4EFZA

Crystal structure of a hypothetical metallo-beta-lactamase from burkholderia pseudomallei
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
298
structure length
295
Chain Sequence
b'GPGSMTVEGFFDPATCTISYLLFDSGSGECALIDSVLDYDPKSGRTRTASADQLIARVAALGARVRWLLETHVHADHLSAAPYLKTRVGGEIAIGRHVTRVQDVFGKLFNAGPAFAHDGSQFDRLLDDGDTLALGALSIRAMHTPGHTPACMTYVVTEAHAAHDARDAAAFVGDTLFMPDYGTARCDFPGGDARSLYRSIRKVLSLPPATRLYMCHDYQPAIQYASTVADELRENVHIREGVTEDDFVAMRTARDATLDMPVLMLPSVQVNMRAGRLPEPEDNGVRYLKIPLDAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metallo-beta-lactamase family protein
publication title Crystal Structure of a hypothetical metallo-beta-lactamase from Burkholderia pseudomallei
rcsb
source organism Burkholderia pseudomallei
molecule tags Hydrolase
total genus 97
structure length 295
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4efzA00
2M5CA 5B15A 4RM5A 4EYFA 3PY5A 5FQAA 3PG4A 4LE6A 1SMLA 3IDZA 5AHRA 2I7XA 1X8IA 1QH5A 4B87A 2NZEA 2GFJA 1Y44A 2WHGA 2NYPA 1ZNBA 3VPEA 1K07A 1DD6A 3IOFA 5HIOA 3I15A 4AWZA 4AX0B 4XUKA 2BG6A 2P1EA 3KNSA 3IE2A 3FCZA 4P62A 3IEKA 5EV8A 4Z60A 5FQCA 4KEPA 5KILA 4C1EA 3KNRA 4TZBA 2XR1A 3IELA 4V0HA 3KL7A 3VQZA 2CBNA 5EVDA 1KR3A 5EH9A 4UWSB 3BK2A 4ZO2A 2BG8B 4Z67A 4Z6XA 4C09A 1VMEA 5HIPA 5LM6A 1JJTA 5AHOA 5LSCA 3AF6A 4UBQA 5LS3A 3ZWFA 1JJEA 5LCAA 3BV6A 4H0DA 4TYFA 4ZO3A 1HLKA 5K4MA 2QDSA 4HL2A 2FU8A 2FM6A 2ZNBA 3DHBA 3RKKA 3IE1A 2YCBA 3SRXA 3MD7A 4YSKA 2BG8A 2YNTB 2A7MA 4TZEA 2DOOA 4Z7RA 4U4LA 2Q9UA 2E7YA 5A87A 4C1HA 5ACRA 1KO2A 2BFZB 2FU7A 2Q0JA 4EYLA 2P97A 4BZ3A 2YNUA 4UAMA 4XWTA 2NZFA 2Y8BA 4TYTA 2ZWRA 2R2DA 2YNVB 3SFPA 5K0WA 4DILA 4TZFA 4RL0A 5ACXA 3DH8A 4PVOA 4PVTA 2YNTA 4UWPB 4UWRB 5KIKA 4BP0A 2NXAA 4RAWA 1E5DA 1ZTCA 2BG7A 1X8GA 2AIOA 4D1UA 3BK1A 2BFZA 3I14A 2P4ZA 5EW0A 3ZNBA 4XWWA 3LVZA 5IQKA 4C1DA 2VW8A 1DXKA 5ACTA 4C1GA 4EXYA 2GKLA 1VJNA 5HH6A 2YNVA 1WUOA 2BIBA 4KEQA 4EYBA 3A4YA 2OHHA 2QEDA 5EVBA 4FR7A 2P18A 5ACUA 2YNWA 3AF5A 4D1VA 4O98A 1BMCA 4NQ5A 2BG2A 3SBLA 4ZEJA 2DKFA 1QH3A 5K4NA 5B3RA 1A8TA 3RPCA 3SD9A 4AX1B 1WW1A 2WYMA 3T3NA 2BMIA 5DPXA 4D1WA 5EHTA 2Y87A 2BR6A 4RL2A 4NQ6A 2XF4A 3WXCA 5LMCA 5AEBA 1X8HA 5A0TA 3T9MA 1DDKA 4UA4A 4Z5ZA 3I11A 3SW3A 3X2YA 2BFLA 2Q42A 3H3EA 3T3OA 2FU6A 3BC2A 3X2XA 1P9EA 2QJSA 3X2ZA 1M2XA 5A0VA 3L6NA 3IEMA 5HIQA 5AXRA 1XM8A 4HL1A 2FHXB 2M5DA 3PY6A 3F9OA 1MQOA 4NQ2A 2Q0IA 4GYQA 4YSBA 4EY2A 2QINA 1YCFA 5LE1A 5AYAA 1WUPA 5LLDA 4NQ4A 4EFZA 3ADRA 2GCUA 2ZO4A 4AD9A 3ZR9A 3I13A 4J5FA 5ACSA 3G1PA 1XTOA 5EV6A 5LCFA 5HISA 1A7TA 5ACWA 4EXSA 1L9YA 4Z5YA 4D1TA 5ACPA 3FAIA 4AWYB 3QH8A 4TZ9A 2FHXA 2ZZIA 4GYUA 5B1UA 5K4KA 2BC2A 2HB9A 3ZQ4A 4RAMA 1JT1A 4C1CA 3JXPA 4DIKA 3X30A 5FQBA 2OHIA 1YCHA 2QDTA 3DHAA 4FSBA 4JO0A 2UYXA 2I7VA 4D02A 2FU9A 2I7TA 2BGAA 5LCHA 1VGNA 5ACVA 4C1FA 2GFKA 3IE0A 3P2UA 4F6HA 2BTNA 4GCWA 2WYMC 2YZ3A 3S0ZA 2AZ4A 4UWOB 3ESHA 3I0VA 2OHJA 4WD6A 3RKJA 4YSLA 4J5HA 1KO3A 3IOGA 4F6ZA 3TP9A 5EWAA 2H6AA 3DHCA 1WRAA 1BC2A 3Q6VA 2WRSA 4CHLA 2GMNA 4HKYA 5HH5A 4FEKA 2Y8AA 5HH4A 2WYLA 2BFKA 1ZKPA 1YCGA 1BVTA 5ACQA 3R2UA 2FK6A 5AXOA 3SPUA 3AJ3A 5A5ZA 4ZNBA 5EVKA 4RBSA
chains in the Genus database with same CATH superfamily
2M5CA 5B15A 4RM5A 4EYFA 3PY5A 5FQAA 3PG4A 4LE6A 1SMLA 3IDZA 5AHRA 2I7XA 1X8IA 1QH5A 4B87A 2NZEA 2GFJA 1Y44A 2WHGA 2NYPA 1ZNBA 3VPEA 1K07A 1DD6A 3IOFA 5HIOA 3I15A 4AWZA 4AX0B 4XUKA 2BG6A 2P1EA 4AXHA 3KNSA 3IE2A 3FCZA 4P62A 3IEKA 5EV8A 4Z60A 2YHEA 4PDXA 5FQCA 4KEPA 5KILA 4C1EA 3KNRA 4TZBA 2XR1A 3IELA 4V0HA 3KL7A 3VQZA 2CBNA 5EVDA 1KR3A 5EH9A 4UWSB 3BK2A 4ZO2A 2BG8B 4Z67A 4Z6XA 4C09A 1VMEA 5HIPA 5LM6A 1JJTA 5AHOA 5LSCA 3AF6A 4UBQA 5LS3A 3ZWFA 1JJEA 5LCAA 3BV6A 4H0DA 4TYFA 4ZO3A 1HLKA 5K4MA 2QDSA 4HL2A 2FU8A 2FM6A 2ZNBA 3DHBA 3RKKA 3IE1A 2YCBA 3SRXA 3MD7A 4YSKA 2BG8A 2YNTB 2A7MA 4TZEA 2DOOA 4Z7RA 4U4LA 2Q9UA 2E7YA 5A87A 4C1HA 5ACRA 1KO2A 2BFZB 2FU7A 4AV7A 2Q0JA 4EYLA 2CFUA 2P97A 4BZ3A 2YNUA 4UAMA 4XWTA 2NZFA 2Y8BA 4TYTA 2ZWRA 2R2DA 5AJLA 2YNVB 3SFPA 5K0WA 4DILA 4TZFA 4RL0A 5ACXA 3DH8A 4PVOA 4PVTA 2YNTA 4UWPB 4UWRB 5KIKA 4BP0A 2NXAA 4RAWA 1E5DA 1ZTCA 2BG7A 1X8GA 2AIOA 4D1UA 3BK1A 2BFZA 3I14A 2P4ZA 5EW0A 3ZNBA 4XWWA 3LVZA 5IQKA 4C1DA 2VW8A 1DXKA 5ACTA 4C1GA 4EXYA 2GKLA 1VJNA 5HH6A 2YNVA 1WUOA 2BIBA 4KEQA 4EYBA 3A4YA 2OHHA 2QEDA 5EVBA 4FR7A 2P18A 5ACUA 2YNWA 3AF5A 4D1VA 4O98A 2CG3A 1BMCA 4NQ5A 2BG2A 3SBLA 4ZEJA 2DKFA 1QH3A 5K4NA 5B3RA 1A8TA 3RPCA 3SD9A 4AX1B 1WW1A 2WYMA 3T3NA 2BMIA 5DPXA 4D1WA 5EHTA 2Y87A 2BR6A 4RL2A 4NQ6A 2XF4A 3WXCA 5LMCA 5AEBA 1X8HA 5A0TA 3T9MA 1DDKA 4UA4A 4Z5ZA 3I11A 3SW3A 3X2YA 2BFLA 2Q42A 3H3EA 3T3OA 2FU6A 3BC2A 3X2XA 1P9EA 2QJSA 3X2ZA 1M2XA 2CG2A 5A0VA 3L6NA 3IEMA 5HIQA 5AXRA 1XM8A 4HL1A 5AIJA 2FHXB 2M5DA 3PY6A 3F9OA 1MQOA 4NQ2A 2Q0IA 4GYQA 4YSBA 4EY2A 2QINA 1YCFA 5LE1A 5AYAA 1WUPA 5LLDA 4NQ4A 4EFZA 3ADRA 2GCUA 2ZO4A 4AD9A 3ZR9A 3I13A 4J5FA 5ACSA 3G1PA 1XTOA 5EV6A 5LCFA 5HISA 1A7TA 5ACWA 4EXSA 1L9YA 4Z5YA 4D1TA 5ACPA 3FAIA 4AWYB 3QH8A 4TZ9A 2FHXA 2ZZIA 4GYUA 5B1UA 5K4KA 2BC2A 2HB9A 3ZQ4A 4RAMA 1JT1A 2CFZA 4C1CA 3JXPA 4DIKA 3X30A 4NURA 5FQBA 2OHIA 1YCHA 2QDTA 3DHAA 4FSBA 4JO0A 2UYXA 2I7VA 5A23A 4D02A 2FU9A 2I7TA 2BGAA 5LCHA 1VGNA 5ACVA 4C1FA 2GFKA 3IE0A 3P2UA 4F6HA 2BTNA 4GCWA 2WYMC 2YZ3A 3S0ZA 2AZ4A 4UWOB 3ESHA 3I0VA 2OHJA 4WD6A 3RKJA 4YSLA 4J5HA 1KO3A 3IOGA 4F6ZA 3TP9A 5EWAA 2H6AA 3DHCA 1WRAA 1BC2A 3Q6VA 2WRSA 4CHLA 2GMNA 4HKYA 5HH5A 4FEKA 2Y8AA 5HH4A 2WYLA 2BFKA 1ZKPA 1YCGA 1BVTA 5ACQA 3R2UA 2FK6A 5AXOA 3SPUA 3AJ3A 5A5ZA 4ZNBA 5EVKA 4RBSA
chains in the Genus database with same CATH topology
2M5CA 5B15A 4RM5A 4EYFA 3PY5A 5FQAA 3PG4A 4LE6A 1SMLA 3IDZA 5AHRA 2I7XA 1X8IA 1QH5A 4B87A 2NZEA 2GFJA 1Y44A 2WHGA 2NYPA 1ZNBA 3VPEA 1K07A 1DD6A 3IOFA 5HIOA 3I15A 4AWZA 4AX0B 4XUKA 2BG6A 2P1EA 3KNSA 3IE2A 3FCZA 4P62A 3IEKA 5EV8A 4Z60A 5FQCA 4KEPA 5KILA 4C1EA 3KNRA 4TZBA 2XR1A 3IELA 4V0HA 3KL7A 3VQZA 2CBNA 5EVDA 1KR3A 5EH9A 4UWSB 3BK2A 4ZO2A 2BG8B 4Z67A 4Z6XA 4C09A 1VMEA 5HIPA 5LM6A 1JJTA 5AHOA 5LSCA 3AF6A 4UBQA 5LS3A 3ZWFA 1JJEA 5LCAA 3BV6A 4H0DA 4TYFA 4ZO3A 1HLKA 5K4MA 2QDSA 4HL2A 2FU8A 2FM6A 2ZNBA 3DHBA 3RKKA 3IE1A 2YCBA 3SRXA 3MD7A 4YSKA 2BG8A 2YNTB 2A7MA 4TZEA 2DOOA 4Z7RA 4U4LA 2Q9UA 2E7YA 5A87A 4C1HA 5ACRA 1KO2A 2BFZB 2FU7A 2Q0JA 4EYLA 2P97A 4BZ3A 2YNUA 4UAMA 4XWTA 2NZFA 2Y8BA 4TYTA 2ZWRA 2R2DA 2YNVB 3SFPA 5K0WA 4DILA 4TZFA 4RL0A 5ACXA 3DH8A 4PVOA 4PVTA 2YNTA 4UWPB 4UWRB 5KIKA 4BP0A 2NXAA 4RAWA 1E5DA 1ZTCA 2BG7A 1X8GA 2AIOA 4D1UA 3BK1A 2BFZA 3I14A 2P4ZA 5EW0A 3ZNBA 4XWWA 3LVZA 5IQKA 4C1DA 2VW8A 1DXKA 5ACTA 4C1GA 4EXYA 2GKLA 1VJNA 5HH6A 2YNVA 1WUOA 2BIBA 4KEQA 4EYBA 3A4YA 2OHHA 2QEDA 5EVBA 4FR7A 2P18A 5ACUA 2YNWA 3AF5A 4D1VA 4O98A 1BMCA 4NQ5A 2BG2A 3SBLA 4ZEJA 2DKFA 1QH3A 5K4NA 5B3RA 1A8TA 3RPCA 3SD9A 4AX1B 1WW1A 2WYMA 3T3NA 2BMIA 5DPXA 4D1WA 5EHTA 2Y87A 2BR6A 4RL2A 4NQ6A 2XF4A 3WXCA 5LMCA 5AEBA 1X8HA 5A0TA 3T9MA 1DDKA 4UA4A 4Z5ZA 3I11A 3SW3A 3X2YA 2BFLA 2Q42A 3H3EA 3T3OA 2FU6A 3BC2A 3X2XA 1P9EA 2QJSA 3X2ZA 1M2XA 5A0VA 3L6NA 3IEMA 5HIQA 5AXRA 1XM8A 4HL1A 2FHXB 2M5DA 3PY6A 3F9OA 1MQOA 4NQ2A 2Q0IA 4GYQA 4YSBA 4EY2A 2QINA 1YCFA 5LE1A 5AYAA 1WUPA 5LLDA 4NQ4A 4EFZA 3ADRA 2GCUA 2ZO4A 4AD9A 3ZR9A 3I13A 4J5FA 5ACSA 3G1PA 1XTOA 5EV6A 5LCFA 5HISA 1A7TA 5ACWA 4EXSA 1L9YA 4Z5YA 4D1TA 5ACPA 3FAIA 4AWYB 3QH8A 4TZ9A 2FHXA 2ZZIA 4GYUA 5B1UA 5K4KA 2BC2A 2HB9A 3ZQ4A 4RAMA 1JT1A 4C1CA 3JXPA 4DIKA 3X30A 5FQBA 2OHIA 1YCHA 2QDTA 3DHAA 4FSBA 4JO0A 2UYXA 2I7VA 4D02A 2FU9A 2I7TA 2BGAA 5LCHA 1VGNA 5ACVA 4C1FA 2GFKA 3IE0A 3P2UA 4F6HA 2BTNA 4GCWA 2WYMC 2YZ3A 3S0ZA 2AZ4A 4UWOB 3ESHA 3I0VA 2OHJA 4WD6A 3RKJA 4YSLA 4J5HA 1KO3A 3IOGA 4F6ZA 3TP9A 5EWAA 2H6AA 3DHCA 1WRAA 1BC2A 3Q6VA 2WRSA 4CHLA 2GMNA 4HKYA 5HH5A 4FEKA 2Y8AA 5HH4A 2WYLA 2BFKA 1ZKPA 1YCGA 1BVTA 5ACQA 3R2UA 2FK6A 5AXOA 3SPUA 3AJ3A 5A5ZA 4ZNBA 5EVKA 4RBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M5C A;  5B15 A;  4RM5 A;  4EYF A;  3PY5 A;  5FQA A;  3PG4 A;  4LE6 A;  1SML A;  3IDZ A;  5AHR A;  2I7X A;  1X8I A;  1QH5 A;  4B87 A;  2NZE A;  2GFJ A;  1Y44 A;  2WHG A;  2NYP A;  1ZNB A;  3VPE A;  1K07 A;  1DD6 A;  3IOF A;  5HIO A;  3I15 A;  4AWZ A;  4AX0 B;  4XUK A;  2BG6 A;  2P1E A;  3KNS A;  3IE2 A;  3FCZ A;  4P62 A;  3IEK A;  5EV8 A;  4Z60 A;  5FQC A;  4KEP A;  5KIL A;  4C1E A;  3KNR A;  4TZB A;  2XR1 A;  3IEL A;  4V0H A;  3KL7 A;  3VQZ A;  2CBN A;  5EVD A;  1KR3 A;  5EH9 A;  4UWS B;  3BK2 A;  4ZO2 A;  2BG8 B;  4Z67 A;  4Z6X A;  4C09 A;  1VME A;  5HIP A;  5LM6 A;  1JJT A;  5AHO A;  5LSC A;  3AF6 A;  4UBQ A;  5LS3 A;  3ZWF A;  1JJE A;  5LCA A;  3BV6 A;  4H0D A;  4TYF A;  4ZO3 A;  1HLK A;  5K4M A;  2QDS A;  4HL2 A;  2FU8 A;  2FM6 A;  2ZNB A;  3DHB A;  3RKK A;  3IE1 A;  2YCB A;  3SRX A;  3MD7 A;  4YSK A;  2BG8 A;  2YNT B;  2A7M A;  4TZE A;  2DOO A;  4Z7R A;  4U4L A;  2Q9U A;  2E7Y A;  5A87 A;  4C1H A;  5ACR A;  1KO2 A;  2BFZ B;  2FU7 A;  2Q0J A;  4EYL A;  2P97 A;  4BZ3 A;  2YNU A;  4UAM A;  4XWT A;  2NZF A;  2Y8B A;  4TYT A;  2ZWR A;  2R2D A;  2YNV B;  3SFP A;  5K0W A;  4DIL A;  4TZF A;  4RL0 A;  5ACX A;  3DH8 A;  4PVO A;  4PVT A;  2YNT A;  4UWP B;  4UWR B;  5KIK A;  4BP0 A;  2NXA A;  4RAW A;  1E5D A;  1ZTC A;  2BG7 A;  1X8G A;  2AIO A;  4D1U A;  3BK1 A;  2BFZ A;  3I14 A;  2P4Z A;  5EW0 A;  3ZNB A;  4XWW A;  3LVZ A;  5IQK A;  4C1D A;  2VW8 A;  1DXK A;  5ACT A;  4C1G A;  4EXY A;  2GKL A;  1VJN A;  5HH6 A;  2YNV A;  1WUO A;  2BIB A;  4KEQ A;  4EYB A;  3A4Y A;  2OHH A;  2QED A;  5EVB A;  4FR7 A;  2P18 A;  5ACU A;  2YNW A;  3AF5 A;  4D1V A;  4O98 A;  1BMC A;  4NQ5 A;  2BG2 A;  3SBL A;  4ZEJ A;  2DKF A;  1QH3 A;  5K4N A;  5B3R A;  1A8T A;  3RPC A;  3SD9 A;  4AX1 B;  1WW1 A;  2WYM A;  3T3N A;  2BMI A;  5DPX A;  4D1W A;  5EHT A;  2Y87 A;  2BR6 A;  4RL2 A;  4NQ6 A;  2XF4 A;  3WXC A;  5LMC A;  5AEB A;  1X8H A;  5A0T A;  3T9M A;  1DDK A;  4UA4 A;  4Z5Z A;  3I11 A;  3SW3 A;  3X2Y A;  2BFL A;  2Q42 A;  3H3E A;  3T3O A;  2FU6 A;  3BC2 A;  3X2X A;  1P9E A;  2QJS A;  3X2Z A;  1M2X A;  5A0V A;  3L6N A;  3IEM A;  5HIQ A;  5AXR A;  1XM8 A;  4HL1 A;  2FHX B;  2M5D A;  3PY6 A;  3F9O A;  1MQO A;  4NQ2 A;  2Q0I A;  4GYQ A;  4YSB A;  4EY2 A;  2QIN A;  1YCF A;  5LE1 A;  5AYA A;  1WUP A;  5LLD A;  4NQ4 A;  4EFZ A;  3ADR A;  2GCU A;  2ZO4 A;  4AD9 A;  3ZR9 A;  3I13 A;  4J5F A;  5ACS A;  3G1P A;  1XTO A;  5EV6 A;  5LCF A;  5HIS A;  1A7T A;  5ACW A;  4EXS A;  1L9Y A;  4Z5Y A;  4D1T A;  5ACP A;  3FAI A;  4AWY B;  3QH8 A;  4TZ9 A;  2FHX A;  2ZZI A;  4GYU A;  5B1U A;  5K4K A;  2BC2 A;  2HB9 A;  3ZQ4 A;  4RAM A;  1JT1 A;  4C1C A;  3JXP A;  4DIK A;  3X30 A;  5FQB A;  2OHI A;  1YCH A;  2QDT A;  3DHA A;  4FSB A;  4JO0 A;  2UYX A;  2I7V A;  4D02 A;  2FU9 A;  2I7T A;  2BGA A;  5LCH A;  1VGN A;  5ACV A;  4C1F A;  2GFK A;  3IE0 A;  3P2U A;  4F6H A;  2BTN A;  4GCW A;  2WYM C;  2YZ3 A;  3S0Z A;  2AZ4 A;  4UWO B;  3ESH A;  3I0V A;  2OHJ A;  4WD6 A;  3RKJ A;  4YSL A;  4J5H A;  1KO3 A;  3IOG A;  4F6Z A;  3TP9 A;  5EWA A;  2H6A A;  3DHC A;  1WRA A;  1BC2 A;  3Q6V A;  2WRS A;  4CHL A;  2GMN A;  4HKY A;  5HH5 A;  4FEK A;  2Y8A A;  5HH4 A;  2WYL A;  2BFK A;  1ZKP A;  1YCG A;  1BVT A;  5ACQ A;  3R2U A;  2FK6 A;  5AXO A;  3SPU A;  3AJ3 A;  5A5Z A;  4ZNB A;  5EVK A;  4RBS A; 
#chains in the Genus database with same CATH topology
 2M5C A;  5B15 A;  4RM5 A;  4EYF A;  3PY5 A;  5FQA A;  3PG4 A;  4LE6 A;  1SML A;  3IDZ A;  5AHR A;  2I7X A;  1X8I A;  1QH5 A;  4B87 A;  2NZE A;  2GFJ A;  1Y44 A;  2WHG A;  2NYP A;  1ZNB A;  3VPE A;  1K07 A;  1DD6 A;  3IOF A;  5HIO A;  3I15 A;  4AWZ A;  4AX0 B;  4XUK A;  2BG6 A;  2P1E A;  4AXH A;  3KNS A;  3IE2 A;  3FCZ A;  4P62 A;  3IEK A;  5EV8 A;  4Z60 A;  2YHE A;  4PDX A;  5FQC A;  4KEP A;  5KIL A;  4C1E A;  3KNR A;  4TZB A;  2XR1 A;  3IEL A;  4V0H A;  3KL7 A;  3VQZ A;  2CBN A;  5EVD A;  1KR3 A;  5EH9 A;  4UWS B;  3BK2 A;  4ZO2 A;  2BG8 B;  4Z67 A;  4Z6X A;  4C09 A;  1VME A;  5HIP A;  5LM6 A;  1JJT A;  5AHO A;  5LSC A;  3AF6 A;  4UBQ A;  5LS3 A;  3ZWF A;  1JJE A;  5LCA A;  3BV6 A;  4H0D A;  4TYF A;  4ZO3 A;  1HLK A;  5K4M A;  2QDS A;  4HL2 A;  2FU8 A;  2FM6 A;  2ZNB A;  3DHB A;  3RKK A;  3IE1 A;  2YCB A;  3SRX A;  3MD7 A;  4YSK A;  2BG8 A;  2YNT B;  2A7M A;  4TZE A;  2DOO A;  4Z7R A;  4U4L A;  2Q9U A;  2E7Y A;  5A87 A;  4C1H A;  5ACR A;  1KO2 A;  2BFZ B;  2FU7 A;  4AV7 A;  2Q0J A;  4EYL A;  2CFU A;  2P97 A;  4BZ3 A;  2YNU A;  4UAM A;  4XWT A;  2NZF A;  2Y8B A;  4TYT A;  2ZWR A;  2R2D A;  5AJL A;  2YNV B;  3SFP A;  5K0W A;  4DIL A;  4TZF A;  4RL0 A;  5ACX A;  3DH8 A;  4PVO A;  4PVT A;  2YNT A;  4UWP B;  4UWR B;  5KIK A;  4BP0 A;  2NXA A;  4RAW A;  1E5D A;  1ZTC A;  2BG7 A;  1X8G A;  2AIO A;  4D1U A;  3BK1 A;  2BFZ A;  3I14 A;  2P4Z A;  5EW0 A;  3ZNB A;  4XWW A;  3LVZ A;  5IQK A;  4C1D A;  2VW8 A;  1DXK A;  5ACT A;  4C1G A;  4EXY A;  2GKL A;  1VJN A;  5HH6 A;  2YNV A;  1WUO A;  2BIB A;  4KEQ A;  4EYB A;  3A4Y A;  2OHH A;  2QED A;  5EVB A;  4FR7 A;  2P18 A;  5ACU A;  2YNW A;  3AF5 A;  4D1V A;  4O98 A;  2CG3 A;  1BMC A;  4NQ5 A;  2BG2 A;  3SBL A;  4ZEJ A;  2DKF A;  1QH3 A;  5K4N A;  5B3R A;  1A8T A;  3RPC A;  3SD9 A;  4AX1 B;  1WW1 A;  2WYM A;  3T3N A;  2BMI A;  5DPX A;  4D1W A;  5EHT A;  2Y87 A;  2BR6 A;  4RL2 A;  4NQ6 A;  2XF4 A;  3WXC A;  5LMC A;  5AEB A;  1X8H A;  5A0T A;  3T9M A;  1DDK A;  4UA4 A;  4Z5Z A;  3I11 A;  3SW3 A;  3X2Y A;  2BFL A;  2Q42 A;  3H3E A;  3T3O A;  2FU6 A;  3BC2 A;  3X2X A;  1P9E A;  2QJS A;  3X2Z A;  1M2X A;  2CG2 A;  5A0V A;  3L6N A;  3IEM A;  5HIQ A;  5AXR A;  1XM8 A;  4HL1 A;  5AIJ A;  2FHX B;  2M5D A;  3PY6 A;  3F9O A;  1MQO A;  4NQ2 A;  2Q0I A;  4GYQ A;  4YSB A;  4EY2 A;  2QIN A;  1YCF A;  5LE1 A;  5AYA A;  1WUP A;  5LLD A;  4NQ4 A;  4EFZ A;  3ADR A;  2GCU A;  2ZO4 A;  4AD9 A;  3ZR9 A;  3I13 A;  4J5F A;  5ACS A;  3G1P A;  1XTO A;  5EV6 A;  5LCF A;  5HIS A;  1A7T A;  5ACW A;  4EXS A;  1L9Y A;  4Z5Y A;  4D1T A;  5ACP A;  3FAI A;  4AWY B;  3QH8 A;  4TZ9 A;  2FHX A;  2ZZI A;  4GYU A;  5B1U A;  5K4K A;  2BC2 A;  2HB9 A;  3ZQ4 A;  4RAM A;  1JT1 A;  2CFZ A;  4C1C A;  3JXP A;  4DIK A;  3X30 A;  4NUR A;  5FQB A;  2OHI A;  1YCH A;  2QDT A;  3DHA A;  4FSB A;  4JO0 A;  2UYX A;  2I7V A;  5A23 A;  4D02 A;  2FU9 A;  2I7T A;  2BGA A;  5LCH A;  1VGN A;  5ACV A;  4C1F A;  2GFK A;  3IE0 A;  3P2U A;  4F6H A;  2BTN A;  4GCW A;  2WYM C;  2YZ3 A;  3S0Z A;  2AZ4 A;  4UWO B;  3ESH A;  3I0V A;  2OHJ A;  4WD6 A;  3RKJ A;  4YSL A;  4J5H A;  1KO3 A;  3IOG A;  4F6Z A;  3TP9 A;  5EWA A;  2H6A A;  3DHC A;  1WRA A;  1BC2 A;  3Q6V A;  2WRS A;  4CHL A;  2GMN A;  4HKY A;  5HH5 A;  4FEK A;  2Y8A A;  5HH4 A;  2WYL A;  2BFK A;  1ZKP A;  1YCG A;  1BVT A;  5ACQ A;  3R2U A;  2FK6 A;  5AXO A;  3SPU A;  3AJ3 A;  5A5Z A;  4ZNB A;  5EVK A;  4RBS A; 
#chains in the Genus database with same CATH homology
 2M5C A;  5B15 A;  4RM5 A;  4EYF A;  3PY5 A;  5FQA A;  3PG4 A;  4LE6 A;  1SML A;  3IDZ A;  5AHR A;  2I7X A;  1X8I A;  1QH5 A;  4B87 A;  2NZE A;  2GFJ A;  1Y44 A;  2WHG A;  2NYP A;  1ZNB A;  3VPE A;  1K07 A;  1DD6 A;  3IOF A;  5HIO A;  3I15 A;  4AWZ A;  4AX0 B;  4XUK A;  2BG6 A;  2P1E A;  3KNS A;  3IE2 A;  3FCZ A;  4P62 A;  3IEK A;  5EV8 A;  4Z60 A;  5FQC A;  4KEP A;  5KIL A;  4C1E A;  3KNR A;  4TZB A;  2XR1 A;  3IEL A;  4V0H A;  3KL7 A;  3VQZ A;  2CBN A;  5EVD A;  1KR3 A;  5EH9 A;  4UWS B;  3BK2 A;  4ZO2 A;  2BG8 B;  4Z67 A;  4Z6X A;  4C09 A;  1VME A;  5HIP A;  5LM6 A;  1JJT A;  5AHO A;  5LSC A;  3AF6 A;  4UBQ A;  5LS3 A;  3ZWF A;  1JJE A;  5LCA A;  3BV6 A;  4H0D A;  4TYF A;  4ZO3 A;  1HLK A;  5K4M A;  2QDS A;  4HL2 A;  2FU8 A;  2FM6 A;  2ZNB A;  3DHB A;  3RKK A;  3IE1 A;  2YCB A;  3SRX A;  3MD7 A;  4YSK A;  2BG8 A;  2YNT B;  2A7M A;  4TZE A;  2DOO A;  4Z7R A;  4U4L A;  2Q9U A;  2E7Y A;  5A87 A;  4C1H A;  5ACR A;  1KO2 A;  2BFZ B;  2FU7 A;  2Q0J A;  4EYL A;  2P97 A;  4BZ3 A;  2YNU A;  4UAM A;  4XWT A;  2NZF A;  2Y8B A;  4TYT A;  2ZWR A;  2R2D A;  2YNV B;  3SFP A;  5K0W A;  4DIL A;  4TZF A;  4RL0 A;  5ACX A;  3DH8 A;  4PVO A;  4PVT A;  2YNT A;  4UWP B;  4UWR B;  5KIK A;  4BP0 A;  2NXA A;  4RAW A;  1E5D A;  1ZTC A;  2BG7 A;  1X8G A;  2AIO A;  4D1U A;  3BK1 A;  2BFZ A;  3I14 A;  2P4Z A;  5EW0 A;  3ZNB A;  4XWW A;  3LVZ A;  5IQK A;  4C1D A;  2VW8 A;  1DXK A;  5ACT A;  4C1G A;  4EXY A;  2GKL A;  1VJN A;  5HH6 A;  2YNV A;  1WUO A;  2BIB A;  4KEQ A;  4EYB A;  3A4Y A;  2OHH A;  2QED A;  5EVB A;  4FR7 A;  2P18 A;  5ACU A;  2YNW A;  3AF5 A;  4D1V A;  4O98 A;  1BMC A;  4NQ5 A;  2BG2 A;  3SBL A;  4ZEJ A;  2DKF A;  1QH3 A;  5K4N A;  5B3R A;  1A8T A;  3RPC A;  3SD9 A;  4AX1 B;  1WW1 A;  2WYM A;  3T3N A;  2BMI A;  5DPX A;  4D1W A;  5EHT A;  2Y87 A;  2BR6 A;  4RL2 A;  4NQ6 A;  2XF4 A;  3WXC A;  5LMC A;  5AEB A;  1X8H A;  5A0T A;  3T9M A;  1DDK A;  4UA4 A;  4Z5Z A;  3I11 A;  3SW3 A;  3X2Y A;  2BFL A;  2Q42 A;  3H3E A;  3T3O A;  2FU6 A;  3BC2 A;  3X2X A;  1P9E A;  2QJS A;  3X2Z A;  1M2X A;  5A0V A;  3L6N A;  3IEM A;  5HIQ A;  5AXR A;  1XM8 A;  4HL1 A;  2FHX B;  2M5D A;  3PY6 A;  3F9O A;  1MQO A;  4NQ2 A;  2Q0I A;  4GYQ A;  4YSB A;  4EY2 A;  2QIN A;  1YCF A;  5LE1 A;  5AYA A;  1WUP A;  5LLD A;  4NQ4 A;  4EFZ A;  3ADR A;  2GCU A;  2ZO4 A;  4AD9 A;  3ZR9 A;  3I13 A;  4J5F A;  5ACS A;  3G1P A;  1XTO A;  5EV6 A;  5LCF A;  5HIS A;  1A7T A;  5ACW A;  4EXS A;  1L9Y A;  4Z5Y A;  4D1T A;  5ACP A;  3FAI A;  4AWY B;  3QH8 A;  4TZ9 A;  2FHX A;  2ZZI A;  4GYU A;  5B1U A;  5K4K A;  2BC2 A;  2HB9 A;  3ZQ4 A;  4RAM A;  1JT1 A;  4C1C A;  3JXP A;  4DIK A;  3X30 A;  5FQB A;  2OHI A;  1YCH A;  2QDT A;  3DHA A;  4FSB A;  4JO0 A;  2UYX A;  2I7V A;  4D02 A;  2FU9 A;  2I7T A;  2BGA A;  5LCH A;  1VGN A;  5ACV A;  4C1F A;  2GFK A;  3IE0 A;  3P2U A;  4F6H A;  2BTN A;  4GCW A;  2WYM C;  2YZ3 A;  3S0Z A;  2AZ4 A;  4UWO B;  3ESH A;  3I0V A;  2OHJ A;  4WD6 A;  3RKJ A;  4YSL A;  4J5H A;  1KO3 A;  3IOG A;  4F6Z A;  3TP9 A;  5EWA A;  2H6A A;  3DHC A;  1WRA A;  1BC2 A;  3Q6V A;  2WRS A;  4CHL A;  2GMN A;  4HKY A;  5HH5 A;  4FEK A;  2Y8A A;  5HH4 A;  2WYL A;  2BFK A;  1ZKP A;  1YCG A;  1BVT A;  5ACQ A;  3R2U A;  2FK6 A;  5AXO A;  3SPU A;  3AJ3 A;  5A5Z A;  4ZNB A;  5EVK A;  4RBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...