2BR6A

Crystal structure of quorum-quenching n-acyl homoserine lactone lactonase
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
252
structure length
240
Chain Sequence
MDMTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIKTEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AIIA-LIKE PROTEIN
publication title The Molecular Structure and Catalytic Mechanism of a Quorum-Quenching N-Acyl-L-Homoserine Lactone Hydrolase.
pubmed doi rcsb
source organism Bacillus thuringiensis
molecule tags Hydrolase
total genus 70
structure length 240
sequence length 252
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2005-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2br6A01
4HL2A 2NZFA 1X8IA 3QH8A 2OHJA 4TZEA 3IE0A 4D1WA 5FQAA 5LS3A 3BK1A 5ACXA 1DD6A 4UAMA 4RM5A 3T9MA 4RBSA 3KNSA 3DHCA 2OHHA 4GCWA 4ZO2A 1BVTA 4TYFA 4AX1B 2AZ4A 3PY6A 2GFJA 2Y8AA 4H0DA 5K0WA 3X2XA 2FM6A 3RKJA 2XF4A 2Q9UA 2BMIA 5AYAA 3IDZA 5K4MA 3X30A 5AHOA 4AWYB 4EYFA 2BTNA 5LM6A 1ZKPA 4UBQA 4EXYA 4GYQA 4P62A 2WYMA 5ACTA 5HH5A 5EW0A 4C1FA 5HIPA 4WD6A 2GFKA 5DPXA 4Z5YA 4Z6XA 4EXSA 4RL0A 2E7YA 3KL7A 3SW3A 3I13A 2YNUA 1BMCA 2I7TA 4D1TA 1WW1A 5HIOA 2WYLA 5HH6A 5EH9A 2P18A 2BG7A 1BC2A 1X8HA 5HH4A 3ZNBA 1Y44A 3PY5A 3P2UA 4Z60A 4C1GA 3FAIA 3FCZA 4FEKA 2QJSA 3PG4A 3ZWFA 2FHXA 4Z67A 3SFPA 3RPCA 5IQKA 4NQ4A 3F9OA 4YSLA 2BG6A 4HKYA 3SRXA 2FU6A 2WHGA 3AJ3A 1M2XA 2AIOA 1XTOA 4LE6A 3T3OA 5LE1A 4TYTA 5EWAA 2NXAA 5FQBA 3DHBA 1XM8A 4YSKA 2WRSA 2A7MA 2H6AA 3G1PA 3BV6A 3L6NA 1YCHA 1DDKA 3AF5A 5AXRA 4C1HA 4AX0B 4ZEJA 2YNTB 3S0ZA 5EHTA 2YZ3A 2P4ZA 3AF6A 2ZNBA 4FSBA 2OHIA 2Q0IA 5B15A 1L9YA 1A7TA 4CHLA 3I11A 2GCUA 5A0TA 5AEBA 4XWWA 3SBLA 4NQ2A 1YCFA 4U4LA 4BP0A 2Y8BA 2YCBA 1JJEA 2DKFA 2UYXA 4UWPB 1YCGA 4D1VA 2Q0JA 5LCAA 3I15A 2BGAA 4HL1A 2BG8B 1VJNA 1KR3A 3IE2A 3IEMA 3LVZA 3VQZA 1KO2A 3RKKA 1QH3A 2NYPA 1ZNBA 2QINA 4XUKA 1QH5A 3R2UA 3BK2A 5LLDA 5A0VA 1HLKA 5K4NA 3IEKA 4NQ6A 5ACWA 5KILA 2ZO4A 4YSBA 3SPUA 4DILA 2BFKA 3IELA 5AHRA 2HB9A 5LMCA 3I0VA 1VGNA 4RAMA 3TP9A 4EYLA 2BG2A 2BFLA 4NQ5A 2I7XA 4BZ3A 5HIQA 3ZR9A 5K4KA 4ZNBA 4EYBA 3SD9A 2XR1A 1X8GA 5LSCA 5LCFA 4JO0A 4KEPA 5EV6A 5ACUA 1K07A 4KEQA 2BR6A 5B1UA 4TZ9A 4FR7A 3X2ZA 1P9EA 5A87A 4V0HA 4C1CA 2I7VA 1WRAA 2YNTA 1WUOA 3ZQ4A 4GYUA 4J5FA 3VPEA 5ACPA 5EVKA 2WYMC 2FK6A 1A8TA 3KNRA 5EV8A 2GMNA 5EVBA 5FQCA 4PVTA 4UA4A 1JJTA 2BIBA 5ACRA 3IE1A 3ADRA 1VMEA 3MD7A 4C1EA 4UWSB 5B3RA 1JT1A 2BG8A 2QDTA 4RAWA 2GKLA 4F6HA 2Y87A 3JXPA 5ACQA 2P97A 2FU7A 3DH8A 4B87A 5HISA 2M5CA 4J5HA 1DXKA 2R2DA 5EVDA 3I14A 4RL2A 2DOOA 1MQOA 4UWOB 5ACSA 5AXOA 4C1DA 2VW8A 4O98A 3Q6VA 4EY2A 3IOFA 4AWZA 1ZTCA 2NZEA 4F6ZA 2FU9A 3DHAA 1SMLA 3WXCA 3X2YA 4AD9A 5ACVA 3ESHA 2M5DA 4Z5ZA 3BC2A 2ZZIA 4PVOA 2BFZA 2P1EA 4EFZA 4C09A 2ZWRA 4TZBA 2YNWA 2BFZB 3IOGA 2CBNA 3A4YA 2YNVA 4ZO3A 2QDSA 4UWRB 3H3EA 2Q42A 4TZFA 4XWTA 2YNVB 4Z7RA 5LCHA 4D02A 3T3NA 5KIKA 2QEDA 4D1UA 2FHXB 1WUPA 2BC2A 1KO3A 2FU8A 5A5ZA 1E5DA 4DIKA
chains in the Genus database with same CATH superfamily
4HL2A 2NZFA 1X8IA 3QH8A 2OHJA 4TZEA 3IE0A 4D1WA 5FQAA 5LS3A 3BK1A 5ACXA 1DD6A 4UAMA 4RM5A 3T9MA 4RBSA 3KNSA 3DHCA 2OHHA 4GCWA 4ZO2A 1BVTA 4TYFA 4AX1B 2AZ4A 3PY6A 2GFJA 2Y8AA 4H0DA 5K0WA 3X2XA 2FM6A 3RKJA 2XF4A 2Q9UA 2BMIA 5AYAA 3IDZA 5K4MA 3X30A 5AHOA 4AWYB 4EYFA 2BTNA 5LM6A 1ZKPA 4UBQA 4EXYA 4GYQA 4P62A 2WYMA 5ACTA 5HH5A 5EW0A 4C1FA 5HIPA 4WD6A 2GFKA 5DPXA 4Z5YA 4Z6XA 4EXSA 4RL0A 2E7YA 3KL7A 3SW3A 2CFUA 3I13A 2YNUA 1BMCA 2I7TA 4D1TA 1WW1A 5HIOA 2WYLA 5AJLA 5HH6A 5EH9A 2P18A 2BG7A 1BC2A 1X8HA 5HH4A 3ZNBA 1Y44A 3PY5A 3P2UA 4Z60A 4C1GA 3FAIA 3FCZA 4FEKA 2QJSA 3PG4A 3ZWFA 2FHXA 4Z67A 3SFPA 3RPCA 5IQKA 4NQ4A 3F9OA 4YSLA 2BG6A 4HKYA 3SRXA 2FU6A 4NURA 2WHGA 3AJ3A 1M2XA 2AIOA 1XTOA 4LE6A 3T3OA 5LE1A 4TYTA 5EWAA 2NXAA 5FQBA 3DHBA 1XM8A 4YSKA 2WRSA 2A7MA 2H6AA 3G1PA 3BV6A 3L6NA 1YCHA 1DDKA 3AF5A 5AXRA 4C1HA 4AX0B 4ZEJA 2YNTB 3S0ZA 5EHTA 2YZ3A 2P4ZA 3AF6A 2ZNBA 4FSBA 2OHIA 2Q0IA 5B15A 1L9YA 1A7TA 4CHLA 3I11A 2GCUA 5A0TA 5AEBA 4XWWA 3SBLA 4NQ2A 1YCFA 4U4LA 4BP0A 2Y8BA 2YCBA 1JJEA 2DKFA 2UYXA 4UWPB 1YCGA 4D1VA 2Q0JA 5LCAA 3I15A 2BGAA 4HL1A 2BG8B 1VJNA 1KR3A 3IE2A 3IEMA 3LVZA 3VQZA 1KO2A 3RKKA 1QH3A 2NYPA 1ZNBA 2QINA 4XUKA 1QH5A 3R2UA 3BK2A 5LLDA 5A0VA 1HLKA 5K4NA 3IEKA 4NQ6A 5ACWA 5KILA 2ZO4A 4YSBA 3SPUA 4DILA 2BFKA 3IELA 5AHRA 2HB9A 5LMCA 3I0VA 1VGNA 4RAMA 3TP9A 4EYLA 2BG2A 2BFLA 4NQ5A 2I7XA 4BZ3A 5HIQA 3ZR9A 5K4KA 4ZNBA 4EYBA 3SD9A 2XR1A 1X8GA 5LSCA 5LCFA 4JO0A 4KEPA 5EV6A 5ACUA 1K07A 4KEQA 2CG2A 2BR6A 5B1UA 4TZ9A 4FR7A 3X2ZA 1P9EA 5A87A 4V0HA 4C1CA 2I7VA 1WRAA 2YNTA 1WUOA 3ZQ4A 2YHEA 4GYUA 4J5FA 3VPEA 5ACPA 5EVKA 2WYMC 2FK6A 1A8TA 3KNRA 5EV8A 2GMNA 5EVBA 5FQCA 4PVTA 4UA4A 1JJTA 2BIBA 5ACRA 3IE1A 3ADRA 1VMEA 3MD7A 4C1EA 4UWSB 5B3RA 1JT1A 2BG8A 2QDTA 4RAWA 2GKLA 4F6HA 2Y87A 3JXPA 5ACQA 2P97A 2FU7A 3DH8A 4B87A 5HISA 2M5CA 4J5HA 1DXKA 2R2DA 5EVDA 3I14A 4RL2A 2DOOA 1MQOA 4UWOB 5ACSA 5AXOA 4C1DA 2VW8A 5AIJA 4O98A 3Q6VA 4EY2A 3IOFA 4AWZA 1ZTCA 2NZEA 4F6ZA 2FU9A 3DHAA 1SMLA 3WXCA 3X2YA 4PDXA 4AD9A 5ACVA 3ESHA 2M5DA 4Z5ZA 3BC2A 2ZZIA 4PVOA 4AV7A 2BFZA 2P1EA 4EFZA 4C09A 4AXHA 2ZWRA 4TZBA 2YNWA 2BFZB 3IOGA 2CBNA 3A4YA 2YNVA 4ZO3A 2QDSA 2CG3A 4UWRB 5A23A 3H3EA 2Q42A 4TZFA 4XWTA 2YNVB 4Z7RA 5LCHA 4D02A 3T3NA 5KIKA 2QEDA 4D1UA 2FHXB 1WUPA 2BC2A 1KO3A 2CFZA 2FU8A 5A5ZA 1E5DA 4DIKA
chains in the Genus database with same CATH topology
4HL2A 2NZFA 1X8IA 3QH8A 2OHJA 4TZEA 3IE0A 4D1WA 5FQAA 5LS3A 3BK1A 5ACXA 1DD6A 4UAMA 4RM5A 3T9MA 4RBSA 3KNSA 3DHCA 2OHHA 4GCWA 4ZO2A 1BVTA 4TYFA 4AX1B 2AZ4A 3PY6A 2GFJA 2Y8AA 4H0DA 5K0WA 3X2XA 2FM6A 3RKJA 2XF4A 2Q9UA 2BMIA 5AYAA 3IDZA 5K4MA 3X30A 5AHOA 4AWYB 4EYFA 2BTNA 5LM6A 1ZKPA 4UBQA 4EXYA 4GYQA 4P62A 2WYMA 5ACTA 5HH5A 5EW0A 4C1FA 5HIPA 4WD6A 2GFKA 5DPXA 4Z5YA 4Z6XA 4EXSA 4RL0A 2E7YA 3KL7A 3SW3A 3I13A 2YNUA 1BMCA 2I7TA 4D1TA 1WW1A 5HIOA 2WYLA 5HH6A 5EH9A 2P18A 2BG7A 1BC2A 1X8HA 5HH4A 3ZNBA 1Y44A 3PY5A 3P2UA 4Z60A 4C1GA 3FAIA 3FCZA 4FEKA 2QJSA 3PG4A 3ZWFA 2FHXA 4Z67A 3SFPA 3RPCA 5IQKA 4NQ4A 3F9OA 4YSLA 2BG6A 4HKYA 3SRXA 2FU6A 2WHGA 3AJ3A 1M2XA 2AIOA 1XTOA 4LE6A 3T3OA 5LE1A 4TYTA 5EWAA 2NXAA 5FQBA 3DHBA 1XM8A 4YSKA 2WRSA 2A7MA 2H6AA 3G1PA 3BV6A 3L6NA 1YCHA 1DDKA 3AF5A 5AXRA 4C1HA 4AX0B 4ZEJA 2YNTB 3S0ZA 5EHTA 2YZ3A 2P4ZA 3AF6A 2ZNBA 4FSBA 2OHIA 2Q0IA 5B15A 1L9YA 1A7TA 4CHLA 3I11A 2GCUA 5A0TA 5AEBA 4XWWA 3SBLA 4NQ2A 1YCFA 4U4LA 4BP0A 2Y8BA 2YCBA 1JJEA 2DKFA 2UYXA 4UWPB 1YCGA 4D1VA 2Q0JA 5LCAA 3I15A 2BGAA 4HL1A 2BG8B 1VJNA 1KR3A 3IE2A 3IEMA 3LVZA 3VQZA 1KO2A 3RKKA 1QH3A 2NYPA 1ZNBA 2QINA 4XUKA 1QH5A 3R2UA 3BK2A 5LLDA 5A0VA 1HLKA 5K4NA 3IEKA 4NQ6A 5ACWA 5KILA 2ZO4A 4YSBA 3SPUA 4DILA 2BFKA 3IELA 5AHRA 2HB9A 5LMCA 3I0VA 1VGNA 4RAMA 3TP9A 4EYLA 2BG2A 2BFLA 4NQ5A 2I7XA 4BZ3A 5HIQA 3ZR9A 5K4KA 4ZNBA 4EYBA 3SD9A 2XR1A 1X8GA 5LSCA 5LCFA 4JO0A 4KEPA 5EV6A 5ACUA 1K07A 4KEQA 2BR6A 5B1UA 4TZ9A 4FR7A 3X2ZA 1P9EA 5A87A 4V0HA 4C1CA 2I7VA 1WRAA 2YNTA 1WUOA 3ZQ4A 4GYUA 4J5FA 3VPEA 5ACPA 5EVKA 2WYMC 2FK6A 1A8TA 3KNRA 5EV8A 2GMNA 5EVBA 5FQCA 4PVTA 4UA4A 1JJTA 2BIBA 5ACRA 3IE1A 3ADRA 1VMEA 3MD7A 4C1EA 4UWSB 5B3RA 1JT1A 2BG8A 2QDTA 4RAWA 2GKLA 4F6HA 2Y87A 3JXPA 5ACQA 2P97A 2FU7A 3DH8A 4B87A 5HISA 2M5CA 4J5HA 1DXKA 2R2DA 5EVDA 3I14A 4RL2A 2DOOA 1MQOA 4UWOB 5ACSA 5AXOA 4C1DA 2VW8A 4O98A 3Q6VA 4EY2A 3IOFA 4AWZA 1ZTCA 2NZEA 4F6ZA 2FU9A 3DHAA 1SMLA 3WXCA 3X2YA 4AD9A 5ACVA 3ESHA 2M5DA 4Z5ZA 3BC2A 2ZZIA 4PVOA 2BFZA 2P1EA 4EFZA 4C09A 2ZWRA 4TZBA 2YNWA 2BFZB 3IOGA 2CBNA 3A4YA 2YNVA 4ZO3A 2QDSA 4UWRB 3H3EA 2Q42A 4TZFA 4XWTA 2YNVB 4Z7RA 5LCHA 4D02A 3T3NA 5KIKA 2QEDA 4D1UA 2FHXB 1WUPA 2BC2A 1KO3A 2FU8A 5A5ZA 1E5DA 4DIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HL2 A;  2NZF A;  1X8I A;  3QH8 A;  2OHJ A;  4TZE A;  3IE0 A;  4D1W A;  5FQA A;  5LS3 A;  3BK1 A;  5ACX A;  1DD6 A;  4UAM A;  4RM5 A;  3T9M A;  4RBS A;  3KNS A;  3DHC A;  2OHH A;  4GCW A;  4ZO2 A;  1BVT A;  4TYF A;  4AX1 B;  2AZ4 A;  3PY6 A;  2GFJ A;  2Y8A A;  4H0D A;  5K0W A;  3X2X A;  2FM6 A;  3RKJ A;  2XF4 A;  2Q9U A;  2BMI A;  5AYA A;  3IDZ A;  5K4M A;  3X30 A;  5AHO A;  4AWY B;  4EYF A;  2BTN A;  5LM6 A;  1ZKP A;  4UBQ A;  4EXY A;  4GYQ A;  4P62 A;  2WYM A;  5ACT A;  5HH5 A;  5EW0 A;  4C1F A;  5HIP A;  4WD6 A;  2GFK A;  5DPX A;  4Z5Y A;  4Z6X A;  4EXS A;  4RL0 A;  2E7Y A;  3KL7 A;  3SW3 A;  3I13 A;  2YNU A;  1BMC A;  2I7T A;  4D1T A;  1WW1 A;  5HIO A;  2WYL A;  5HH6 A;  5EH9 A;  2P18 A;  2BG7 A;  1BC2 A;  1X8H A;  5HH4 A;  3ZNB A;  1Y44 A;  3PY5 A;  3P2U A;  4Z60 A;  4C1G A;  3FAI A;  3FCZ A;  4FEK A;  2QJS A;  3PG4 A;  3ZWF A;  2FHX A;  4Z67 A;  3SFP A;  3RPC A;  5IQK A;  4NQ4 A;  3F9O A;  4YSL A;  2BG6 A;  4HKY A;  3SRX A;  2FU6 A;  2WHG A;  3AJ3 A;  1M2X A;  2AIO A;  1XTO A;  4LE6 A;  3T3O A;  5LE1 A;  4TYT A;  5EWA A;  2NXA A;  5FQB A;  3DHB A;  1XM8 A;  4YSK A;  2WRS A;  2A7M A;  2H6A A;  3G1P A;  3BV6 A;  3L6N A;  1YCH A;  1DDK A;  3AF5 A;  5AXR A;  4C1H A;  4AX0 B;  4ZEJ A;  2YNT B;  3S0Z A;  5EHT A;  2YZ3 A;  2P4Z A;  3AF6 A;  2ZNB A;  4FSB A;  2OHI A;  2Q0I A;  5B15 A;  1L9Y A;  1A7T A;  4CHL A;  3I11 A;  2GCU A;  5A0T A;  5AEB A;  4XWW A;  3SBL A;  4NQ2 A;  1YCF A;  4U4L A;  4BP0 A;  2Y8B A;  2YCB A;  1JJE A;  2DKF A;  2UYX A;  4UWP B;  1YCG A;  4D1V A;  2Q0J A;  5LCA A;  3I15 A;  2BGA A;  4HL1 A;  2BG8 B;  1VJN A;  1KR3 A;  3IE2 A;  3IEM A;  3LVZ A;  3VQZ A;  1KO2 A;  3RKK A;  1QH3 A;  2NYP A;  1ZNB A;  2QIN A;  4XUK A;  1QH5 A;  3R2U A;  3BK2 A;  5LLD A;  5A0V A;  1HLK A;  5K4N A;  3IEK A;  4NQ6 A;  5ACW A;  5KIL A;  2ZO4 A;  4YSB A;  3SPU A;  4DIL A;  2BFK A;  3IEL A;  5AHR A;  2HB9 A;  5LMC A;  3I0V A;  1VGN A;  4RAM A;  3TP9 A;  4EYL A;  2BG2 A;  2BFL A;  4NQ5 A;  2I7X A;  4BZ3 A;  5HIQ A;  3ZR9 A;  5K4K A;  4ZNB A;  4EYB A;  3SD9 A;  2XR1 A;  1X8G A;  5LSC A;  5LCF A;  4JO0 A;  4KEP A;  5EV6 A;  5ACU A;  1K07 A;  4KEQ A;  2BR6 A;  5B1U A;  4TZ9 A;  4FR7 A;  3X2Z A;  1P9E A;  5A87 A;  4V0H A;  4C1C A;  2I7V A;  1WRA A;  2YNT A;  1WUO A;  3ZQ4 A;  4GYU A;  4J5F A;  3VPE A;  5ACP A;  5EVK A;  2WYM C;  2FK6 A;  1A8T A;  3KNR A;  5EV8 A;  2GMN A;  5EVB A;  5FQC A;  4PVT A;  4UA4 A;  1JJT A;  2BIB A;  5ACR A;  3IE1 A;  3ADR A;  1VME A;  3MD7 A;  4C1E A;  4UWS B;  5B3R A;  1JT1 A;  2BG8 A;  2QDT A;  4RAW A;  2GKL A;  4F6H A;  2Y87 A;  3JXP A;  5ACQ A;  2P97 A;  2FU7 A;  3DH8 A;  4B87 A;  5HIS A;  2M5C A;  4J5H A;  1DXK A;  2R2D A;  5EVD A;  3I14 A;  4RL2 A;  2DOO A;  1MQO A;  4UWO B;  5ACS A;  5AXO A;  4C1D A;  2VW8 A;  4O98 A;  3Q6V A;  4EY2 A;  3IOF A;  4AWZ A;  1ZTC A;  2NZE A;  4F6Z A;  2FU9 A;  3DHA A;  1SML A;  3WXC A;  3X2Y A;  4AD9 A;  5ACV A;  3ESH A;  2M5D A;  4Z5Z A;  3BC2 A;  2ZZI A;  4PVO A;  2BFZ A;  2P1E A;  4EFZ A;  4C09 A;  2ZWR A;  4TZB A;  2YNW A;  2BFZ B;  3IOG A;  2CBN A;  3A4Y A;  2YNV A;  4ZO3 A;  2QDS A;  4UWR B;  3H3E A;  2Q42 A;  4TZF A;  4XWT A;  2YNV B;  4Z7R A;  5LCH A;  4D02 A;  3T3N A;  5KIK A;  2QED A;  4D1U A;  2FHX B;  1WUP A;  2BC2 A;  1KO3 A;  2FU8 A;  5A5Z A;  1E5D A;  4DIK A; 
#chains in the Genus database with same CATH topology
 4HL2 A;  2NZF A;  1X8I A;  3QH8 A;  2OHJ A;  4TZE A;  3IE0 A;  4D1W A;  5FQA A;  5LS3 A;  3BK1 A;  5ACX A;  1DD6 A;  4UAM A;  4RM5 A;  3T9M A;  4RBS A;  3KNS A;  3DHC A;  2OHH A;  4GCW A;  4ZO2 A;  1BVT A;  4TYF A;  4AX1 B;  2AZ4 A;  3PY6 A;  2GFJ A;  2Y8A A;  4H0D A;  5K0W A;  3X2X A;  2FM6 A;  3RKJ A;  2XF4 A;  2Q9U A;  2BMI A;  5AYA A;  3IDZ A;  5K4M A;  3X30 A;  5AHO A;  4AWY B;  4EYF A;  2BTN A;  5LM6 A;  1ZKP A;  4UBQ A;  4EXY A;  4GYQ A;  4P62 A;  2WYM A;  5ACT A;  5HH5 A;  5EW0 A;  4C1F A;  5HIP A;  4WD6 A;  2GFK A;  5DPX A;  4Z5Y A;  4Z6X A;  4EXS A;  4RL0 A;  2E7Y A;  3KL7 A;  3SW3 A;  2CFU A;  3I13 A;  2YNU A;  1BMC A;  2I7T A;  4D1T A;  1WW1 A;  5HIO A;  2WYL A;  5AJL A;  5HH6 A;  5EH9 A;  2P18 A;  2BG7 A;  1BC2 A;  1X8H A;  5HH4 A;  3ZNB A;  1Y44 A;  3PY5 A;  3P2U A;  4Z60 A;  4C1G A;  3FAI A;  3FCZ A;  4FEK A;  2QJS A;  3PG4 A;  3ZWF A;  2FHX A;  4Z67 A;  3SFP A;  3RPC A;  5IQK A;  4NQ4 A;  3F9O A;  4YSL A;  2BG6 A;  4HKY A;  3SRX A;  2FU6 A;  4NUR A;  2WHG A;  3AJ3 A;  1M2X A;  2AIO A;  1XTO A;  4LE6 A;  3T3O A;  5LE1 A;  4TYT A;  5EWA A;  2NXA A;  5FQB A;  3DHB A;  1XM8 A;  4YSK A;  2WRS A;  2A7M A;  2H6A A;  3G1P A;  3BV6 A;  3L6N A;  1YCH A;  1DDK A;  3AF5 A;  5AXR A;  4C1H A;  4AX0 B;  4ZEJ A;  2YNT B;  3S0Z A;  5EHT A;  2YZ3 A;  2P4Z A;  3AF6 A;  2ZNB A;  4FSB A;  2OHI A;  2Q0I A;  5B15 A;  1L9Y A;  1A7T A;  4CHL A;  3I11 A;  2GCU A;  5A0T A;  5AEB A;  4XWW A;  3SBL A;  4NQ2 A;  1YCF A;  4U4L A;  4BP0 A;  2Y8B A;  2YCB A;  1JJE A;  2DKF A;  2UYX A;  4UWP B;  1YCG A;  4D1V A;  2Q0J A;  5LCA A;  3I15 A;  2BGA A;  4HL1 A;  2BG8 B;  1VJN A;  1KR3 A;  3IE2 A;  3IEM A;  3LVZ A;  3VQZ A;  1KO2 A;  3RKK A;  1QH3 A;  2NYP A;  1ZNB A;  2QIN A;  4XUK A;  1QH5 A;  3R2U A;  3BK2 A;  5LLD A;  5A0V A;  1HLK A;  5K4N A;  3IEK A;  4NQ6 A;  5ACW A;  5KIL A;  2ZO4 A;  4YSB A;  3SPU A;  4DIL A;  2BFK A;  3IEL A;  5AHR A;  2HB9 A;  5LMC A;  3I0V A;  1VGN A;  4RAM A;  3TP9 A;  4EYL A;  2BG2 A;  2BFL A;  4NQ5 A;  2I7X A;  4BZ3 A;  5HIQ A;  3ZR9 A;  5K4K A;  4ZNB A;  4EYB A;  3SD9 A;  2XR1 A;  1X8G A;  5LSC A;  5LCF A;  4JO0 A;  4KEP A;  5EV6 A;  5ACU A;  1K07 A;  4KEQ A;  2CG2 A;  2BR6 A;  5B1U A;  4TZ9 A;  4FR7 A;  3X2Z A;  1P9E A;  5A87 A;  4V0H A;  4C1C A;  2I7V A;  1WRA A;  2YNT A;  1WUO A;  3ZQ4 A;  2YHE A;  4GYU A;  4J5F A;  3VPE A;  5ACP A;  5EVK A;  2WYM C;  2FK6 A;  1A8T A;  3KNR A;  5EV8 A;  2GMN A;  5EVB A;  5FQC A;  4PVT A;  4UA4 A;  1JJT A;  2BIB A;  5ACR A;  3IE1 A;  3ADR A;  1VME A;  3MD7 A;  4C1E A;  4UWS B;  5B3R A;  1JT1 A;  2BG8 A;  2QDT A;  4RAW A;  2GKL A;  4F6H A;  2Y87 A;  3JXP A;  5ACQ A;  2P97 A;  2FU7 A;  3DH8 A;  4B87 A;  5HIS A;  2M5C A;  4J5H A;  1DXK A;  2R2D A;  5EVD A;  3I14 A;  4RL2 A;  2DOO A;  1MQO A;  4UWO B;  5ACS A;  5AXO A;  4C1D A;  2VW8 A;  5AIJ A;  4O98 A;  3Q6V A;  4EY2 A;  3IOF A;  4AWZ A;  1ZTC A;  2NZE A;  4F6Z A;  2FU9 A;  3DHA A;  1SML A;  3WXC A;  3X2Y A;  4PDX A;  4AD9 A;  5ACV A;  3ESH A;  2M5D A;  4Z5Z A;  3BC2 A;  2ZZI A;  4PVO A;  4AV7 A;  2BFZ A;  2P1E A;  4EFZ A;  4C09 A;  4AXH A;  2ZWR A;  4TZB A;  2YNW A;  2BFZ B;  3IOG A;  2CBN A;  3A4Y A;  2YNV A;  4ZO3 A;  2QDS A;  2CG3 A;  4UWR B;  5A23 A;  3H3E A;  2Q42 A;  4TZF A;  4XWT A;  2YNV B;  4Z7R A;  5LCH A;  4D02 A;  3T3N A;  5KIK A;  2QED A;  4D1U A;  2FHX B;  1WUP A;  2BC2 A;  1KO3 A;  2CFZ A;  2FU8 A;  5A5Z A;  1E5D A;  4DIK A; 
#chains in the Genus database with same CATH homology
 4HL2 A;  2NZF A;  1X8I A;  3QH8 A;  2OHJ A;  4TZE A;  3IE0 A;  4D1W A;  5FQA A;  5LS3 A;  3BK1 A;  5ACX A;  1DD6 A;  4UAM A;  4RM5 A;  3T9M A;  4RBS A;  3KNS A;  3DHC A;  2OHH A;  4GCW A;  4ZO2 A;  1BVT A;  4TYF A;  4AX1 B;  2AZ4 A;  3PY6 A;  2GFJ A;  2Y8A A;  4H0D A;  5K0W A;  3X2X A;  2FM6 A;  3RKJ A;  2XF4 A;  2Q9U A;  2BMI A;  5AYA A;  3IDZ A;  5K4M A;  3X30 A;  5AHO A;  4AWY B;  4EYF A;  2BTN A;  5LM6 A;  1ZKP A;  4UBQ A;  4EXY A;  4GYQ A;  4P62 A;  2WYM A;  5ACT A;  5HH5 A;  5EW0 A;  4C1F A;  5HIP A;  4WD6 A;  2GFK A;  5DPX A;  4Z5Y A;  4Z6X A;  4EXS A;  4RL0 A;  2E7Y A;  3KL7 A;  3SW3 A;  3I13 A;  2YNU A;  1BMC A;  2I7T A;  4D1T A;  1WW1 A;  5HIO A;  2WYL A;  5HH6 A;  5EH9 A;  2P18 A;  2BG7 A;  1BC2 A;  1X8H A;  5HH4 A;  3ZNB A;  1Y44 A;  3PY5 A;  3P2U A;  4Z60 A;  4C1G A;  3FAI A;  3FCZ A;  4FEK A;  2QJS A;  3PG4 A;  3ZWF A;  2FHX A;  4Z67 A;  3SFP A;  3RPC A;  5IQK A;  4NQ4 A;  3F9O A;  4YSL A;  2BG6 A;  4HKY A;  3SRX A;  2FU6 A;  2WHG A;  3AJ3 A;  1M2X A;  2AIO A;  1XTO A;  4LE6 A;  3T3O A;  5LE1 A;  4TYT A;  5EWA A;  2NXA A;  5FQB A;  3DHB A;  1XM8 A;  4YSK A;  2WRS A;  2A7M A;  2H6A A;  3G1P A;  3BV6 A;  3L6N A;  1YCH A;  1DDK A;  3AF5 A;  5AXR A;  4C1H A;  4AX0 B;  4ZEJ A;  2YNT B;  3S0Z A;  5EHT A;  2YZ3 A;  2P4Z A;  3AF6 A;  2ZNB A;  4FSB A;  2OHI A;  2Q0I A;  5B15 A;  1L9Y A;  1A7T A;  4CHL A;  3I11 A;  2GCU A;  5A0T A;  5AEB A;  4XWW A;  3SBL A;  4NQ2 A;  1YCF A;  4U4L A;  4BP0 A;  2Y8B A;  2YCB A;  1JJE A;  2DKF A;  2UYX A;  4UWP B;  1YCG A;  4D1V A;  2Q0J A;  5LCA A;  3I15 A;  2BGA A;  4HL1 A;  2BG8 B;  1VJN A;  1KR3 A;  3IE2 A;  3IEM A;  3LVZ A;  3VQZ A;  1KO2 A;  3RKK A;  1QH3 A;  2NYP A;  1ZNB A;  2QIN A;  4XUK A;  1QH5 A;  3R2U A;  3BK2 A;  5LLD A;  5A0V A;  1HLK A;  5K4N A;  3IEK A;  4NQ6 A;  5ACW A;  5KIL A;  2ZO4 A;  4YSB A;  3SPU A;  4DIL A;  2BFK A;  3IEL A;  5AHR A;  2HB9 A;  5LMC A;  3I0V A;  1VGN A;  4RAM A;  3TP9 A;  4EYL A;  2BG2 A;  2BFL A;  4NQ5 A;  2I7X A;  4BZ3 A;  5HIQ A;  3ZR9 A;  5K4K A;  4ZNB A;  4EYB A;  3SD9 A;  2XR1 A;  1X8G A;  5LSC A;  5LCF A;  4JO0 A;  4KEP A;  5EV6 A;  5ACU A;  1K07 A;  4KEQ A;  2BR6 A;  5B1U A;  4TZ9 A;  4FR7 A;  3X2Z A;  1P9E A;  5A87 A;  4V0H A;  4C1C A;  2I7V A;  1WRA A;  2YNT A;  1WUO A;  3ZQ4 A;  4GYU A;  4J5F A;  3VPE A;  5ACP A;  5EVK A;  2WYM C;  2FK6 A;  1A8T A;  3KNR A;  5EV8 A;  2GMN A;  5EVB A;  5FQC A;  4PVT A;  4UA4 A;  1JJT A;  2BIB A;  5ACR A;  3IE1 A;  3ADR A;  1VME A;  3MD7 A;  4C1E A;  4UWS B;  5B3R A;  1JT1 A;  2BG8 A;  2QDT A;  4RAW A;  2GKL A;  4F6H A;  2Y87 A;  3JXP A;  5ACQ A;  2P97 A;  2FU7 A;  3DH8 A;  4B87 A;  5HIS A;  2M5C A;  4J5H A;  1DXK A;  2R2D A;  5EVD A;  3I14 A;  4RL2 A;  2DOO A;  1MQO A;  4UWO B;  5ACS A;  5AXO A;  4C1D A;  2VW8 A;  4O98 A;  3Q6V A;  4EY2 A;  3IOF A;  4AWZ A;  1ZTC A;  2NZE A;  4F6Z A;  2FU9 A;  3DHA A;  1SML A;  3WXC A;  3X2Y A;  4AD9 A;  5ACV A;  3ESH A;  2M5D A;  4Z5Z A;  3BC2 A;  2ZZI A;  4PVO A;  2BFZ A;  2P1E A;  4EFZ A;  4C09 A;  2ZWR A;  4TZB A;  2YNW A;  2BFZ B;  3IOG A;  2CBN A;  3A4Y A;  2YNV A;  4ZO3 A;  2QDS A;  4UWR B;  3H3E A;  2Q42 A;  4TZF A;  4XWT A;  2YNV B;  4Z7R A;  5LCH A;  4D02 A;  3T3N A;  5KIK A;  2QED A;  4D1U A;  2FHX B;  1WUP A;  2BC2 A;  1KO3 A;  2FU8 A;  5A5Z A;  1E5D A;  4DIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...