4EFZA

Crystal structure of a hypothetical metallo-beta-lactamase from burkholderia pseudomallei
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
298
structure length
295
Chain Sequence
GPGSMTVEGFFDPATCTISYLLFDSGSGECALIDSVLDYDPKSGRTRTASADQLIARVAALGARVRWLLETHVHADHLSAAPYLKTRVGGEIAIGRHVTRVQDVFGKLFNAGPAFAHDGSQFDRLLDDGDTLALGALSIRAMHTPGHTPACMTYVVTEAHAAHDARDAAAFVGDTLFMPDYGTARCDFPGGDARSLYRSIRKVLSLPPATRLYMCHDYQPAIQYASTVADELRENVHIREGVTEDDFVAMRTARDATLDMPVLMLPSVQVNMRAGRLPEPEDNGVRYLKIPLDAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Metallo-beta-lactamase family protein
publication title Crystal Structure of a hypothetical metallo-beta-lactamase from Burkholderia pseudomallei
rcsb
source organism Burkholderia pseudomallei
total genus 97
structure length 295
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4efzA00
4F6HA 3DH8A 4ZO2A 2ZZIA 4NQ6A 3WXCA 3MD7A 2AZ4A 3PY5A 2Q0IA 3T3OA 4Z5ZA 2E7YA 3I0VA 4TZBA 4Z5YA 3LVZA 3ZWFA 4GYQA 3X2ZA 3ZQ4A 4B87A 5ACPA 4GCWA 1ZKPA 3SW3A 2NXAA 4GYUA 4F6ZA 4V0HA 3SD9A 4J5HA 1A8TA 2P97A 4UWOB 1HLKA 2FK6A 5HISA 3VQZA 2QDTA 4AD9A 2WYMC 3I15A 2XR1A 2BTNA 5A0VA 2FU7A 5LCFA 3IEKA 1X8GA 1SMLA 4TZ9A 3T3NA 3FCZA 5K0WA 4HL2A 5LCHA 2P18A 1KO2A 4D1TA 3JXPA 2Q42A 4D1VA 1JT1A 4H0DA 4CHLA 4NQ4A 2Q9UA 5K4NA 4RBSA 2YZ3A 2I7TA 5ACQA 5HIQA 1A7TA 2BFZA 4D02A 2QDSA 5HH5A 4KEQA 4TYTA 1DDKA 5EW0A 3X2XA 3SBLA 2XF4A 5EHTA 4J5FA 4NQ5A 4RAMA 3KL7A 2A7MA 5FQAA 5B15A 1E5DA 1VJNA 3RKKA 4Z7RA 1BVTA 1BC2A 5ACSA 3BV6A 4XWTA 4TZFA 2CBNA 5LLDA 4U4LA 1DXKA 5ACUA 3VPEA 3H3EA 1X8HA 1KR3A 3IELA 5EV6A 4UAMA 4AWZA 2M5DA 2BG8B 5AXOA 2FU8A 2QINA 4O98A 3IOFA 1KO3A 3QH8A 1XM8A 1QH5A 2BIBA 5KIKA 2FM6A 3S0ZA 4UA4A 4C1EA 2FU6A 2YNTB 5DPXA 2AIOA 4KEPA 4RL0A 4TZEA 4AX1B 2UYXA 4HL1A 4YSKA 5HIPA 2YNVA 3T9MA 4DIKA 2WYLA 4DILA 5AYAA 2BG2A 4UWRB 4D1WA 2ZWRA 3I11A 2WHGA 5K4KA 2FHXA 3ADRA 3SPUA 5EV8A 3X30A 4C1FA 1Y44A 1ZTCA 2BG7A 4BZ3A 5ACTA 3IE0A 3ESHA 2GMNA 4YSBA 4XWWA 2Y8BA 4RL2A 1YCFA 5IQKA 2BC2A 2OHIA 1ZNBA 4EXSA 2I7VA 2OHJA 5ACWA 5ACXA 1L9YA 1VMEA 3PY6A 2BFLA 2BFKA 2BGAA 3X2YA 1X8IA 5EVKA 3AJ3A 5AHOA 2NYPA 2GCUA 3IOGA 2P1EA 4C1CA 4ZNBA 5LM6A 3RKJA 4LE6A 4RM5A 1P9EA 2GFJA 3I14A 4PVOA 3AF6A 1JJEA 2GKLA 4ZO3A 1DD6A 2NZFA 1WUPA 4AX0B 4RAWA 4WD6A 2P4ZA 1YCHA 2ZNBA 1MQOA 5EWAA 2DOOA 3DHCA 3KNSA 1QH3A 3SRXA 2Y8AA 5A0TA 4EYFA 3BK1A 3P2UA 5LE1A 2M5CA 4NQ2A 1JJTA 4FEKA 2Q0JA 2YNUA 4UWPB 3BK2A 4TYFA 2GFKA 4AWYB 2QJSA 3RPCA 3AF5A 5ACVA 3DHBA 3ZNBA 4XUKA 1WW1A 4FSBA 4Z6XA 2BR6A 3ZR9A 1M2XA 3KNRA 3DHAA 4EY2A 1XTOA 5EH9A 1YCGA 2OHHA 4D1UA 2FU9A 2H6AA 4UBQA 3IDZA 5HH6A 3G1PA 2BFZB 2DKFA 2WYMA 3IE2A 4HKYA 3PG4A 5EVBA 5B1UA 2QEDA 1K07A 1BMCA 4EXYA 1VGNA 4C09A 2BG6A 2Y87A 3SFPA 4BP0A 4YSLA 5FQBA 4EYBA 3IE1A 5A87A 2R2DA 3R2UA 3BC2A 4Z67A 5B3RA 4C1DA 2I7XA 2BG8A 4PVTA 4FR7A 5EVDA 5LCAA 5A5ZA 1WUOA 2YNTA 2YCBA 5HH4A 3FAIA 4C1HA 2NZEA 3F9OA 2ZO4A 5ACRA 5HIOA 3IEMA 2YNVB 5LMCA 5AEBA 4C1GA 3L6NA 5AXRA 5K4MA 2HB9A 2FHXB 3I13A 2WRSA 4EYLA 4ZEJA 4JO0A 4UWSB 5LSCA 2BMIA 2YNWA 5KILA 4Z60A 5FQCA 1WRAA 3A4YA 4P62A 2VW8A 3TP9A 4EFZA 5AHRA 3Q6VA 5LS3A
chains in the Genus database with same CATH superfamily
4F6HA 3DH8A 4ZO2A 2ZZIA 4NQ6A 3WXCA 3MD7A 2AZ4A 3PY5A 2Q0IA 3T3OA 4Z5ZA 2E7YA 3I0VA 4TZBA 4Z5YA 3LVZA 3ZWFA 2CFZA 4GYQA 3X2ZA 3ZQ4A 4B87A 5ACPA 4GCWA 1ZKPA 3SW3A 2NXAA 5AJLA 4GYUA 4F6ZA 5AIJA 4V0HA 3SD9A 4J5HA 1A8TA 2P97A 4UWOB 1HLKA 2FK6A 5HISA 3VQZA 2QDTA 4AD9A 2WYMC 3I15A 2XR1A 2BTNA 5A0VA 2FU7A 5LCFA 3IEKA 1X8GA 1SMLA 4TZ9A 3T3NA 3FCZA 5K0WA 2CG2A 4HL2A 5LCHA 2P18A 1KO2A 4D1TA 3JXPA 4PDXA 2Q42A 4D1VA 1JT1A 4H0DA 4CHLA 4NQ4A 2Q9UA 5K4NA 4RBSA 2YZ3A 2CG3A 2I7TA 5ACQA 5HIQA 1A7TA 2BFZA 4D02A 2QDSA 5HH5A 4KEQA 4TYTA 1DDKA 5EW0A 3X2XA 3SBLA 2XF4A 5EHTA 4J5FA 4NQ5A 4RAMA 3KL7A 2A7MA 5FQAA 5B15A 1E5DA 1VJNA 3RKKA 4Z7RA 1BVTA 1BC2A 5ACSA 3BV6A 4XWTA 4TZFA 2CBNA 5LLDA 4U4LA 1DXKA 5ACUA 3VPEA 3H3EA 1X8HA 1KR3A 3IELA 5EV6A 2YHEA 4UAMA 4AWZA 2M5DA 2BG8B 5AXOA 2FU8A 2QINA 4O98A 3IOFA 1KO3A 3QH8A 1XM8A 1QH5A 2BIBA 5KIKA 2FM6A 3S0ZA 4UA4A 4C1EA 2FU6A 2YNTB 5DPXA 2AIOA 4KEPA 4RL0A 4TZEA 4AX1B 2UYXA 4HL1A 4YSKA 5HIPA 2YNVA 3T9MA 4DIKA 2WYLA 4DILA 5AYAA 2BG2A 4UWRB 4D1WA 2ZWRA 3I11A 2WHGA 5K4KA 2FHXA 3ADRA 3SPUA 5EV8A 3X30A 4C1FA 1Y44A 1ZTCA 2BG7A 4BZ3A 5ACTA 4AXHA 3IE0A 3ESHA 2GMNA 4YSBA 4XWWA 2Y8BA 4NURA 4RL2A 1YCFA 5IQKA 2BC2A 2OHIA 1ZNBA 4EXSA 2I7VA 2OHJA 5ACWA 5ACXA 1L9YA 1VMEA 3PY6A 2BFLA 2BFKA 2BGAA 3X2YA 1X8IA 5EVKA 3AJ3A 5AHOA 2NYPA 2GCUA 3IOGA 2P1EA 4C1CA 4ZNBA 5LM6A 3RKJA 4LE6A 4RM5A 1P9EA 2GFJA 3I14A 4PVOA 3AF6A 1JJEA 2GKLA 4ZO3A 1DD6A 2NZFA 1WUPA 4AX0B 4RAWA 4WD6A 2P4ZA 1YCHA 2ZNBA 1MQOA 5EWAA 2DOOA 3DHCA 3KNSA 1QH3A 3SRXA 2Y8AA 5A0TA 4EYFA 3BK1A 3P2UA 5LE1A 2M5CA 4NQ2A 1JJTA 4FEKA 2Q0JA 2YNUA 4UWPB 3BK2A 4TYFA 2GFKA 4AWYB 2QJSA 3RPCA 3AF5A 5ACVA 3DHBA 3ZNBA 4XUKA 1WW1A 4FSBA 4Z6XA 2BR6A 3ZR9A 1M2XA 3KNRA 3DHAA 4EY2A 1XTOA 5EH9A 1YCGA 2OHHA 4D1UA 2FU9A 2H6AA 4UBQA 3IDZA 5HH6A 3G1PA 2BFZB 2DKFA 2WYMA 3IE2A 4HKYA 3PG4A 5EVBA 5B1UA 2QEDA 1K07A 1BMCA 4EXYA 1VGNA 4C09A 2BG6A 2Y87A 3SFPA 4BP0A 4YSLA 5FQBA 4EYBA 3IE1A 5A87A 2R2DA 3R2UA 3BC2A 4Z67A 5B3RA 4C1DA 2I7XA 2BG8A 4PVTA 4FR7A 5EVDA 5LCAA 5A5ZA 1WUOA 2YNTA 2YCBA 5HH4A 5A23A 3FAIA 4C1HA 2NZEA 3F9OA 2ZO4A 5ACRA 5HIOA 3IEMA 2YNVB 5LMCA 5AEBA 4C1GA 3L6NA 5AXRA 5K4MA 2HB9A 2FHXB 3I13A 2WRSA 4EYLA 4ZEJA 4JO0A 4UWSB 5LSCA 2BMIA 2YNWA 5KILA 4AV7A 4Z60A 5FQCA 1WRAA 3A4YA 4P62A 2VW8A 3TP9A 2CFUA 4EFZA 5AHRA 3Q6VA 5LS3A
chains in the Genus database with same CATH topology
4F6HA 3DH8A 4ZO2A 2ZZIA 4NQ6A 3WXCA 3MD7A 2AZ4A 3PY5A 2Q0IA 3T3OA 4Z5ZA 2E7YA 3I0VA 4TZBA 4Z5YA 3LVZA 3ZWFA 4GYQA 3X2ZA 3ZQ4A 4B87A 5ACPA 4GCWA 1ZKPA 3SW3A 2NXAA 4GYUA 4F6ZA 4V0HA 3SD9A 4J5HA 1A8TA 2P97A 4UWOB 1HLKA 2FK6A 5HISA 3VQZA 2QDTA 4AD9A 2WYMC 3I15A 2XR1A 2BTNA 5A0VA 2FU7A 5LCFA 3IEKA 1X8GA 1SMLA 4TZ9A 3T3NA 3FCZA 5K0WA 4HL2A 5LCHA 2P18A 1KO2A 4D1TA 3JXPA 2Q42A 4D1VA 1JT1A 4H0DA 4CHLA 4NQ4A 2Q9UA 5K4NA 4RBSA 2YZ3A 2I7TA 5ACQA 5HIQA 1A7TA 2BFZA 4D02A 2QDSA 5HH5A 4KEQA 4TYTA 1DDKA 5EW0A 3X2XA 3SBLA 2XF4A 5EHTA 4J5FA 4NQ5A 4RAMA 3KL7A 2A7MA 5FQAA 5B15A 1E5DA 1VJNA 3RKKA 4Z7RA 1BVTA 1BC2A 5ACSA 3BV6A 4XWTA 4TZFA 2CBNA 5LLDA 4U4LA 1DXKA 5ACUA 3VPEA 3H3EA 1X8HA 1KR3A 3IELA 5EV6A 4UAMA 4AWZA 2M5DA 2BG8B 5AXOA 2FU8A 2QINA 4O98A 3IOFA 1KO3A 3QH8A 1XM8A 1QH5A 2BIBA 5KIKA 2FM6A 3S0ZA 4UA4A 4C1EA 2FU6A 2YNTB 5DPXA 2AIOA 4KEPA 4RL0A 4TZEA 4AX1B 2UYXA 4HL1A 4YSKA 5HIPA 2YNVA 3T9MA 4DIKA 2WYLA 4DILA 5AYAA 2BG2A 4UWRB 4D1WA 2ZWRA 3I11A 2WHGA 5K4KA 2FHXA 3ADRA 3SPUA 5EV8A 3X30A 4C1FA 1Y44A 1ZTCA 2BG7A 4BZ3A 5ACTA 3IE0A 3ESHA 2GMNA 4YSBA 4XWWA 2Y8BA 4RL2A 1YCFA 5IQKA 2BC2A 2OHIA 1ZNBA 4EXSA 2I7VA 2OHJA 5ACWA 5ACXA 1L9YA 1VMEA 3PY6A 2BFLA 2BFKA 2BGAA 3X2YA 1X8IA 5EVKA 3AJ3A 5AHOA 2NYPA 2GCUA 3IOGA 2P1EA 4C1CA 4ZNBA 5LM6A 3RKJA 4LE6A 4RM5A 1P9EA 2GFJA 3I14A 4PVOA 3AF6A 1JJEA 2GKLA 4ZO3A 1DD6A 2NZFA 1WUPA 4AX0B 4RAWA 4WD6A 2P4ZA 1YCHA 2ZNBA 1MQOA 5EWAA 2DOOA 3DHCA 3KNSA 1QH3A 3SRXA 2Y8AA 5A0TA 4EYFA 3BK1A 3P2UA 5LE1A 2M5CA 4NQ2A 1JJTA 4FEKA 2Q0JA 2YNUA 4UWPB 3BK2A 4TYFA 2GFKA 4AWYB 2QJSA 3RPCA 3AF5A 5ACVA 3DHBA 3ZNBA 4XUKA 1WW1A 4FSBA 4Z6XA 2BR6A 3ZR9A 1M2XA 3KNRA 3DHAA 4EY2A 1XTOA 5EH9A 1YCGA 2OHHA 4D1UA 2FU9A 2H6AA 4UBQA 3IDZA 5HH6A 3G1PA 2BFZB 2DKFA 2WYMA 3IE2A 4HKYA 3PG4A 5EVBA 5B1UA 2QEDA 1K07A 1BMCA 4EXYA 1VGNA 4C09A 2BG6A 2Y87A 3SFPA 4BP0A 4YSLA 5FQBA 4EYBA 3IE1A 5A87A 2R2DA 3R2UA 3BC2A 4Z67A 5B3RA 4C1DA 2I7XA 2BG8A 4PVTA 4FR7A 5EVDA 5LCAA 5A5ZA 1WUOA 2YNTA 2YCBA 5HH4A 3FAIA 4C1HA 2NZEA 3F9OA 2ZO4A 5ACRA 5HIOA 3IEMA 2YNVB 5LMCA 5AEBA 4C1GA 3L6NA 5AXRA 5K4MA 2HB9A 2FHXB 3I13A 2WRSA 4EYLA 4ZEJA 4JO0A 4UWSB 5LSCA 2BMIA 2YNWA 5KILA 4Z60A 5FQCA 1WRAA 3A4YA 4P62A 2VW8A 3TP9A 4EFZA 5AHRA 3Q6VA 5LS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F6H A;  3DH8 A;  4ZO2 A;  2ZZI A;  4NQ6 A;  3WXC A;  3MD7 A;  2AZ4 A;  3PY5 A;  2Q0I A;  3T3O A;  4Z5Z A;  2E7Y A;  3I0V A;  4TZB A;  4Z5Y A;  3LVZ A;  3ZWF A;  4GYQ A;  3X2Z A;  3ZQ4 A;  4B87 A;  5ACP A;  4GCW A;  1ZKP A;  3SW3 A;  2NXA A;  4GYU A;  4F6Z A;  4V0H A;  3SD9 A;  4J5H A;  1A8T A;  2P97 A;  4UWO B;  1HLK A;  2FK6 A;  5HIS A;  3VQZ A;  2QDT A;  4AD9 A;  2WYM C;  3I15 A;  2XR1 A;  2BTN A;  5A0V A;  2FU7 A;  5LCF A;  3IEK A;  1X8G A;  1SML A;  4TZ9 A;  3T3N A;  3FCZ A;  5K0W A;  4HL2 A;  5LCH A;  2P18 A;  1KO2 A;  4D1T A;  3JXP A;  2Q42 A;  4D1V A;  1JT1 A;  4H0D A;  4CHL A;  4NQ4 A;  2Q9U A;  5K4N A;  4RBS A;  2YZ3 A;  2I7T A;  5ACQ A;  5HIQ A;  1A7T A;  2BFZ A;  4D02 A;  2QDS A;  5HH5 A;  4KEQ A;  4TYT A;  1DDK A;  5EW0 A;  3X2X A;  3SBL A;  2XF4 A;  5EHT A;  4J5F A;  4NQ5 A;  4RAM A;  3KL7 A;  2A7M A;  5FQA A;  5B15 A;  1E5D A;  1VJN A;  3RKK A;  4Z7R A;  1BVT A;  1BC2 A;  5ACS A;  3BV6 A;  4XWT A;  4TZF A;  2CBN A;  5LLD A;  4U4L A;  1DXK A;  5ACU A;  3VPE A;  3H3E A;  1X8H A;  1KR3 A;  3IEL A;  5EV6 A;  4UAM A;  4AWZ A;  2M5D A;  2BG8 B;  5AXO A;  2FU8 A;  2QIN A;  4O98 A;  3IOF A;  1KO3 A;  3QH8 A;  1XM8 A;  1QH5 A;  2BIB A;  5KIK A;  2FM6 A;  3S0Z A;  4UA4 A;  4C1E A;  2FU6 A;  2YNT B;  5DPX A;  2AIO A;  4KEP A;  4RL0 A;  4TZE A;  4AX1 B;  2UYX A;  4HL1 A;  4YSK A;  5HIP A;  2YNV A;  3T9M A;  4DIK A;  2WYL A;  4DIL A;  5AYA A;  2BG2 A;  4UWR B;  4D1W A;  2ZWR A;  3I11 A;  2WHG A;  5K4K A;  2FHX A;  3ADR A;  3SPU A;  5EV8 A;  3X30 A;  4C1F A;  1Y44 A;  1ZTC A;  2BG7 A;  4BZ3 A;  5ACT A;  3IE0 A;  3ESH A;  2GMN A;  4YSB A;  4XWW A;  2Y8B A;  4RL2 A;  1YCF A;  5IQK A;  2BC2 A;  2OHI A;  1ZNB A;  4EXS A;  2I7V A;  2OHJ A;  5ACW A;  5ACX A;  1L9Y A;  1VME A;  3PY6 A;  2BFL A;  2BFK A;  2BGA A;  3X2Y A;  1X8I A;  5EVK A;  3AJ3 A;  5AHO A;  2NYP A;  2GCU A;  3IOG A;  2P1E A;  4C1C A;  4ZNB A;  5LM6 A;  3RKJ A;  4LE6 A;  4RM5 A;  1P9E A;  2GFJ A;  3I14 A;  4PVO A;  3AF6 A;  1JJE A;  2GKL A;  4ZO3 A;  1DD6 A;  2NZF A;  1WUP A;  4AX0 B;  4RAW A;  4WD6 A;  2P4Z A;  1YCH A;  2ZNB A;  1MQO A;  5EWA A;  2DOO A;  3DHC A;  3KNS A;  1QH3 A;  3SRX A;  2Y8A A;  5A0T A;  4EYF A;  3BK1 A;  3P2U A;  5LE1 A;  2M5C A;  4NQ2 A;  1JJT A;  4FEK A;  2Q0J A;  2YNU A;  4UWP B;  3BK2 A;  4TYF A;  2GFK A;  4AWY B;  2QJS A;  3RPC A;  3AF5 A;  5ACV A;  3DHB A;  3ZNB A;  4XUK A;  1WW1 A;  4FSB A;  4Z6X A;  2BR6 A;  3ZR9 A;  1M2X A;  3KNR A;  3DHA A;  4EY2 A;  1XTO A;  5EH9 A;  1YCG A;  2OHH A;  4D1U A;  2FU9 A;  2H6A A;  4UBQ A;  3IDZ A;  5HH6 A;  3G1P A;  2BFZ B;  2DKF A;  2WYM A;  3IE2 A;  4HKY A;  3PG4 A;  5EVB A;  5B1U A;  2QED A;  1K07 A;  1BMC A;  4EXY A;  1VGN A;  4C09 A;  2BG6 A;  2Y87 A;  3SFP A;  4BP0 A;  4YSL A;  5FQB A;  4EYB A;  3IE1 A;  5A87 A;  2R2D A;  3R2U A;  3BC2 A;  4Z67 A;  5B3R A;  4C1D A;  2I7X A;  2BG8 A;  4PVT A;  4FR7 A;  5EVD A;  5LCA A;  5A5Z A;  1WUO A;  2YNT A;  2YCB A;  5HH4 A;  3FAI A;  4C1H A;  2NZE A;  3F9O A;  2ZO4 A;  5ACR A;  5HIO A;  3IEM A;  2YNV B;  5LMC A;  5AEB A;  4C1G A;  3L6N A;  5AXR A;  5K4M A;  2HB9 A;  2FHX B;  3I13 A;  2WRS A;  4EYL A;  4ZEJ A;  4JO0 A;  4UWS B;  5LSC A;  2BMI A;  2YNW A;  5KIL A;  4Z60 A;  5FQC A;  1WRA A;  3A4Y A;  4P62 A;  2VW8 A;  3TP9 A;  4EFZ A;  5AHR A;  3Q6V A;  5LS3 A; 
#chains in the Genus database with same CATH topology
 4F6H A;  3DH8 A;  4ZO2 A;  2ZZI A;  4NQ6 A;  3WXC A;  3MD7 A;  2AZ4 A;  3PY5 A;  2Q0I A;  3T3O A;  4Z5Z A;  2E7Y A;  3I0V A;  4TZB A;  4Z5Y A;  3LVZ A;  3ZWF A;  2CFZ A;  4GYQ A;  3X2Z A;  3ZQ4 A;  4B87 A;  5ACP A;  4GCW A;  1ZKP A;  3SW3 A;  2NXA A;  5AJL A;  4GYU A;  4F6Z A;  5AIJ A;  4V0H A;  3SD9 A;  4J5H A;  1A8T A;  2P97 A;  4UWO B;  1HLK A;  2FK6 A;  5HIS A;  3VQZ A;  2QDT A;  4AD9 A;  2WYM C;  3I15 A;  2XR1 A;  2BTN A;  5A0V A;  2FU7 A;  5LCF A;  3IEK A;  1X8G A;  1SML A;  4TZ9 A;  3T3N A;  3FCZ A;  5K0W A;  2CG2 A;  4HL2 A;  5LCH A;  2P18 A;  1KO2 A;  4D1T A;  3JXP A;  4PDX A;  2Q42 A;  4D1V A;  1JT1 A;  4H0D A;  4CHL A;  4NQ4 A;  2Q9U A;  5K4N A;  4RBS A;  2YZ3 A;  2CG3 A;  2I7T A;  5ACQ A;  5HIQ A;  1A7T A;  2BFZ A;  4D02 A;  2QDS A;  5HH5 A;  4KEQ A;  4TYT A;  1DDK A;  5EW0 A;  3X2X A;  3SBL A;  2XF4 A;  5EHT A;  4J5F A;  4NQ5 A;  4RAM A;  3KL7 A;  2A7M A;  5FQA A;  5B15 A;  1E5D A;  1VJN A;  3RKK A;  4Z7R A;  1BVT A;  1BC2 A;  5ACS A;  3BV6 A;  4XWT A;  4TZF A;  2CBN A;  5LLD A;  4U4L A;  1DXK A;  5ACU A;  3VPE A;  3H3E A;  1X8H A;  1KR3 A;  3IEL A;  5EV6 A;  2YHE A;  4UAM A;  4AWZ A;  2M5D A;  2BG8 B;  5AXO A;  2FU8 A;  2QIN A;  4O98 A;  3IOF A;  1KO3 A;  3QH8 A;  1XM8 A;  1QH5 A;  2BIB A;  5KIK A;  2FM6 A;  3S0Z A;  4UA4 A;  4C1E A;  2FU6 A;  2YNT B;  5DPX A;  2AIO A;  4KEP A;  4RL0 A;  4TZE A;  4AX1 B;  2UYX A;  4HL1 A;  4YSK A;  5HIP A;  2YNV A;  3T9M A;  4DIK A;  2WYL A;  4DIL A;  5AYA A;  2BG2 A;  4UWR B;  4D1W A;  2ZWR A;  3I11 A;  2WHG A;  5K4K A;  2FHX A;  3ADR A;  3SPU A;  5EV8 A;  3X30 A;  4C1F A;  1Y44 A;  1ZTC A;  2BG7 A;  4BZ3 A;  5ACT A;  4AXH A;  3IE0 A;  3ESH A;  2GMN A;  4YSB A;  4XWW A;  2Y8B A;  4NUR A;  4RL2 A;  1YCF A;  5IQK A;  2BC2 A;  2OHI A;  1ZNB A;  4EXS A;  2I7V A;  2OHJ A;  5ACW A;  5ACX A;  1L9Y A;  1VME A;  3PY6 A;  2BFL A;  2BFK A;  2BGA A;  3X2Y A;  1X8I A;  5EVK A;  3AJ3 A;  5AHO A;  2NYP A;  2GCU A;  3IOG A;  2P1E A;  4C1C A;  4ZNB A;  5LM6 A;  3RKJ A;  4LE6 A;  4RM5 A;  1P9E A;  2GFJ A;  3I14 A;  4PVO A;  3AF6 A;  1JJE A;  2GKL A;  4ZO3 A;  1DD6 A;  2NZF A;  1WUP A;  4AX0 B;  4RAW A;  4WD6 A;  2P4Z A;  1YCH A;  2ZNB A;  1MQO A;  5EWA A;  2DOO A;  3DHC A;  3KNS A;  1QH3 A;  3SRX A;  2Y8A A;  5A0T A;  4EYF A;  3BK1 A;  3P2U A;  5LE1 A;  2M5C A;  4NQ2 A;  1JJT A;  4FEK A;  2Q0J A;  2YNU A;  4UWP B;  3BK2 A;  4TYF A;  2GFK A;  4AWY B;  2QJS A;  3RPC A;  3AF5 A;  5ACV A;  3DHB A;  3ZNB A;  4XUK A;  1WW1 A;  4FSB A;  4Z6X A;  2BR6 A;  3ZR9 A;  1M2X A;  3KNR A;  3DHA A;  4EY2 A;  1XTO A;  5EH9 A;  1YCG A;  2OHH A;  4D1U A;  2FU9 A;  2H6A A;  4UBQ A;  3IDZ A;  5HH6 A;  3G1P A;  2BFZ B;  2DKF A;  2WYM A;  3IE2 A;  4HKY A;  3PG4 A;  5EVB A;  5B1U A;  2QED A;  1K07 A;  1BMC A;  4EXY A;  1VGN A;  4C09 A;  2BG6 A;  2Y87 A;  3SFP A;  4BP0 A;  4YSL A;  5FQB A;  4EYB A;  3IE1 A;  5A87 A;  2R2D A;  3R2U A;  3BC2 A;  4Z67 A;  5B3R A;  4C1D A;  2I7X A;  2BG8 A;  4PVT A;  4FR7 A;  5EVD A;  5LCA A;  5A5Z A;  1WUO A;  2YNT A;  2YCB A;  5HH4 A;  5A23 A;  3FAI A;  4C1H A;  2NZE A;  3F9O A;  2ZO4 A;  5ACR A;  5HIO A;  3IEM A;  2YNV B;  5LMC A;  5AEB A;  4C1G A;  3L6N A;  5AXR A;  5K4M A;  2HB9 A;  2FHX B;  3I13 A;  2WRS A;  4EYL A;  4ZEJ A;  4JO0 A;  4UWS B;  5LSC A;  2BMI A;  2YNW A;  5KIL A;  4AV7 A;  4Z60 A;  5FQC A;  1WRA A;  3A4Y A;  4P62 A;  2VW8 A;  3TP9 A;  2CFU A;  4EFZ A;  5AHR A;  3Q6V A;  5LS3 A; 
#chains in the Genus database with same CATH homology
 4F6H A;  3DH8 A;  4ZO2 A;  2ZZI A;  4NQ6 A;  3WXC A;  3MD7 A;  2AZ4 A;  3PY5 A;  2Q0I A;  3T3O A;  4Z5Z A;  2E7Y A;  3I0V A;  4TZB A;  4Z5Y A;  3LVZ A;  3ZWF A;  4GYQ A;  3X2Z A;  3ZQ4 A;  4B87 A;  5ACP A;  4GCW A;  1ZKP A;  3SW3 A;  2NXA A;  4GYU A;  4F6Z A;  4V0H A;  3SD9 A;  4J5H A;  1A8T A;  2P97 A;  4UWO B;  1HLK A;  2FK6 A;  5HIS A;  3VQZ A;  2QDT A;  4AD9 A;  2WYM C;  3I15 A;  2XR1 A;  2BTN A;  5A0V A;  2FU7 A;  5LCF A;  3IEK A;  1X8G A;  1SML A;  4TZ9 A;  3T3N A;  3FCZ A;  5K0W A;  4HL2 A;  5LCH A;  2P18 A;  1KO2 A;  4D1T A;  3JXP A;  2Q42 A;  4D1V A;  1JT1 A;  4H0D A;  4CHL A;  4NQ4 A;  2Q9U A;  5K4N A;  4RBS A;  2YZ3 A;  2I7T A;  5ACQ A;  5HIQ A;  1A7T A;  2BFZ A;  4D02 A;  2QDS A;  5HH5 A;  4KEQ A;  4TYT A;  1DDK A;  5EW0 A;  3X2X A;  3SBL A;  2XF4 A;  5EHT A;  4J5F A;  4NQ5 A;  4RAM A;  3KL7 A;  2A7M A;  5FQA A;  5B15 A;  1E5D A;  1VJN A;  3RKK A;  4Z7R A;  1BVT A;  1BC2 A;  5ACS A;  3BV6 A;  4XWT A;  4TZF A;  2CBN A;  5LLD A;  4U4L A;  1DXK A;  5ACU A;  3VPE A;  3H3E A;  1X8H A;  1KR3 A;  3IEL A;  5EV6 A;  4UAM A;  4AWZ A;  2M5D A;  2BG8 B;  5AXO A;  2FU8 A;  2QIN A;  4O98 A;  3IOF A;  1KO3 A;  3QH8 A;  1XM8 A;  1QH5 A;  2BIB A;  5KIK A;  2FM6 A;  3S0Z A;  4UA4 A;  4C1E A;  2FU6 A;  2YNT B;  5DPX A;  2AIO A;  4KEP A;  4RL0 A;  4TZE A;  4AX1 B;  2UYX A;  4HL1 A;  4YSK A;  5HIP A;  2YNV A;  3T9M A;  4DIK A;  2WYL A;  4DIL A;  5AYA A;  2BG2 A;  4UWR B;  4D1W A;  2ZWR A;  3I11 A;  2WHG A;  5K4K A;  2FHX A;  3ADR A;  3SPU A;  5EV8 A;  3X30 A;  4C1F A;  1Y44 A;  1ZTC A;  2BG7 A;  4BZ3 A;  5ACT A;  3IE0 A;  3ESH A;  2GMN A;  4YSB A;  4XWW A;  2Y8B A;  4RL2 A;  1YCF A;  5IQK A;  2BC2 A;  2OHI A;  1ZNB A;  4EXS A;  2I7V A;  2OHJ A;  5ACW A;  5ACX A;  1L9Y A;  1VME A;  3PY6 A;  2BFL A;  2BFK A;  2BGA A;  3X2Y A;  1X8I A;  5EVK A;  3AJ3 A;  5AHO A;  2NYP A;  2GCU A;  3IOG A;  2P1E A;  4C1C A;  4ZNB A;  5LM6 A;  3RKJ A;  4LE6 A;  4RM5 A;  1P9E A;  2GFJ A;  3I14 A;  4PVO A;  3AF6 A;  1JJE A;  2GKL A;  4ZO3 A;  1DD6 A;  2NZF A;  1WUP A;  4AX0 B;  4RAW A;  4WD6 A;  2P4Z A;  1YCH A;  2ZNB A;  1MQO A;  5EWA A;  2DOO A;  3DHC A;  3KNS A;  1QH3 A;  3SRX A;  2Y8A A;  5A0T A;  4EYF A;  3BK1 A;  3P2U A;  5LE1 A;  2M5C A;  4NQ2 A;  1JJT A;  4FEK A;  2Q0J A;  2YNU A;  4UWP B;  3BK2 A;  4TYF A;  2GFK A;  4AWY B;  2QJS A;  3RPC A;  3AF5 A;  5ACV A;  3DHB A;  3ZNB A;  4XUK A;  1WW1 A;  4FSB A;  4Z6X A;  2BR6 A;  3ZR9 A;  1M2X A;  3KNR A;  3DHA A;  4EY2 A;  1XTO A;  5EH9 A;  1YCG A;  2OHH A;  4D1U A;  2FU9 A;  2H6A A;  4UBQ A;  3IDZ A;  5HH6 A;  3G1P A;  2BFZ B;  2DKF A;  2WYM A;  3IE2 A;  4HKY A;  3PG4 A;  5EVB A;  5B1U A;  2QED A;  1K07 A;  1BMC A;  4EXY A;  1VGN A;  4C09 A;  2BG6 A;  2Y87 A;  3SFP A;  4BP0 A;  4YSL A;  5FQB A;  4EYB A;  3IE1 A;  5A87 A;  2R2D A;  3R2U A;  3BC2 A;  4Z67 A;  5B3R A;  4C1D A;  2I7X A;  2BG8 A;  4PVT A;  4FR7 A;  5EVD A;  5LCA A;  5A5Z A;  1WUO A;  2YNT A;  2YCB A;  5HH4 A;  3FAI A;  4C1H A;  2NZE A;  3F9O A;  2ZO4 A;  5ACR A;  5HIO A;  3IEM A;  2YNV B;  5LMC A;  5AEB A;  4C1G A;  3L6N A;  5AXR A;  5K4M A;  2HB9 A;  2FHX B;  3I13 A;  2WRS A;  4EYL A;  4ZEJ A;  4JO0 A;  4UWS B;  5LSC A;  2BMI A;  2YNW A;  5KIL A;  4Z60 A;  5FQC A;  1WRA A;  3A4Y A;  4P62 A;  2VW8 A;  3TP9 A;  4EFZ A;  5AHR A;  3Q6V A;  5LS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...