2BR6A

Crystal structure of quorum-quenching n-acyl homoserine lactone lactonase
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
252
structure length
240
Chain Sequence
MDMTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIKTEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Molecular Structure and Catalytic Mechanism of a Quorum-Quenching N-Acyl-L-Homoserine Lactone Hydrolase.
pubmed doi rcsb
source organism Bacillus thuringiensis
molecule tags Hydrolase
molecule keywords AIIA-LIKE PROTEIN
total genus 70
structure length 240
sequence length 252
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2005-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2br6A01
1Y44A 2AZ4A 3ZQ4A 3ESHA 5EV8A 4AWYB 3LVZA 5EVBA 3G1PA 4FR7A 2Y87A 5AHOA 5LLDA 2FU9A 3T3NA 4FEKA 1X8GA 1ZNBA 3BK2A 2CBNA 5KIKA 2FU7A 4AX0B 4AX1B 5K4NA 1QH5A 4UWSB 3DHCA 5LCAA 1YCGA 2YNTA 4ZO2A 4D1VA 1VJNA 4Z67A 3VPEA 4Z5ZA 5EW0A 5A87A 2A7MA 1YCFA 1WW1A 2ZO4A 5LSCA 2WHGA 3F9OA 1A8TA 2BG8A 2NZEA 2WYMA 3JXPA 4YSKA 5A0TA 5ACQA 3R2UA 2BGAA 1YCHA 5HISA 4P62A 3MD7A 1QH3A 1M2XA 3AF6A 4C1FA 4GCWA 2E7YA 2QDTA 3PY5A 1BMCA 3AJ3A 4EXYA 3IE1A 4TYTA 4GYQA 1E5DA 1KR3A 2FHXB 5K0WA 4NQ5A 2BIBA 2BR6A 3I0VA 2M5CA 4UBQA 3TP9A 4KEPA 1K07A 4XUKA 4HKYA 1SMLA 5LM6A 2GFKA 4EY2A 5K4KA 2I7XA 3Q6VA 4B87A 3IDZA 2FU6A 4UA4A 4UWPB 4F6ZA 1VGNA 1XM8A 4O98A 3IOGA 2YCBA 4RAWA 5EV6A 2Y8BA 4Z60A 3ZNBA 1DDKA 4ZEJA 4C1DA 1WUPA 5A5ZA 3WXCA 2Y8AA 2GCUA 3I11A 2DKFA 4EYBA 3KL7A 4C09A 1VMEA 3T3OA 2OHJA 1JJTA 1A7TA 4GYUA 3VQZA 2XR1A 2QEDA 2R2DA 5ACVA 2M5DA 2VW8A 4Z6XA 2NXAA 4AD9A 4XWWA 2XF4A 4HL2A 3ZR9A 2ZNBA 1HLKA 4U4LA 4EFZA 2GFJA 2I7TA 2FM6A 2GMNA 2BFZA 5LE1A 4JO0A 3DHAA 5A0VA 5LCHA 3SD9A 3IOFA 3ADRA 3IE2A 3SRXA 4D1TA 3QH8A 1WUOA 4WD6A 2FU8A 3DH8A 1KO2A 1X8IA 3X30A 3I15A 2QINA 5EHTA 3IELA 5HIQA 1BC2A 2AIOA 1DXKA 2BMIA 4DILA 4DIKA 3SPUA 5HH5A 1ZKPA 5AXOA 5HIOA 2BG6A 5IQKA 1JT1A 4J5HA 3RKJA 4C1HA 5EVKA 1KO3A 3PG4A 4F6HA 5K4MA 3RPCA 4TZ9A 4RAMA 5EVDA 3PY6A 3SW3A 4PVOA 4D1WA 2BG8B 3BC2A 5B1UA 2DOOA 5AXRA 2HB9A 4C1GA 2BC2A 3X2XA 3FCZA 4UWOB 5HH4A 2QJSA 3SBLA 4Z7RA 5LCFA 5KILA 2UYXA 2OHHA 4RBSA 3I13A 3X2YA 2BG2A 1P9EA 5FQCA 5AHRA 4CHLA 2BFKA 3BK1A 5ACPA 2GKLA 3RKKA 2ZZIA 5DPXA 4TZEA 1X8HA 4TZBA 2YNVB 1DD6A 3IEKA 5ACWA 3SFPA 4PVTA 3H3EA 2BFZB 4YSBA 2NZFA 5LMCA 4V0HA 4C1CA 3IE0A 2I7VA 4NQ2A 3ZWFA 1ZTCA 4RM5A 4FSBA 2P4ZA 5AYAA 1L9YA 2Q42A 3BV6A 5FQBA 5ACSA 3I14A 2BTNA 2Q0IA 2FHXA 3L6NA 1BVTA 4KEQA 4D02A 4J5FA 2YNTB 4YSLA 4C1EA 2P97A 3S0ZA 5ACXA 4AWZA 5ACUA 3T9MA 2BFLA 5EH9A 4D1UA 4Z5YA 5ACRA 5B15A 4XWTA 4RL2A 4EXSA 2H6AA 2QDSA 4BP0A 4TZFA 1XTOA 4H0DA 2OHIA 5AEBA 1MQOA 3X2ZA 5HIPA 3KNSA 2P1EA 4UWRB 2WYMC 4HL1A 5EWAA 2Q9UA 2NYPA 2FK6A 4EYFA 2P18A 4BZ3A 3IEMA 2ZWRA 5B3RA 4EYLA 4ZNBA 1JJEA 4LE6A 2YNUA 3P2UA 5HH6A 3DHBA 2YNWA 4RL0A 5ACTA 2YNVA 3FAIA 2WRSA 5LS3A 1WRAA 4NQ6A 2YZ3A 4NQ4A 3AF5A 5FQAA 3KNRA 4TYFA 2BG7A 4ZO3A 3A4YA 2Q0JA 2WYLA 4UAMA
chains in the Genus database with same CATH superfamily
1Y44A 2AZ4A 3ZQ4A 3ESHA 5EV8A 4AWYB 3LVZA 5EVBA 3G1PA 4FR7A 2Y87A 5AHOA 5LLDA 2FU9A 3T3NA 4FEKA 1X8GA 1ZNBA 3BK2A 2CBNA 5KIKA 2FU7A 4AX0B 4AX1B 5K4NA 1QH5A 4UWSB 3DHCA 5LCAA 1YCGA 2YNTA 4ZO2A 4D1VA 1VJNA 4Z67A 3VPEA 4Z5ZA 5EW0A 5A87A 2A7MA 5AIJA 1YCFA 1WW1A 2ZO4A 5LSCA 2WHGA 3F9OA 1A8TA 2BG8A 2NZEA 2WYMA 3JXPA 4YSKA 5A0TA 5ACQA 3R2UA 2BGAA 1YCHA 4PDXA 5HISA 4P62A 3MD7A 1QH3A 1M2XA 3AF6A 4C1FA 4GCWA 2E7YA 2QDTA 3PY5A 1BMCA 3AJ3A 4EXYA 3IE1A 4TYTA 4GYQA 1E5DA 1KR3A 2FHXB 5K0WA 4NQ5A 2BIBA 2BR6A 3I0VA 2M5CA 4UBQA 3TP9A 4KEPA 1K07A 4XUKA 4HKYA 1SMLA 5LM6A 2GFKA 4EY2A 5K4KA 2I7XA 3Q6VA 4B87A 3IDZA 2FU6A 4UA4A 4UWPB 4F6ZA 1VGNA 1XM8A 4O98A 3IOGA 2YCBA 4RAWA 5EV6A 5AJLA 2Y8BA 4Z60A 3ZNBA 2CG3A 1DDKA 4ZEJA 4C1DA 1WUPA 5A5ZA 3WXCA 2YHEA 2Y8AA 2GCUA 3I11A 2DKFA 4EYBA 3KL7A 4C09A 1VMEA 3T3OA 2OHJA 1JJTA 1A7TA 4GYUA 3VQZA 2XR1A 2QEDA 2R2DA 5ACVA 2M5DA 2VW8A 4Z6XA 2NXAA 4AD9A 4AV7A 4XWWA 2XF4A 4HL2A 3ZR9A 2ZNBA 1HLKA 4U4LA 4EFZA 2GFJA 2I7TA 2FM6A 2GMNA 2BFZA 5LE1A 4JO0A 3DHAA 5A0VA 5LCHA 3SD9A 3IOFA 3ADRA 3IE2A 3SRXA 4D1TA 3QH8A 1WUOA 4WD6A 2FU8A 3DH8A 1KO2A 1X8IA 3X30A 3I15A 2QINA 5EHTA 3IELA 5HIQA 1BC2A 2AIOA 1DXKA 2BMIA 4DILA 4DIKA 3SPUA 5HH5A 1ZKPA 5AXOA 5HIOA 2BG6A 5IQKA 1JT1A 4J5HA 3RKJA 4C1HA 5EVKA 1KO3A 3PG4A 2CFUA 4F6HA 5K4MA 3RPCA 2CG2A 4TZ9A 4RAMA 5EVDA 3PY6A 3SW3A 4PVOA 4D1WA 2BG8B 3BC2A 5B1UA 2DOOA 5AXRA 2HB9A 4C1GA 2BC2A 3X2XA 5A23A 3FCZA 4UWOB 5HH4A 2QJSA 3SBLA 4Z7RA 5LCFA 5KILA 2UYXA 2OHHA 4RBSA 3I13A 3X2YA 2BG2A 1P9EA 5FQCA 5AHRA 4CHLA 4AXHA 2BFKA 3BK1A 5ACPA 2GKLA 3RKKA 2ZZIA 5DPXA 4TZEA 1X8HA 4TZBA 2YNVB 1DD6A 3IEKA 5ACWA 3SFPA 4PVTA 3H3EA 2BFZB 4YSBA 2NZFA 5LMCA 4V0HA 4C1CA 3IE0A 2I7VA 4NQ2A 3ZWFA 1ZTCA 4RM5A 4FSBA 2P4ZA 5AYAA 1L9YA 2Q42A 3BV6A 5FQBA 5ACSA 3I14A 2BTNA 2Q0IA 2FHXA 3L6NA 1BVTA 4KEQA 4D02A 4J5FA 2YNTB 4YSLA 4C1EA 2P97A 3S0ZA 5ACXA 4AWZA 5ACUA 3T9MA 2BFLA 5EH9A 4D1UA 4Z5YA 5ACRA 5B15A 4XWTA 4RL2A 4EXSA 2H6AA 2QDSA 4BP0A 4TZFA 1XTOA 4H0DA 2OHIA 5AEBA 1MQOA 3X2ZA 5HIPA 3KNSA 2P1EA 4UWRB 2WYMC 4HL1A 5EWAA 2Q9UA 2NYPA 2FK6A 4EYFA 2P18A 4BZ3A 3IEMA 2ZWRA 5B3RA 4EYLA 4ZNBA 1JJEA 4LE6A 2YNUA 3P2UA 5HH6A 3DHBA 2YNWA 4NURA 2CFZA 4RL0A 5ACTA 2YNVA 3FAIA 2WRSA 5LS3A 1WRAA 4NQ6A 2YZ3A 4NQ4A 3AF5A 5FQAA 3KNRA 4TYFA 2BG7A 4ZO3A 3A4YA 2Q0JA 2WYLA 4UAMA
chains in the Genus database with same CATH topology
1Y44A 2AZ4A 3ZQ4A 3ESHA 5EV8A 4AWYB 3LVZA 5EVBA 3G1PA 4FR7A 2Y87A 5AHOA 5LLDA 2FU9A 3T3NA 4FEKA 1X8GA 1ZNBA 3BK2A 2CBNA 5KIKA 2FU7A 4AX0B 4AX1B 5K4NA 1QH5A 4UWSB 3DHCA 5LCAA 1YCGA 2YNTA 4ZO2A 4D1VA 1VJNA 4Z67A 3VPEA 4Z5ZA 5EW0A 5A87A 2A7MA 1YCFA 1WW1A 2ZO4A 5LSCA 2WHGA 3F9OA 1A8TA 2BG8A 2NZEA 2WYMA 3JXPA 4YSKA 5A0TA 5ACQA 3R2UA 2BGAA 1YCHA 5HISA 4P62A 3MD7A 1QH3A 1M2XA 3AF6A 4C1FA 4GCWA 2E7YA 2QDTA 3PY5A 1BMCA 3AJ3A 4EXYA 3IE1A 4TYTA 4GYQA 1E5DA 1KR3A 2FHXB 5K0WA 4NQ5A 2BIBA 2BR6A 3I0VA 2M5CA 4UBQA 3TP9A 4KEPA 1K07A 4XUKA 4HKYA 1SMLA 5LM6A 2GFKA 4EY2A 5K4KA 2I7XA 3Q6VA 4B87A 3IDZA 2FU6A 4UA4A 4UWPB 4F6ZA 1VGNA 1XM8A 4O98A 3IOGA 2YCBA 4RAWA 5EV6A 2Y8BA 4Z60A 3ZNBA 1DDKA 4ZEJA 4C1DA 1WUPA 5A5ZA 3WXCA 2Y8AA 2GCUA 3I11A 2DKFA 4EYBA 3KL7A 4C09A 1VMEA 3T3OA 2OHJA 1JJTA 1A7TA 4GYUA 3VQZA 2XR1A 2QEDA 2R2DA 5ACVA 2M5DA 2VW8A 4Z6XA 2NXAA 4AD9A 4XWWA 2XF4A 4HL2A 3ZR9A 2ZNBA 1HLKA 4U4LA 4EFZA 2GFJA 2I7TA 2FM6A 2GMNA 2BFZA 5LE1A 4JO0A 3DHAA 5A0VA 5LCHA 3SD9A 3IOFA 3ADRA 3IE2A 3SRXA 4D1TA 3QH8A 1WUOA 4WD6A 2FU8A 3DH8A 1KO2A 1X8IA 3X30A 3I15A 2QINA 5EHTA 3IELA 5HIQA 1BC2A 2AIOA 1DXKA 2BMIA 4DILA 4DIKA 3SPUA 5HH5A 1ZKPA 5AXOA 5HIOA 2BG6A 5IQKA 1JT1A 4J5HA 3RKJA 4C1HA 5EVKA 1KO3A 3PG4A 4F6HA 5K4MA 3RPCA 4TZ9A 4RAMA 5EVDA 3PY6A 3SW3A 4PVOA 4D1WA 2BG8B 3BC2A 5B1UA 2DOOA 5AXRA 2HB9A 4C1GA 2BC2A 3X2XA 3FCZA 4UWOB 5HH4A 2QJSA 3SBLA 4Z7RA 5LCFA 5KILA 2UYXA 2OHHA 4RBSA 3I13A 3X2YA 2BG2A 1P9EA 5FQCA 5AHRA 4CHLA 2BFKA 3BK1A 5ACPA 2GKLA 3RKKA 2ZZIA 5DPXA 4TZEA 1X8HA 4TZBA 2YNVB 1DD6A 3IEKA 5ACWA 3SFPA 4PVTA 3H3EA 2BFZB 4YSBA 2NZFA 5LMCA 4V0HA 4C1CA 3IE0A 2I7VA 4NQ2A 3ZWFA 1ZTCA 4RM5A 4FSBA 2P4ZA 5AYAA 1L9YA 2Q42A 3BV6A 5FQBA 5ACSA 3I14A 2BTNA 2Q0IA 2FHXA 3L6NA 1BVTA 4KEQA 4D02A 4J5FA 2YNTB 4YSLA 4C1EA 2P97A 3S0ZA 5ACXA 4AWZA 5ACUA 3T9MA 2BFLA 5EH9A 4D1UA 4Z5YA 5ACRA 5B15A 4XWTA 4RL2A 4EXSA 2H6AA 2QDSA 4BP0A 4TZFA 1XTOA 4H0DA 2OHIA 5AEBA 1MQOA 3X2ZA 5HIPA 3KNSA 2P1EA 4UWRB 2WYMC 4HL1A 5EWAA 2Q9UA 2NYPA 2FK6A 4EYFA 2P18A 4BZ3A 3IEMA 2ZWRA 5B3RA 4EYLA 4ZNBA 1JJEA 4LE6A 2YNUA 3P2UA 5HH6A 3DHBA 2YNWA 4RL0A 5ACTA 2YNVA 3FAIA 2WRSA 5LS3A 1WRAA 4NQ6A 2YZ3A 4NQ4A 3AF5A 5FQAA 3KNRA 4TYFA 2BG7A 4ZO3A 3A4YA 2Q0JA 2WYLA 4UAMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y44 A;  2AZ4 A;  3ZQ4 A;  3ESH A;  5EV8 A;  4AWY B;  3LVZ A;  5EVB A;  3G1P A;  4FR7 A;  2Y87 A;  5AHO A;  5LLD A;  2FU9 A;  3T3N A;  4FEK A;  1X8G A;  1ZNB A;  3BK2 A;  2CBN A;  5KIK A;  2FU7 A;  4AX0 B;  4AX1 B;  5K4N A;  1QH5 A;  4UWS B;  3DHC A;  5LCA A;  1YCG A;  2YNT A;  4ZO2 A;  4D1V A;  1VJN A;  4Z67 A;  3VPE A;  4Z5Z A;  5EW0 A;  5A87 A;  2A7M A;  1YCF A;  1WW1 A;  2ZO4 A;  5LSC A;  2WHG A;  3F9O A;  1A8T A;  2BG8 A;  2NZE A;  2WYM A;  3JXP A;  4YSK A;  5A0T A;  5ACQ A;  3R2U A;  2BGA A;  1YCH A;  5HIS A;  4P62 A;  3MD7 A;  1QH3 A;  1M2X A;  3AF6 A;  4C1F A;  4GCW A;  2E7Y A;  2QDT A;  3PY5 A;  1BMC A;  3AJ3 A;  4EXY A;  3IE1 A;  4TYT A;  4GYQ A;  1E5D A;  1KR3 A;  2FHX B;  5K0W A;  4NQ5 A;  2BIB A;  2BR6 A;  3I0V A;  2M5C A;  4UBQ A;  3TP9 A;  4KEP A;  1K07 A;  4XUK A;  4HKY A;  1SML A;  5LM6 A;  2GFK A;  4EY2 A;  5K4K A;  2I7X A;  3Q6V A;  4B87 A;  3IDZ A;  2FU6 A;  4UA4 A;  4UWP B;  4F6Z A;  1VGN A;  1XM8 A;  4O98 A;  3IOG A;  2YCB A;  4RAW A;  5EV6 A;  2Y8B A;  4Z60 A;  3ZNB A;  1DDK A;  4ZEJ A;  4C1D A;  1WUP A;  5A5Z A;  3WXC A;  2Y8A A;  2GCU A;  3I11 A;  2DKF A;  4EYB A;  3KL7 A;  4C09 A;  1VME A;  3T3O A;  2OHJ A;  1JJT A;  1A7T A;  4GYU A;  3VQZ A;  2XR1 A;  2QED A;  2R2D A;  5ACV A;  2M5D A;  2VW8 A;  4Z6X A;  2NXA A;  4AD9 A;  4XWW A;  2XF4 A;  4HL2 A;  3ZR9 A;  2ZNB A;  1HLK A;  4U4L A;  4EFZ A;  2GFJ A;  2I7T A;  2FM6 A;  2GMN A;  2BFZ A;  5LE1 A;  4JO0 A;  3DHA A;  5A0V A;  5LCH A;  3SD9 A;  3IOF A;  3ADR A;  3IE2 A;  3SRX A;  4D1T A;  3QH8 A;  1WUO A;  4WD6 A;  2FU8 A;  3DH8 A;  1KO2 A;  1X8I A;  3X30 A;  3I15 A;  2QIN A;  5EHT A;  3IEL A;  5HIQ A;  1BC2 A;  2AIO A;  1DXK A;  2BMI A;  4DIL A;  4DIK A;  3SPU A;  5HH5 A;  1ZKP A;  5AXO A;  5HIO A;  2BG6 A;  5IQK A;  1JT1 A;  4J5H A;  3RKJ A;  4C1H A;  5EVK A;  1KO3 A;  3PG4 A;  4F6H A;  5K4M A;  3RPC A;  4TZ9 A;  4RAM A;  5EVD A;  3PY6 A;  3SW3 A;  4PVO A;  4D1W A;  2BG8 B;  3BC2 A;  5B1U A;  2DOO A;  5AXR A;  2HB9 A;  4C1G A;  2BC2 A;  3X2X A;  3FCZ A;  4UWO B;  5HH4 A;  2QJS A;  3SBL A;  4Z7R A;  5LCF A;  5KIL A;  2UYX A;  2OHH A;  4RBS A;  3I13 A;  3X2Y A;  2BG2 A;  1P9E A;  5FQC A;  5AHR A;  4CHL A;  2BFK A;  3BK1 A;  5ACP A;  2GKL A;  3RKK A;  2ZZI A;  5DPX A;  4TZE A;  1X8H A;  4TZB A;  2YNV B;  1DD6 A;  3IEK A;  5ACW A;  3SFP A;  4PVT A;  3H3E A;  2BFZ B;  4YSB A;  2NZF A;  5LMC A;  4V0H A;  4C1C A;  3IE0 A;  2I7V A;  4NQ2 A;  3ZWF A;  1ZTC A;  4RM5 A;  4FSB A;  2P4Z A;  5AYA A;  1L9Y A;  2Q42 A;  3BV6 A;  5FQB A;  5ACS A;  3I14 A;  2BTN A;  2Q0I A;  2FHX A;  3L6N A;  1BVT A;  4KEQ A;  4D02 A;  4J5F A;  2YNT B;  4YSL A;  4C1E A;  2P97 A;  3S0Z A;  5ACX A;  4AWZ A;  5ACU A;  3T9M A;  2BFL A;  5EH9 A;  4D1U A;  4Z5Y A;  5ACR A;  5B15 A;  4XWT A;  4RL2 A;  4EXS A;  2H6A A;  2QDS A;  4BP0 A;  4TZF A;  1XTO A;  4H0D A;  2OHI A;  5AEB A;  1MQO A;  3X2Z A;  5HIP A;  3KNS A;  2P1E A;  4UWR B;  2WYM C;  4HL1 A;  5EWA A;  2Q9U A;  2NYP A;  2FK6 A;  4EYF A;  2P18 A;  4BZ3 A;  3IEM A;  2ZWR A;  5B3R A;  4EYL A;  4ZNB A;  1JJE A;  4LE6 A;  2YNU A;  3P2U A;  5HH6 A;  3DHB A;  2YNW A;  4RL0 A;  5ACT A;  2YNV A;  3FAI A;  2WRS A;  5LS3 A;  1WRA A;  4NQ6 A;  2YZ3 A;  4NQ4 A;  3AF5 A;  5FQA A;  3KNR A;  4TYF A;  2BG7 A;  4ZO3 A;  3A4Y A;  2Q0J A;  2WYL A;  4UAM A; 
#chains in the Genus database with same CATH topology
 1Y44 A;  2AZ4 A;  3ZQ4 A;  3ESH A;  5EV8 A;  4AWY B;  3LVZ A;  5EVB A;  3G1P A;  4FR7 A;  2Y87 A;  5AHO A;  5LLD A;  2FU9 A;  3T3N A;  4FEK A;  1X8G A;  1ZNB A;  3BK2 A;  2CBN A;  5KIK A;  2FU7 A;  4AX0 B;  4AX1 B;  5K4N A;  1QH5 A;  4UWS B;  3DHC A;  5LCA A;  1YCG A;  2YNT A;  4ZO2 A;  4D1V A;  1VJN A;  4Z67 A;  3VPE A;  4Z5Z A;  5EW0 A;  5A87 A;  2A7M A;  5AIJ A;  1YCF A;  1WW1 A;  2ZO4 A;  5LSC A;  2WHG A;  3F9O A;  1A8T A;  2BG8 A;  2NZE A;  2WYM A;  3JXP A;  4YSK A;  5A0T A;  5ACQ A;  3R2U A;  2BGA A;  1YCH A;  4PDX A;  5HIS A;  4P62 A;  3MD7 A;  1QH3 A;  1M2X A;  3AF6 A;  4C1F A;  4GCW A;  2E7Y A;  2QDT A;  3PY5 A;  1BMC A;  3AJ3 A;  4EXY A;  3IE1 A;  4TYT A;  4GYQ A;  1E5D A;  1KR3 A;  2FHX B;  5K0W A;  4NQ5 A;  2BIB A;  2BR6 A;  3I0V A;  2M5C A;  4UBQ A;  3TP9 A;  4KEP A;  1K07 A;  4XUK A;  4HKY A;  1SML A;  5LM6 A;  2GFK A;  4EY2 A;  5K4K A;  2I7X A;  3Q6V A;  4B87 A;  3IDZ A;  2FU6 A;  4UA4 A;  4UWP B;  4F6Z A;  1VGN A;  1XM8 A;  4O98 A;  3IOG A;  2YCB A;  4RAW A;  5EV6 A;  5AJL A;  2Y8B A;  4Z60 A;  3ZNB A;  2CG3 A;  1DDK A;  4ZEJ A;  4C1D A;  1WUP A;  5A5Z A;  3WXC A;  2YHE A;  2Y8A A;  2GCU A;  3I11 A;  2DKF A;  4EYB A;  3KL7 A;  4C09 A;  1VME A;  3T3O A;  2OHJ A;  1JJT A;  1A7T A;  4GYU A;  3VQZ A;  2XR1 A;  2QED A;  2R2D A;  5ACV A;  2M5D A;  2VW8 A;  4Z6X A;  2NXA A;  4AD9 A;  4AV7 A;  4XWW A;  2XF4 A;  4HL2 A;  3ZR9 A;  2ZNB A;  1HLK A;  4U4L A;  4EFZ A;  2GFJ A;  2I7T A;  2FM6 A;  2GMN A;  2BFZ A;  5LE1 A;  4JO0 A;  3DHA A;  5A0V A;  5LCH A;  3SD9 A;  3IOF A;  3ADR A;  3IE2 A;  3SRX A;  4D1T A;  3QH8 A;  1WUO A;  4WD6 A;  2FU8 A;  3DH8 A;  1KO2 A;  1X8I A;  3X30 A;  3I15 A;  2QIN A;  5EHT A;  3IEL A;  5HIQ A;  1BC2 A;  2AIO A;  1DXK A;  2BMI A;  4DIL A;  4DIK A;  3SPU A;  5HH5 A;  1ZKP A;  5AXO A;  5HIO A;  2BG6 A;  5IQK A;  1JT1 A;  4J5H A;  3RKJ A;  4C1H A;  5EVK A;  1KO3 A;  3PG4 A;  2CFU A;  4F6H A;  5K4M A;  3RPC A;  2CG2 A;  4TZ9 A;  4RAM A;  5EVD A;  3PY6 A;  3SW3 A;  4PVO A;  4D1W A;  2BG8 B;  3BC2 A;  5B1U A;  2DOO A;  5AXR A;  2HB9 A;  4C1G A;  2BC2 A;  3X2X A;  5A23 A;  3FCZ A;  4UWO B;  5HH4 A;  2QJS A;  3SBL A;  4Z7R A;  5LCF A;  5KIL A;  2UYX A;  2OHH A;  4RBS A;  3I13 A;  3X2Y A;  2BG2 A;  1P9E A;  5FQC A;  5AHR A;  4CHL A;  4AXH A;  2BFK A;  3BK1 A;  5ACP A;  2GKL A;  3RKK A;  2ZZI A;  5DPX A;  4TZE A;  1X8H A;  4TZB A;  2YNV B;  1DD6 A;  3IEK A;  5ACW A;  3SFP A;  4PVT A;  3H3E A;  2BFZ B;  4YSB A;  2NZF A;  5LMC A;  4V0H A;  4C1C A;  3IE0 A;  2I7V A;  4NQ2 A;  3ZWF A;  1ZTC A;  4RM5 A;  4FSB A;  2P4Z A;  5AYA A;  1L9Y A;  2Q42 A;  3BV6 A;  5FQB A;  5ACS A;  3I14 A;  2BTN A;  2Q0I A;  2FHX A;  3L6N A;  1BVT A;  4KEQ A;  4D02 A;  4J5F A;  2YNT B;  4YSL A;  4C1E A;  2P97 A;  3S0Z A;  5ACX A;  4AWZ A;  5ACU A;  3T9M A;  2BFL A;  5EH9 A;  4D1U A;  4Z5Y A;  5ACR A;  5B15 A;  4XWT A;  4RL2 A;  4EXS A;  2H6A A;  2QDS A;  4BP0 A;  4TZF A;  1XTO A;  4H0D A;  2OHI A;  5AEB A;  1MQO A;  3X2Z A;  5HIP A;  3KNS A;  2P1E A;  4UWR B;  2WYM C;  4HL1 A;  5EWA A;  2Q9U A;  2NYP A;  2FK6 A;  4EYF A;  2P18 A;  4BZ3 A;  3IEM A;  2ZWR A;  5B3R A;  4EYL A;  4ZNB A;  1JJE A;  4LE6 A;  2YNU A;  3P2U A;  5HH6 A;  3DHB A;  2YNW A;  4NUR A;  2CFZ A;  4RL0 A;  5ACT A;  2YNV A;  3FAI A;  2WRS A;  5LS3 A;  1WRA A;  4NQ6 A;  2YZ3 A;  4NQ4 A;  3AF5 A;  5FQA A;  3KNR A;  4TYF A;  2BG7 A;  4ZO3 A;  3A4Y A;  2Q0J A;  2WYL A;  4UAM A; 
#chains in the Genus database with same CATH homology
 1Y44 A;  2AZ4 A;  3ZQ4 A;  3ESH A;  5EV8 A;  4AWY B;  3LVZ A;  5EVB A;  3G1P A;  4FR7 A;  2Y87 A;  5AHO A;  5LLD A;  2FU9 A;  3T3N A;  4FEK A;  1X8G A;  1ZNB A;  3BK2 A;  2CBN A;  5KIK A;  2FU7 A;  4AX0 B;  4AX1 B;  5K4N A;  1QH5 A;  4UWS B;  3DHC A;  5LCA A;  1YCG A;  2YNT A;  4ZO2 A;  4D1V A;  1VJN A;  4Z67 A;  3VPE A;  4Z5Z A;  5EW0 A;  5A87 A;  2A7M A;  1YCF A;  1WW1 A;  2ZO4 A;  5LSC A;  2WHG A;  3F9O A;  1A8T A;  2BG8 A;  2NZE A;  2WYM A;  3JXP A;  4YSK A;  5A0T A;  5ACQ A;  3R2U A;  2BGA A;  1YCH A;  5HIS A;  4P62 A;  3MD7 A;  1QH3 A;  1M2X A;  3AF6 A;  4C1F A;  4GCW A;  2E7Y A;  2QDT A;  3PY5 A;  1BMC A;  3AJ3 A;  4EXY A;  3IE1 A;  4TYT A;  4GYQ A;  1E5D A;  1KR3 A;  2FHX B;  5K0W A;  4NQ5 A;  2BIB A;  2BR6 A;  3I0V A;  2M5C A;  4UBQ A;  3TP9 A;  4KEP A;  1K07 A;  4XUK A;  4HKY A;  1SML A;  5LM6 A;  2GFK A;  4EY2 A;  5K4K A;  2I7X A;  3Q6V A;  4B87 A;  3IDZ A;  2FU6 A;  4UA4 A;  4UWP B;  4F6Z A;  1VGN A;  1XM8 A;  4O98 A;  3IOG A;  2YCB A;  4RAW A;  5EV6 A;  2Y8B A;  4Z60 A;  3ZNB A;  1DDK A;  4ZEJ A;  4C1D A;  1WUP A;  5A5Z A;  3WXC A;  2Y8A A;  2GCU A;  3I11 A;  2DKF A;  4EYB A;  3KL7 A;  4C09 A;  1VME A;  3T3O A;  2OHJ A;  1JJT A;  1A7T A;  4GYU A;  3VQZ A;  2XR1 A;  2QED A;  2R2D A;  5ACV A;  2M5D A;  2VW8 A;  4Z6X A;  2NXA A;  4AD9 A;  4XWW A;  2XF4 A;  4HL2 A;  3ZR9 A;  2ZNB A;  1HLK A;  4U4L A;  4EFZ A;  2GFJ A;  2I7T A;  2FM6 A;  2GMN A;  2BFZ A;  5LE1 A;  4JO0 A;  3DHA A;  5A0V A;  5LCH A;  3SD9 A;  3IOF A;  3ADR A;  3IE2 A;  3SRX A;  4D1T A;  3QH8 A;  1WUO A;  4WD6 A;  2FU8 A;  3DH8 A;  1KO2 A;  1X8I A;  3X30 A;  3I15 A;  2QIN A;  5EHT A;  3IEL A;  5HIQ A;  1BC2 A;  2AIO A;  1DXK A;  2BMI A;  4DIL A;  4DIK A;  3SPU A;  5HH5 A;  1ZKP A;  5AXO A;  5HIO A;  2BG6 A;  5IQK A;  1JT1 A;  4J5H A;  3RKJ A;  4C1H A;  5EVK A;  1KO3 A;  3PG4 A;  4F6H A;  5K4M A;  3RPC A;  4TZ9 A;  4RAM A;  5EVD A;  3PY6 A;  3SW3 A;  4PVO A;  4D1W A;  2BG8 B;  3BC2 A;  5B1U A;  2DOO A;  5AXR A;  2HB9 A;  4C1G A;  2BC2 A;  3X2X A;  3FCZ A;  4UWO B;  5HH4 A;  2QJS A;  3SBL A;  4Z7R A;  5LCF A;  5KIL A;  2UYX A;  2OHH A;  4RBS A;  3I13 A;  3X2Y A;  2BG2 A;  1P9E A;  5FQC A;  5AHR A;  4CHL A;  2BFK A;  3BK1 A;  5ACP A;  2GKL A;  3RKK A;  2ZZI A;  5DPX A;  4TZE A;  1X8H A;  4TZB A;  2YNV B;  1DD6 A;  3IEK A;  5ACW A;  3SFP A;  4PVT A;  3H3E A;  2BFZ B;  4YSB A;  2NZF A;  5LMC A;  4V0H A;  4C1C A;  3IE0 A;  2I7V A;  4NQ2 A;  3ZWF A;  1ZTC A;  4RM5 A;  4FSB A;  2P4Z A;  5AYA A;  1L9Y A;  2Q42 A;  3BV6 A;  5FQB A;  5ACS A;  3I14 A;  2BTN A;  2Q0I A;  2FHX A;  3L6N A;  1BVT A;  4KEQ A;  4D02 A;  4J5F A;  2YNT B;  4YSL A;  4C1E A;  2P97 A;  3S0Z A;  5ACX A;  4AWZ A;  5ACU A;  3T9M A;  2BFL A;  5EH9 A;  4D1U A;  4Z5Y A;  5ACR A;  5B15 A;  4XWT A;  4RL2 A;  4EXS A;  2H6A A;  2QDS A;  4BP0 A;  4TZF A;  1XTO A;  4H0D A;  2OHI A;  5AEB A;  1MQO A;  3X2Z A;  5HIP A;  3KNS A;  2P1E A;  4UWR B;  2WYM C;  4HL1 A;  5EWA A;  2Q9U A;  2NYP A;  2FK6 A;  4EYF A;  2P18 A;  4BZ3 A;  3IEM A;  2ZWR A;  5B3R A;  4EYL A;  4ZNB A;  1JJE A;  4LE6 A;  2YNU A;  3P2U A;  5HH6 A;  3DHB A;  2YNW A;  4RL0 A;  5ACT A;  2YNV A;  3FAI A;  2WRS A;  5LS3 A;  1WRA A;  4NQ6 A;  2YZ3 A;  4NQ4 A;  3AF5 A;  5FQA A;  3KNR A;  4TYF A;  2BG7 A;  4ZO3 A;  3A4Y A;  2Q0J A;  2WYL A;  4UAM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...