2BR6A

Crystal structure of quorum-quenching n-acyl homoserine lactone lactonase
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
252
structure length
240
Chain Sequence
MDMTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIKTEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords AIIA-LIKE PROTEIN
publication title The Molecular Structure and Catalytic Mechanism of a Quorum-Quenching N-Acyl-L-Homoserine Lactone Hydrolase.
pubmed doi rcsb
source organism Bacillus thuringiensis
total genus 70
structure length 240
sequence length 252
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2005-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2br6A01
2BFZB 3I13A 4FSBA 4DILA 5AYAA 3SBLA 3QH8A 4UWRB 3P2UA 3X2YA 5HH6A 4FEKA 4EXSA 5LLDA 4UWPB 2NZEA 2GMNA 5AEBA 3PY6A 3SPUA 2Q9UA 4AWYB 4TZFA 2GCUA 3PG4A 3T9MA 5A87A 4TZBA 4Z60A 2OHJA 5KILA 5ACPA 5HISA 2AIOA 2FU9A 1JJTA 3SFPA 4Z5ZA 4XWTA 4EFZA 3ADRA 2YNUA 5HH4A 2M5CA 5EVDA 5EVBA 3IOFA 3X2ZA 3BV6A 1WW1A 1VMEA 4UWSB 1X8HA 5A0VA 1WUPA 4BZ3A 2YNTB 4EYLA 3PY5A 2YNTA 3BK2A 3SRXA 3DH8A 4GYQA 2I7TA 5HIQA 3IDZA 3DHAA 3ZQ4A 5K4MA 4P62A 3SW3A 2WRSA 4LE6A 5ACXA 4C1HA 5K0WA 2WYMA 2YNVB 5FQBA 2YNVA 3I15A 1DXKA 4AWZA 1WUOA 4D1UA 1VJNA 2XR1A 2ZWRA 3IE1A 4NQ5A 5DPXA 4F6ZA 2QJSA 5EHTA 4RM5A 4AX1B 2QDTA 2BG8A 2NYPA 3DHBA 4UBQA 2OHHA 3R2UA 4PVTA 1KR3A 4RAMA 2BIBA 1BVTA 2Q0JA 2DKFA 2ZNBA 2ZZIA 4TZEA 2FK6A 3IEKA 3T3OA 4C1CA 3IE2A 4ZEJA 3BK1A 4NQ6A 4EYBA 4RAWA 4D1WA 5ACQA 2FU7A 3IE0A 2Y8AA 3AJ3A 4UWOB 4AX0B 2ZO4A 4B87A 4H0DA 4GCWA 5K4NA 3IEMA 2VW8A 4C09A 2HB9A 4TYTA 5ACTA 1DD6A 1QH3A 4D1VA 2FU8A 3AF5A 5HIOA 4XUKA 2P4ZA 5ACSA 4HL1A 5B1UA 5LM6A 2OHIA 5EH9A 4Z5YA 3ZNBA 2GFKA 1XTOA 3IOGA 4JO0A 5LE1A 5AXOA 5EW0A 4Z7RA 1QH5A 4C1EA 2I7VA 4EY2A 1KO2A 4RL0A 3ESHA 2E7YA 2I7XA 3RKKA 1P9EA 3VPEA 2BC2A 3FAIA 4ZO3A 4C1DA 4DIKA 2QEDA 5IQKA 2H6AA 2A7MA 3H3EA 4FR7A 1DDKA 2YNWA 4V0HA 3I14A 3F9OA 2WYLA 2QINA 5AHOA 2DOOA 4NQ2A 3I0VA 2GFJA 5EWAA 5AXRA 4C1FA 2AZ4A 4O98A 4Z6XA 3FCZA 4D02A 3KNSA 2BG8B 3JXPA 1JJEA 2BG2A 5LS3A 4ZNBA 3L6NA 5ACWA 5LMCA 4HKYA 4EYFA 4C1GA 3AF6A 5EV6A 4YSBA 1VGNA 2P18A 2BMIA 2GKLA 4J5HA 3MD7A 5EVKA 2BG7A 4KEQA 1MQOA 4J5FA 3RKJA 2FU6A 4U4LA 5LCHA 3T3NA 4YSKA 2YCBA 3SD9A 2FHXB 2BFZA 1A7TA 2UYXA 4TYFA 2FHXA 3LVZA 5HIPA 4F6HA 4UAMA 3BC2A 4GYUA 3TP9A 4RBSA 2BTNA 3ZWFA 1K07A 5LCAA 1Y44A 2BFKA 3X2XA 3RPCA 4PVOA 4RL2A 1YCGA 3KL7A 4CHLA 3WXCA 1YCHA 1JT1A 4WD6A 1YCFA 5EV8A 1BC2A 5A0TA 1SMLA 2BFLA 4Z67A 2BR6A 1WRAA 2BGAA 2WHGA 1X8GA 2NXAA 2P97A 2P1EA 1L9YA 3VQZA 1HLKA 4AD9A 4D1TA 2M5DA 5ACUA 1BMCA 5ACRA 1A8TA 3A4YA 3I11A 4TZ9A 4KEPA 1E5DA 4ZO2A 5K4KA 2BG6A 5B15A 4XWWA 1ZTCA 2QDSA 2Q42A 2WYMC 5LCFA 2FM6A 2CBNA 4YSLA 5HH5A 3IELA 3G1PA 4HL2A 3ZR9A 5FQAA 1ZNBA 2XF4A 3X30A 4UA4A 2Y87A 4EXYA 4NQ4A 4BP0A 1KO3A 3KNRA 1M2XA 5B3RA 5ACVA 2NZFA 2R2DA 1XM8A 5A5ZA 3DHCA 3S0ZA 5LSCA 3Q6VA 5KIKA 1ZKPA 2YZ3A 2Y8BA 5AHRA 2Q0IA 5FQCA 1X8IA
chains in the Genus database with same CATH superfamily
2BFZB 3I13A 4FSBA 4DILA 5AYAA 3SBLA 3QH8A 4UWRB 3P2UA 3X2YA 5HH6A 4FEKA 4EXSA 5LLDA 4UWPB 2NZEA 2GMNA 5AEBA 3PY6A 3SPUA 2Q9UA 4AWYB 4TZFA 2GCUA 3PG4A 3T9MA 5A87A 4TZBA 4Z60A 2OHJA 5KILA 5ACPA 5HISA 2AIOA 2FU9A 1JJTA 3SFPA 4Z5ZA 4XWTA 4EFZA 3ADRA 2YNUA 5HH4A 2M5CA 5EVDA 5EVBA 3IOFA 3X2ZA 3BV6A 1WW1A 1VMEA 4UWSB 1X8HA 5A0VA 1WUPA 4BZ3A 2YNTB 4EYLA 3PY5A 2YNTA 3BK2A 3SRXA 3DH8A 4GYQA 2I7TA 5HIQA 3IDZA 3DHAA 3ZQ4A 5K4MA 4P62A 3SW3A 2WRSA 4LE6A 5ACXA 4C1HA 5K0WA 2WYMA 2YNVB 5FQBA 2YNVA 3I15A 1DXKA 4AWZA 1WUOA 4D1UA 1VJNA 2XR1A 2ZWRA 3IE1A 4NQ5A 5DPXA 4F6ZA 2CFZA 2QJSA 5EHTA 4RM5A 4AX1B 2QDTA 2BG8A 2NYPA 3DHBA 4UBQA 2OHHA 3R2UA 4PVTA 1KR3A 4RAMA 2BIBA 2CG3A 1BVTA 2Q0JA 2DKFA 2ZNBA 2ZZIA 4TZEA 2FK6A 3IEKA 4PDXA 3T3OA 4C1CA 3IE2A 4AV7A 4ZEJA 3BK1A 4NQ6A 4EYBA 4RAWA 4D1WA 5ACQA 2FU7A 3IE0A 2Y8AA 3AJ3A 4UWOB 4AX0B 2ZO4A 4B87A 4H0DA 4GCWA 5K4NA 3IEMA 2VW8A 4C09A 2HB9A 4TYTA 5ACTA 1DD6A 1QH3A 4D1VA 2FU8A 3AF5A 5HIOA 4XUKA 2P4ZA 5ACSA 4HL1A 5B1UA 5A23A 5LM6A 2OHIA 5EH9A 4Z5YA 3ZNBA 2GFKA 1XTOA 3IOGA 4JO0A 5LE1A 5AXOA 5EW0A 4Z7RA 1QH5A 4C1EA 2I7VA 4EY2A 1KO2A 4RL0A 3ESHA 2E7YA 2I7XA 3RKKA 1P9EA 3VPEA 2BC2A 3FAIA 4ZO3A 4C1DA 4DIKA 2QEDA 5IQKA 2H6AA 2A7MA 3H3EA 4FR7A 1DDKA 4V0HA 2YNWA 3I14A 3F9OA 2WYLA 2QINA 5AHOA 2DOOA 4NQ2A 3I0VA 2GFJA 5EWAA 5AXRA 4C1FA 2AZ4A 4O98A 4Z6XA 3FCZA 4D02A 3KNSA 2BG8B 3JXPA 1JJEA 2BG2A 5LS3A 4ZNBA 3L6NA 5ACWA 5LMCA 4HKYA 4EYFA 4C1GA 3AF6A 5EV6A 4YSBA 1VGNA 2P18A 2BMIA 2GKLA 4J5HA 3MD7A 5EVKA 2BG7A 4KEQA 1MQOA 4J5FA 3RKJA 2FU6A 4U4LA 5LCHA 3T3NA 4YSKA 2YCBA 3SD9A 2FHXB 2BFZA 1A7TA 2UYXA 4TYFA 2FHXA 5AJLA 3LVZA 5HIPA 4F6HA 4UAMA 3BC2A 4GYUA 3TP9A 4RBSA 2BTNA 3ZWFA 1K07A 5LCAA 1Y44A 2BFKA 3X2XA 3RPCA 4PVOA 4RL2A 2YHEA 1YCGA 3KL7A 4CHLA 3WXCA 1YCHA 1JT1A 4WD6A 1YCFA 5EV8A 1BC2A 5A0TA 1SMLA 2BFLA 4Z67A 4AXHA 2BR6A 1WRAA 2BGAA 2CG2A 2WHGA 1X8GA 2NXAA 2P97A 2P1EA 1L9YA 3VQZA 1HLKA 4AD9A 4D1TA 2M5DA 5ACUA 1BMCA 5ACRA 1A8TA 3A4YA 3I11A 4TZ9A 4KEPA 1E5DA 4ZO2A 5K4KA 2BG6A 5B15A 4XWWA 1ZTCA 2QDSA 2Q42A 2WYMC 5LCFA 2FM6A 2CBNA 4YSLA 5HH5A 3IELA 3G1PA 4HL2A 3ZR9A 5FQAA 1ZNBA 2XF4A 3X30A 4UA4A 2Y87A 4EXYA 4NQ4A 2CFUA 4BP0A 1KO3A 3KNRA 1M2XA 5B3RA 5ACVA 2NZFA 2R2DA 1XM8A 5A5ZA 3DHCA 3S0ZA 5LSCA 3Q6VA 4NURA 5KIKA 1ZKPA 2YZ3A 2Y8BA 5AHRA 2Q0IA 5FQCA 1X8IA 5AIJA
chains in the Genus database with same CATH topology
2BFZB 3I13A 4FSBA 4DILA 5AYAA 3SBLA 3QH8A 4UWRB 3P2UA 3X2YA 5HH6A 4FEKA 4EXSA 5LLDA 4UWPB 2NZEA 2GMNA 5AEBA 3PY6A 3SPUA 2Q9UA 4AWYB 4TZFA 2GCUA 3PG4A 3T9MA 5A87A 4TZBA 4Z60A 2OHJA 5KILA 5ACPA 5HISA 2AIOA 2FU9A 1JJTA 3SFPA 4Z5ZA 4XWTA 4EFZA 3ADRA 2YNUA 5HH4A 2M5CA 5EVDA 5EVBA 3IOFA 3X2ZA 3BV6A 1WW1A 1VMEA 4UWSB 1X8HA 5A0VA 1WUPA 4BZ3A 2YNTB 4EYLA 3PY5A 2YNTA 3BK2A 3SRXA 3DH8A 4GYQA 2I7TA 5HIQA 3IDZA 3DHAA 3ZQ4A 5K4MA 4P62A 3SW3A 2WRSA 4LE6A 5ACXA 4C1HA 5K0WA 2WYMA 2YNVB 5FQBA 2YNVA 3I15A 1DXKA 4AWZA 1WUOA 4D1UA 1VJNA 2XR1A 2ZWRA 3IE1A 4NQ5A 5DPXA 4F6ZA 2QJSA 5EHTA 4RM5A 4AX1B 2QDTA 2BG8A 2NYPA 3DHBA 4UBQA 2OHHA 3R2UA 4PVTA 1KR3A 4RAMA 2BIBA 1BVTA 2Q0JA 2DKFA 2ZNBA 2ZZIA 4TZEA 2FK6A 3IEKA 3T3OA 4C1CA 3IE2A 4ZEJA 3BK1A 4NQ6A 4EYBA 4RAWA 4D1WA 5ACQA 2FU7A 3IE0A 2Y8AA 3AJ3A 4UWOB 4AX0B 2ZO4A 4B87A 4H0DA 4GCWA 5K4NA 3IEMA 2VW8A 4C09A 2HB9A 4TYTA 5ACTA 1DD6A 1QH3A 4D1VA 2FU8A 3AF5A 5HIOA 4XUKA 2P4ZA 5ACSA 4HL1A 5B1UA 5LM6A 2OHIA 5EH9A 4Z5YA 3ZNBA 2GFKA 1XTOA 3IOGA 4JO0A 5LE1A 5AXOA 5EW0A 4Z7RA 1QH5A 4C1EA 2I7VA 4EY2A 1KO2A 4RL0A 3ESHA 2E7YA 2I7XA 3RKKA 1P9EA 3VPEA 2BC2A 3FAIA 4ZO3A 4C1DA 4DIKA 2QEDA 5IQKA 2H6AA 2A7MA 3H3EA 4FR7A 1DDKA 2YNWA 4V0HA 3I14A 3F9OA 2WYLA 2QINA 5AHOA 2DOOA 4NQ2A 3I0VA 2GFJA 5EWAA 5AXRA 4C1FA 2AZ4A 4O98A 4Z6XA 3FCZA 4D02A 3KNSA 2BG8B 3JXPA 1JJEA 2BG2A 5LS3A 4ZNBA 3L6NA 5ACWA 5LMCA 4HKYA 4EYFA 4C1GA 3AF6A 5EV6A 4YSBA 1VGNA 2P18A 2BMIA 2GKLA 4J5HA 3MD7A 5EVKA 2BG7A 4KEQA 1MQOA 4J5FA 3RKJA 2FU6A 4U4LA 5LCHA 3T3NA 4YSKA 2YCBA 3SD9A 2FHXB 2BFZA 1A7TA 2UYXA 4TYFA 2FHXA 3LVZA 5HIPA 4F6HA 4UAMA 3BC2A 4GYUA 3TP9A 4RBSA 2BTNA 3ZWFA 1K07A 5LCAA 1Y44A 2BFKA 3X2XA 3RPCA 4PVOA 4RL2A 1YCGA 3KL7A 4CHLA 3WXCA 1YCHA 1JT1A 4WD6A 1YCFA 5EV8A 1BC2A 5A0TA 1SMLA 2BFLA 4Z67A 2BR6A 1WRAA 2BGAA 2WHGA 1X8GA 2NXAA 2P97A 2P1EA 1L9YA 3VQZA 1HLKA 4AD9A 4D1TA 2M5DA 5ACUA 1BMCA 5ACRA 1A8TA 3A4YA 3I11A 4TZ9A 4KEPA 1E5DA 4ZO2A 5K4KA 2BG6A 5B15A 4XWWA 1ZTCA 2QDSA 2Q42A 2WYMC 5LCFA 2FM6A 2CBNA 4YSLA 5HH5A 3IELA 3G1PA 4HL2A 3ZR9A 5FQAA 1ZNBA 2XF4A 3X30A 4UA4A 2Y87A 4EXYA 4NQ4A 4BP0A 1KO3A 3KNRA 1M2XA 5B3RA 5ACVA 2NZFA 2R2DA 1XM8A 5A5ZA 3DHCA 3S0ZA 5LSCA 3Q6VA 5KIKA 1ZKPA 2YZ3A 2Y8BA 5AHRA 2Q0IA 5FQCA 1X8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BFZ B;  3I13 A;  4FSB A;  4DIL A;  5AYA A;  3SBL A;  3QH8 A;  4UWR B;  3P2U A;  3X2Y A;  5HH6 A;  4FEK A;  4EXS A;  5LLD A;  4UWP B;  2NZE A;  2GMN A;  5AEB A;  3PY6 A;  3SPU A;  2Q9U A;  4AWY B;  4TZF A;  2GCU A;  3PG4 A;  3T9M A;  5A87 A;  4TZB A;  4Z60 A;  2OHJ A;  5KIL A;  5ACP A;  5HIS A;  2AIO A;  2FU9 A;  1JJT A;  3SFP A;  4Z5Z A;  4XWT A;  4EFZ A;  3ADR A;  2YNU A;  5HH4 A;  2M5C A;  5EVD A;  5EVB A;  3IOF A;  3X2Z A;  3BV6 A;  1WW1 A;  1VME A;  4UWS B;  1X8H A;  5A0V A;  1WUP A;  4BZ3 A;  2YNT B;  4EYL A;  3PY5 A;  2YNT A;  3BK2 A;  3SRX A;  3DH8 A;  4GYQ A;  2I7T A;  5HIQ A;  3IDZ A;  3DHA A;  3ZQ4 A;  5K4M A;  4P62 A;  3SW3 A;  2WRS A;  4LE6 A;  5ACX A;  4C1H A;  5K0W A;  2WYM A;  2YNV B;  5FQB A;  2YNV A;  3I15 A;  1DXK A;  4AWZ A;  1WUO A;  4D1U A;  1VJN A;  2XR1 A;  2ZWR A;  3IE1 A;  4NQ5 A;  5DPX A;  4F6Z A;  2QJS A;  5EHT A;  4RM5 A;  4AX1 B;  2QDT A;  2BG8 A;  2NYP A;  3DHB A;  4UBQ A;  2OHH A;  3R2U A;  4PVT A;  1KR3 A;  4RAM A;  2BIB A;  1BVT A;  2Q0J A;  2DKF A;  2ZNB A;  2ZZI A;  4TZE A;  2FK6 A;  3IEK A;  3T3O A;  4C1C A;  3IE2 A;  4ZEJ A;  3BK1 A;  4NQ6 A;  4EYB A;  4RAW A;  4D1W A;  5ACQ A;  2FU7 A;  3IE0 A;  2Y8A A;  3AJ3 A;  4UWO B;  4AX0 B;  2ZO4 A;  4B87 A;  4H0D A;  4GCW A;  5K4N A;  3IEM A;  2VW8 A;  4C09 A;  2HB9 A;  4TYT A;  5ACT A;  1DD6 A;  1QH3 A;  4D1V A;  2FU8 A;  3AF5 A;  5HIO A;  4XUK A;  2P4Z A;  5ACS A;  4HL1 A;  5B1U A;  5LM6 A;  2OHI A;  5EH9 A;  4Z5Y A;  3ZNB A;  2GFK A;  1XTO A;  3IOG A;  4JO0 A;  5LE1 A;  5AXO A;  5EW0 A;  4Z7R A;  1QH5 A;  4C1E A;  2I7V A;  4EY2 A;  1KO2 A;  4RL0 A;  3ESH A;  2E7Y A;  2I7X A;  3RKK A;  1P9E A;  3VPE A;  2BC2 A;  3FAI A;  4ZO3 A;  4C1D A;  4DIK A;  2QED A;  5IQK A;  2H6A A;  2A7M A;  3H3E A;  4FR7 A;  1DDK A;  2YNW A;  4V0H A;  3I14 A;  3F9O A;  2WYL A;  2QIN A;  5AHO A;  2DOO A;  4NQ2 A;  3I0V A;  2GFJ A;  5EWA A;  5AXR A;  4C1F A;  2AZ4 A;  4O98 A;  4Z6X A;  3FCZ A;  4D02 A;  3KNS A;  2BG8 B;  3JXP A;  1JJE A;  2BG2 A;  5LS3 A;  4ZNB A;  3L6N A;  5ACW A;  5LMC A;  4HKY A;  4EYF A;  4C1G A;  3AF6 A;  5EV6 A;  4YSB A;  1VGN A;  2P18 A;  2BMI A;  2GKL A;  4J5H A;  3MD7 A;  5EVK A;  2BG7 A;  4KEQ A;  1MQO A;  4J5F A;  3RKJ A;  2FU6 A;  4U4L A;  5LCH A;  3T3N A;  4YSK A;  2YCB A;  3SD9 A;  2FHX B;  2BFZ A;  1A7T A;  2UYX A;  4TYF A;  2FHX A;  3LVZ A;  5HIP A;  4F6H A;  4UAM A;  3BC2 A;  4GYU A;  3TP9 A;  4RBS A;  2BTN A;  3ZWF A;  1K07 A;  5LCA A;  1Y44 A;  2BFK A;  3X2X A;  3RPC A;  4PVO A;  4RL2 A;  1YCG A;  3KL7 A;  4CHL A;  3WXC A;  1YCH A;  1JT1 A;  4WD6 A;  1YCF A;  5EV8 A;  1BC2 A;  5A0T A;  1SML A;  2BFL A;  4Z67 A;  2BR6 A;  1WRA A;  2BGA A;  2WHG A;  1X8G A;  2NXA A;  2P97 A;  2P1E A;  1L9Y A;  3VQZ A;  1HLK A;  4AD9 A;  4D1T A;  2M5D A;  5ACU A;  1BMC A;  5ACR A;  1A8T A;  3A4Y A;  3I11 A;  4TZ9 A;  4KEP A;  1E5D A;  4ZO2 A;  5K4K A;  2BG6 A;  5B15 A;  4XWW A;  1ZTC A;  2QDS A;  2Q42 A;  2WYM C;  5LCF A;  2FM6 A;  2CBN A;  4YSL A;  5HH5 A;  3IEL A;  3G1P A;  4HL2 A;  3ZR9 A;  5FQA A;  1ZNB A;  2XF4 A;  3X30 A;  4UA4 A;  2Y87 A;  4EXY A;  4NQ4 A;  4BP0 A;  1KO3 A;  3KNR A;  1M2X A;  5B3R A;  5ACV A;  2NZF A;  2R2D A;  1XM8 A;  5A5Z A;  3DHC A;  3S0Z A;  5LSC A;  3Q6V A;  5KIK A;  1ZKP A;  2YZ3 A;  2Y8B A;  5AHR A;  2Q0I A;  5FQC A;  1X8I A; 
#chains in the Genus database with same CATH topology
 2BFZ B;  3I13 A;  4FSB A;  4DIL A;  5AYA A;  3SBL A;  3QH8 A;  4UWR B;  3P2U A;  3X2Y A;  5HH6 A;  4FEK A;  4EXS A;  5LLD A;  4UWP B;  2NZE A;  2GMN A;  5AEB A;  3PY6 A;  3SPU A;  2Q9U A;  4AWY B;  4TZF A;  2GCU A;  3PG4 A;  3T9M A;  5A87 A;  4TZB A;  4Z60 A;  2OHJ A;  5KIL A;  5ACP A;  5HIS A;  2AIO A;  2FU9 A;  1JJT A;  3SFP A;  4Z5Z A;  4XWT A;  4EFZ A;  3ADR A;  2YNU A;  5HH4 A;  2M5C A;  5EVD A;  5EVB A;  3IOF A;  3X2Z A;  3BV6 A;  1WW1 A;  1VME A;  4UWS B;  1X8H A;  5A0V A;  1WUP A;  4BZ3 A;  2YNT B;  4EYL A;  3PY5 A;  2YNT A;  3BK2 A;  3SRX A;  3DH8 A;  4GYQ A;  2I7T A;  5HIQ A;  3IDZ A;  3DHA A;  3ZQ4 A;  5K4M A;  4P62 A;  3SW3 A;  2WRS A;  4LE6 A;  5ACX A;  4C1H A;  5K0W A;  2WYM A;  2YNV B;  5FQB A;  2YNV A;  3I15 A;  1DXK A;  4AWZ A;  1WUO A;  4D1U A;  1VJN A;  2XR1 A;  2ZWR A;  3IE1 A;  4NQ5 A;  5DPX A;  4F6Z A;  2CFZ A;  2QJS A;  5EHT A;  4RM5 A;  4AX1 B;  2QDT A;  2BG8 A;  2NYP A;  3DHB A;  4UBQ A;  2OHH A;  3R2U A;  4PVT A;  1KR3 A;  4RAM A;  2BIB A;  2CG3 A;  1BVT A;  2Q0J A;  2DKF A;  2ZNB A;  2ZZI A;  4TZE A;  2FK6 A;  3IEK A;  4PDX A;  3T3O A;  4C1C A;  3IE2 A;  4AV7 A;  4ZEJ A;  3BK1 A;  4NQ6 A;  4EYB A;  4RAW A;  4D1W A;  5ACQ A;  2FU7 A;  3IE0 A;  2Y8A A;  3AJ3 A;  4UWO B;  4AX0 B;  2ZO4 A;  4B87 A;  4H0D A;  4GCW A;  5K4N A;  3IEM A;  2VW8 A;  4C09 A;  2HB9 A;  4TYT A;  5ACT A;  1DD6 A;  1QH3 A;  4D1V A;  2FU8 A;  3AF5 A;  5HIO A;  4XUK A;  2P4Z A;  5ACS A;  4HL1 A;  5B1U A;  5A23 A;  5LM6 A;  2OHI A;  5EH9 A;  4Z5Y A;  3ZNB A;  2GFK A;  1XTO A;  3IOG A;  4JO0 A;  5LE1 A;  5AXO A;  5EW0 A;  4Z7R A;  1QH5 A;  4C1E A;  2I7V A;  4EY2 A;  1KO2 A;  4RL0 A;  3ESH A;  2E7Y A;  2I7X A;  3RKK A;  1P9E A;  3VPE A;  2BC2 A;  3FAI A;  4ZO3 A;  4C1D A;  4DIK A;  2QED A;  5IQK A;  2H6A A;  2A7M A;  3H3E A;  4FR7 A;  1DDK A;  4V0H A;  2YNW A;  3I14 A;  3F9O A;  2WYL A;  2QIN A;  5AHO A;  2DOO A;  4NQ2 A;  3I0V A;  2GFJ A;  5EWA A;  5AXR A;  4C1F A;  2AZ4 A;  4O98 A;  4Z6X A;  3FCZ A;  4D02 A;  3KNS A;  2BG8 B;  3JXP A;  1JJE A;  2BG2 A;  5LS3 A;  4ZNB A;  3L6N A;  5ACW A;  5LMC A;  4HKY A;  4EYF A;  4C1G A;  3AF6 A;  5EV6 A;  4YSB A;  1VGN A;  2P18 A;  2BMI A;  2GKL A;  4J5H A;  3MD7 A;  5EVK A;  2BG7 A;  4KEQ A;  1MQO A;  4J5F A;  3RKJ A;  2FU6 A;  4U4L A;  5LCH A;  3T3N A;  4YSK A;  2YCB A;  3SD9 A;  2FHX B;  2BFZ A;  1A7T A;  2UYX A;  4TYF A;  2FHX A;  5AJL A;  3LVZ A;  5HIP A;  4F6H A;  4UAM A;  3BC2 A;  4GYU A;  3TP9 A;  4RBS A;  2BTN A;  3ZWF A;  1K07 A;  5LCA A;  1Y44 A;  2BFK A;  3X2X A;  3RPC A;  4PVO A;  4RL2 A;  2YHE A;  1YCG A;  3KL7 A;  4CHL A;  3WXC A;  1YCH A;  1JT1 A;  4WD6 A;  1YCF A;  5EV8 A;  1BC2 A;  5A0T A;  1SML A;  2BFL A;  4Z67 A;  4AXH A;  2BR6 A;  1WRA A;  2BGA A;  2CG2 A;  2WHG A;  1X8G A;  2NXA A;  2P97 A;  2P1E A;  1L9Y A;  3VQZ A;  1HLK A;  4AD9 A;  4D1T A;  2M5D A;  5ACU A;  1BMC A;  5ACR A;  1A8T A;  3A4Y A;  3I11 A;  4TZ9 A;  4KEP A;  1E5D A;  4ZO2 A;  5K4K A;  2BG6 A;  5B15 A;  4XWW A;  1ZTC A;  2QDS A;  2Q42 A;  2WYM C;  5LCF A;  2FM6 A;  2CBN A;  4YSL A;  5HH5 A;  3IEL A;  3G1P A;  4HL2 A;  3ZR9 A;  5FQA A;  1ZNB A;  2XF4 A;  3X30 A;  4UA4 A;  2Y87 A;  4EXY A;  4NQ4 A;  2CFU A;  4BP0 A;  1KO3 A;  3KNR A;  1M2X A;  5B3R A;  5ACV A;  2NZF A;  2R2D A;  1XM8 A;  5A5Z A;  3DHC A;  3S0Z A;  5LSC A;  3Q6V A;  4NUR A;  5KIK A;  1ZKP A;  2YZ3 A;  2Y8B A;  5AHR A;  2Q0I A;  5FQC A;  1X8I A;  5AIJ A; 
#chains in the Genus database with same CATH homology
 2BFZ B;  3I13 A;  4FSB A;  4DIL A;  5AYA A;  3SBL A;  3QH8 A;  4UWR B;  3P2U A;  3X2Y A;  5HH6 A;  4FEK A;  4EXS A;  5LLD A;  4UWP B;  2NZE A;  2GMN A;  5AEB A;  3PY6 A;  3SPU A;  2Q9U A;  4AWY B;  4TZF A;  2GCU A;  3PG4 A;  3T9M A;  5A87 A;  4TZB A;  4Z60 A;  2OHJ A;  5KIL A;  5ACP A;  5HIS A;  2AIO A;  2FU9 A;  1JJT A;  3SFP A;  4Z5Z A;  4XWT A;  4EFZ A;  3ADR A;  2YNU A;  5HH4 A;  2M5C A;  5EVD A;  5EVB A;  3IOF A;  3X2Z A;  3BV6 A;  1WW1 A;  1VME A;  4UWS B;  1X8H A;  5A0V A;  1WUP A;  4BZ3 A;  2YNT B;  4EYL A;  3PY5 A;  2YNT A;  3BK2 A;  3SRX A;  3DH8 A;  4GYQ A;  2I7T A;  5HIQ A;  3IDZ A;  3DHA A;  3ZQ4 A;  5K4M A;  4P62 A;  3SW3 A;  2WRS A;  4LE6 A;  5ACX A;  4C1H A;  5K0W A;  2WYM A;  2YNV B;  5FQB A;  2YNV A;  3I15 A;  1DXK A;  4AWZ A;  1WUO A;  4D1U A;  1VJN A;  2XR1 A;  2ZWR A;  3IE1 A;  4NQ5 A;  5DPX A;  4F6Z A;  2QJS A;  5EHT A;  4RM5 A;  4AX1 B;  2QDT A;  2BG8 A;  2NYP A;  3DHB A;  4UBQ A;  2OHH A;  3R2U A;  4PVT A;  1KR3 A;  4RAM A;  2BIB A;  1BVT A;  2Q0J A;  2DKF A;  2ZNB A;  2ZZI A;  4TZE A;  2FK6 A;  3IEK A;  3T3O A;  4C1C A;  3IE2 A;  4ZEJ A;  3BK1 A;  4NQ6 A;  4EYB A;  4RAW A;  4D1W A;  5ACQ A;  2FU7 A;  3IE0 A;  2Y8A A;  3AJ3 A;  4UWO B;  4AX0 B;  2ZO4 A;  4B87 A;  4H0D A;  4GCW A;  5K4N A;  3IEM A;  2VW8 A;  4C09 A;  2HB9 A;  4TYT A;  5ACT A;  1DD6 A;  1QH3 A;  4D1V A;  2FU8 A;  3AF5 A;  5HIO A;  4XUK A;  2P4Z A;  5ACS A;  4HL1 A;  5B1U A;  5LM6 A;  2OHI A;  5EH9 A;  4Z5Y A;  3ZNB A;  2GFK A;  1XTO A;  3IOG A;  4JO0 A;  5LE1 A;  5AXO A;  5EW0 A;  4Z7R A;  1QH5 A;  4C1E A;  2I7V A;  4EY2 A;  1KO2 A;  4RL0 A;  3ESH A;  2E7Y A;  2I7X A;  3RKK A;  1P9E A;  3VPE A;  2BC2 A;  3FAI A;  4ZO3 A;  4C1D A;  4DIK A;  2QED A;  5IQK A;  2H6A A;  2A7M A;  3H3E A;  4FR7 A;  1DDK A;  2YNW A;  4V0H A;  3I14 A;  3F9O A;  2WYL A;  2QIN A;  5AHO A;  2DOO A;  4NQ2 A;  3I0V A;  2GFJ A;  5EWA A;  5AXR A;  4C1F A;  2AZ4 A;  4O98 A;  4Z6X A;  3FCZ A;  4D02 A;  3KNS A;  2BG8 B;  3JXP A;  1JJE A;  2BG2 A;  5LS3 A;  4ZNB A;  3L6N A;  5ACW A;  5LMC A;  4HKY A;  4EYF A;  4C1G A;  3AF6 A;  5EV6 A;  4YSB A;  1VGN A;  2P18 A;  2BMI A;  2GKL A;  4J5H A;  3MD7 A;  5EVK A;  2BG7 A;  4KEQ A;  1MQO A;  4J5F A;  3RKJ A;  2FU6 A;  4U4L A;  5LCH A;  3T3N A;  4YSK A;  2YCB A;  3SD9 A;  2FHX B;  2BFZ A;  1A7T A;  2UYX A;  4TYF A;  2FHX A;  3LVZ A;  5HIP A;  4F6H A;  4UAM A;  3BC2 A;  4GYU A;  3TP9 A;  4RBS A;  2BTN A;  3ZWF A;  1K07 A;  5LCA A;  1Y44 A;  2BFK A;  3X2X A;  3RPC A;  4PVO A;  4RL2 A;  1YCG A;  3KL7 A;  4CHL A;  3WXC A;  1YCH A;  1JT1 A;  4WD6 A;  1YCF A;  5EV8 A;  1BC2 A;  5A0T A;  1SML A;  2BFL A;  4Z67 A;  2BR6 A;  1WRA A;  2BGA A;  2WHG A;  1X8G A;  2NXA A;  2P97 A;  2P1E A;  1L9Y A;  3VQZ A;  1HLK A;  4AD9 A;  4D1T A;  2M5D A;  5ACU A;  1BMC A;  5ACR A;  1A8T A;  3A4Y A;  3I11 A;  4TZ9 A;  4KEP A;  1E5D A;  4ZO2 A;  5K4K A;  2BG6 A;  5B15 A;  4XWW A;  1ZTC A;  2QDS A;  2Q42 A;  2WYM C;  5LCF A;  2FM6 A;  2CBN A;  4YSL A;  5HH5 A;  3IEL A;  3G1P A;  4HL2 A;  3ZR9 A;  5FQA A;  1ZNB A;  2XF4 A;  3X30 A;  4UA4 A;  2Y87 A;  4EXY A;  4NQ4 A;  4BP0 A;  1KO3 A;  3KNR A;  1M2X A;  5B3R A;  5ACV A;  2NZF A;  2R2D A;  1XM8 A;  5A5Z A;  3DHC A;  3S0Z A;  5LSC A;  3Q6V A;  5KIK A;  1ZKP A;  2YZ3 A;  2Y8B A;  5AHR A;  2Q0I A;  5FQC A;  1X8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...