X8G A;  4C1G A;  4F6Z A;  2ZWR A;  3I13 A;  4BZ3 A;  4PVT A;  3IOF A;  4YSL A;  4AX1 B;  4EFZ A;  4C1E A;  4NQ2 A;  2YNU A;  5ACQ A;  2BFK A;  3S0Z A;  5A87 A;  2FK6 A;  2FU8 A;  5LCF A;  5A23 A;  3H3E A;  4D1T A;  2P4Z A;  2FU9 A;  2XF4 A;  2CBN A;  3T3O A;  5LE1 A;  3VPE A;  3BK2 A;  3BK1 A;  3SBL A;  2BR6 A; 
#chains in the Genus database with same CATH homology
 2WRS A;  5FQA A;  3Q6V A;  5EHT A;  5EW0 A;  5HIO A;  3A4Y A;  4D1V A;  3RKJ A;  3VQZ A;  2NYP A;  4UAM A;  4PVO A;  3ZR9 A;  2YNT B;  2Q0J A;  4C1D A;  5HIS A;  3AJ3 A;  3I15 A;  2M5C A;  5ACW A;  4BP0 A;  3T3N A;  2QED A;  1QH5 A;  2ZNB A;  1YCH A;  2YNV A;  3BV6 A;  3SFP A;  5KIK A;  3FAI A;  5AEB A;  1WUO A;  4EXY A;  1ZNB A;  5EH9 A;  3JXP A;  3X30 A;  1A8T A;  3QH8 A;  4NQ5 A;  2DOO A;  4P62 A;  1XTO A;  5B1U A;  3ZNB A;  4Z5Y A;  3SW3 A;  1BC2 A;  3DHA A;  2BGA A;  5LMC A;  5AXR A;  4V0H A;  2BG7 A;  5A5Z A;  1HLK A;  4FR7 A;  5AHO A;  4AD9 A;  3SD9 A;  4EXS A;  5AYA A;  2NZF A;  4ZO2 A;  3SRX A;  4EYF A;  2YCB A;  2BFL A;  1X8I A;  4UWP B;  1YCF A;  5FQC A;  2BC2 A;  3I14 A;  2YZ3 A;  1M2X A;  5HIQ A;  2WYM C;  4XUK A;  2BFZ B;  4XWT A;  4KEP A;  1L9Y A;  4HL1 A;  3I11 A;  4LE6 A;  3G1P A;  5A0V A;  2BIB A;  5EVK A;  4XWW A;  2A7M A;  4UWO B;  4AX0 B;  5K0W A;  2OHJ A;  4B87 A;  2XR1 A;  4JO0 A;  4FSB A;  1DXK A;  3ESH A;  3KL7 A;  5ACR A;  1VJN A;  5EWA A;  3KNS A;  4TZ9 A;  2P18 A;  5HH6 A;  5ACU A;  1QH3 A;  2NXA A;  4WD6 A;  3X2Y A;  4U4L A;  2I7X A;  3IE1 A;  2GFK A;  4Z7R A;  2M5D A;  2BG6 A;  2Q42 A;  4TYT A;  4GYQ A;  1K07 A;  3R2U A;  2BTN A;  2GMN A;  5K4M A;  5ACX A;  4GYU A;  3DHB A;  2DKF A;  5HH5 A;  3PY6 A;  4J5F A;  5AXO A;  4EYL A;  4Z6X A;  5LSC A;  3SPU A;  2ZZI A;  5K4N A;  4HL2 A;  4TZF A;  2FU7 A;  5ACS A;  2FHX B;  3TP9 A;  3FCZ A;  2NZE A;  4Z67 A;  2I7T A;  4AWZ A;  1DDK A;  3WXC A;  3ZQ4 A;  2BMI A;  3X2X A;  4D1W A;  4O98 A;  3AF5 A;  4RL0 A;  2H6A A;  4HKY A;  5LCA A;  4H0D A;  4NQ6 A;  2AZ4 A;  1JJE A;  2R2D A;  1X8H A;  4DIL A;  3AF6 A;  2FU6 A;  4FEK A;  4NQ4 A;  1KO3 A;  2Y8A A;  1WUP A;  4UWR B;  4YSB A;  2OHH A;  4J5H A;  5EVB A;  2ZO4 A;  5ACV A;  5A0T A;  1ZTC A;  3BC2 A;  2YNV B;  2BG8 A;  2I7V A;  5B15 A;  3L6N A;  5LS3 A;  1Y44 A;  3DHC A;  5K4K A;  4KEQ A;  4TZB A;  3I0V A;  4TZE A;  4D1U A;  4DIK A;  4TYF A;  5B3R A;  5EV8 A;  2YNT A;  5LLD A;  5AHR A;  2WYM A;  2YNW A;  3ZWF A;  2Y8B A;  5EV6 A;  1WW1 A;  1DD6 A;  1KO2 A;  4RL2 A;  3DH8 A;  3P2U A;  2Y87 A;  3IEM A;  3IDZ A;  1YCG A;  3IEK A;  2E7Y A;  4RAM A;  3IOG A;  3T9M A;  4RM5 A;  1A7T A;  2HB9 A;  4UBQ A;  2AIO A;  2UYX A;  2QJS A;  2GKL A;  4C1C A;  2QDT A;  1BVT A;  2GCU A;  2GFJ A;  2WHG A;  4D02 A;  4C09 A;  3RKK A;  2QDS A;  3LVZ A;  1MQO A;  5FQB A;  1WRA A;  1JT1 A;  4ZNB A;  3X2Z A;  2FHX A;  1P9E A;  3KNR A;  4EYB A;  4C1H A;  4UA4 A;  4EY2 A;  2QIN A;  2P97 A;  5HIP A;  4ZO3 A;  4YSK A;  3PY5 A;  3IE2 A;  3RPC A;  5ACP A;  1E5D A;  4C1F A;  2BG2 A;  5DPX A;  3MD7 A;  5IQK A;  4ZEJ A;  1JJT A;  3IE0 A;  2FM6 A;  3ADR A;  2P1E A;  1KR3 A;  4RAW A;  5LM6 A;  2VW8 A;  4F6H A;  4Z60 A;  1BMC A;  2BFZ A;  2WYL A;  1VGN A;  3PG4 A;  1XM8 A;  4UWS B;  2BG8 B;  4CHL A;  3IEL A;  1VME A;  2OHI A;  1SML A;  2Q0I A;  4AWY B;  5HH4 A;  5LCH A;  4RBS A;  4Z5Z A;  5ACT A;  2Q9U A;  5EVD A;  3F9O A;  1ZKP A;  4GCW A;  5KIL A;  1X8G A;  4C1G A;  4F6Z A;  2ZWR A;  3I13 A;  4BZ3 A;  4PVT A;  3IOF A;  4YSL A;  4AX1 B;  4EFZ A;  4C1E A;  4NQ2 A;  2YNU A;  5ACQ A;  2BFK A;  3S0Z A;  5A87 A;  2FK6 A;  2FU8 A;  5LCF A;  3H3E A;  4D1T A;  2P4Z A;  2FU9 A;  2XF4 A;  2CBN A;  3T3O A;  5LE1 A;  3VPE A;  3BK2 A;  3BK1 A;  3SBL A;  2BR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...