1YCHA

X-ray crystal structures of moorella thermoacetica fpra. novel diiron site structure and mechanistic insights into a scavenging nitric oxide reductase
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
398
structure length
398
Chain Sequence
SQPVAITDGIYWVGAVDWNIRYFHGPAFSTHRGTTYNAYLIVDDKTALVDTVYEPFKEELIAKLKQIKDPVKLDYLVVNHTESDHAGAFPAIMELCPDAHVLCTQRAFDSLKAHYSHIDFNYTIVKTGTSVSLGKRSLTFIEAPMLHWPDSMFTYVPEEALLLPNDAFGQHIATSVRFDDQVDAGLIMDEAAKYYANILMPFSNLITKKLDEIQKINLAIKTIAPSHGIIWRKDPGRIIEAYARWAEGQGKAKAVIAYDTMWLSTEKMAHALMDGLVAGGCEVKLFKLSVSDRNDVIKEILDARAVLVGSPTINNDILPVVSPLLDDLVGLRPKNKVGLAFGAYGWGGGAQKILEERLKAAKIELIAEPGPTVQWVPRGEDLQRCYELGRKIAARIAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray crystal structures of Moorella thermoacetica FprA. Novel diiron site structure and mechanistic insights into a scavenging nitric oxide reductase.
pubmed doi rcsb
source organism Moorella thermoacetica
molecule tags Oxidoreductase
molecule keywords Nitric oxide reductase
total genus 131
structure length 398
sequence length 398
chains with identical sequence B, C, D
ec nomenclature ec 1.-.-.-:
pdb deposition date 2004-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ychA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1ychA01
2M5DA 3T3NA 4ICIA 2QMYA 3I14A 2BG7A 2OHHA 5NULA 2YCBA 3HA2A 1D03A 4QOEA 2WC1A 1CZNA 2QJSA 4PVTA 2XOEA 4EYFA 4UWOB 3N39C 3ES9A 2N1MA 3G1PA 4O98A 3B6JA 1AKVA 2ARKA 5BUCA 5FQCA 3BV6A 4QOJA 1BVYF 2FLVA 2BFKA 3ESXA 4NQ5A 2YZ3A 2BTNA 1SMLA 3NHKA 1YRHA 4N82A 4ZNBA 2D5IA 4P62A 3S0ZA 3BK2A 3GFSA 5ACWA 2HB9A 2P4ZA 1XTOA 4F6HA 4Z7RA 1TLLA 2I7TA 4TZEA 2V5UA 1RLJA 4LTNA 4C1CA 1QRDA 1D04A 4QOIA 2Z9BA 3PY6A 4YAUA 4PU0A 1P9EA 4C1GA 2QDTA 1V4BA 4XDGA 2YNVB 4LA4A 2Y8BA 5LJLA 4EY2A 1C7EA 2FM6A 3QFCA 5HH5A 1DD6A 2BFZA 5EV8A 1DDKA 3SFPA 2MOKA 3T9MA 4AX1B 4BZ3A 2ZZIA 2KQUA 5LSCA 3JXPA 3S2YA 3TP9A 5FX2A 1FTGA 1GG5A 3IEKA 1FVXA 2NXAA 2FHXA 4QODA 4D1TA 1L9YA 1J8QA 3SW3A 2F1OA 1WRAA 2WRSA 3KL7A 3T3OA 5F51A 2BG6A 2Q0JA 2GFJA 2BG2A 4EXYA 1FLNA 2B3DA 4FSBA 5IQKA 3W78A 3X2ZA 3QH8A 3H3EA 4UWPB 3I15A 3W77A 4QOGA 1RTTA 5EVKA 1AKUA 4FEKA 4TZ9A 2E7YA 3NHRA 2X2PA 4C76A 2GKLA 4DIKA 2GFKA 5LVAA 1F4PA 3ZNBA 3P0RA 4H6PA 5FA6A 4F8YA 1T5BA 5AXRA 4YAWA 5F12A 5LCFA 3ZWFA 5LBUA 5FUQA 4XUKA 2QDSA 1JT1A 3A4YA 2QWXA 2ZWRA 5K0WA 2FU6A 4BP0A 3NHPA 3TEMA 1ZNBA 4PTZA 4NULA 5A5ZA 3NLLA 4NLLA 1AKQA 2M5CA 2Z9CA 2DOOA 1I1OA 1BU5A 5NLLA 4LE6A 4CF6A 4QOHA 2GMNA 3P2UA 4ZO3A 5ACXA 4HL2A 4QOFA 5LJIA 4U7HA 1BMCA 4S24A 5JROA 2BMVA 2Q42A 4V0HA 1OFVA 4C1FA 1E5DA 1J9GA 4C1DA 1ZX1A 1BVTA 2H6AA 3F6RA 4ZO2A 2QR2A 3NHUA 2Q62A 3LVZA 5HIPA 2QINA 4ZVKA 1YKGA 5FQBA 3NFRA 3UXEA 4UWRB 4GR9A 3VPEA 3OVMA 2ZNBA 1CZKA 5ACPA 5AHRA 2OYSA 1HLKA 4KEQA 1T0IA 5LBTA 5FQAA 3B6MA 1XI2A 1H66A 1J9EA 3N3AC 1D4AA 2BN4A 4FR7A 4UWSB 1ZWKA 1KR3A 3JSXA 5K4MA 2BIBA 5AEBA 2FX2A 1M2XA 4U7GA 4H0DA 4HL1A 2Z98A 3F9OA 4TYTA 2V5VA 4YSKA 3HR4A 3N3BC 3RKKA 3I0VA 2AZ4A 1XYYA 1YCFA 2FZ5A 1X8HA 1CZRA 2Y87A 3FCZA 2NYPA 2KLBA 3O2NA 4FGJA 3GAMA 1A8TA 2I7XA 1AG9A 1AMOA 4UA4A 4GYUA 1A7TA 3IELA 1AKTA 1XYVA 3IEMA 3ADRA 1VJNA 2AIOA 1WUPA 4Z6XA 3FNIA 3KLBA 1FX1A 1H69A 3RPEA 2Q0IA 3ZR9A 2WYLA 2WYMC 4C1HA 4C09A 2BGAA 1FLAA 4RM5A 3L9WA 2FAXA 4AX0B 4Y7CA 3W7AA 1X77A 2QEDA 1KBQA 3W79A 4F6ZA 5ACVA 5LMCA 1RLIA 3K20A 4J8PA 4HKYA 4EFZA 1DXQA 5KILA 4YQEA 3FAIA 2GCUA 3IE1A 2A7MA 3DHBA 3VQZA 3B6IA 5EWAA 2BZSA 4NQ2A 1NNI1 3DH8A 4RBSA 4ZVLA 2YNTB 4AWZA 2XR1A 1SQSA 2FHXB 2XODA 3IOGA 3F90A 1JA0A 4WD6A 4D1WA 2QX8A 2FVXA 6NULA 3R2UA 4BMPB 1K07A 1X8IA 5B1UA 5LM6A 4EXSA 5ACTA 2HPVA 5B3RA 3U7RA 2MWMA 2BMIA 1AKRA 1FLDA 2VW8A 2FCRA 5F4BA 3X30A 5B3LA 1MQOA 1WSBA 1X8GA 3OJWA 1QR2A 4BMOB 3ESHA 1AKWA 2ZO4A 4ZEJA 4J5FA 4AD9A 5AXOA 2P18A 2WHGA 3NHFA 3WXCA 2X2OA 3DHCA 3ZHOA 3HLYA 2WYMA 5LCHA 2MTBA 2YNWA 1CZHA 1OBOA 3KNSA 1FLVA 4NQ4A 2MT9A 2ZKIA 4N9QA 4HS4A 1YCGA 4U7FA 4TYFA 3PG4A 4LAFA 1YOBA 1WUOA 2R97A 1OBVA 1JA1A 2FU9A 2Q9UA 2YNVA 3AJ3A 1JJTA 1XM8A 2BG8A 1YCHA 1JJEA 2YNUA 5EVDA 3U7IA 3K1YA 1J9ZA 3OWHA 2BFZB 2M6SA 3I13A 4UBQA 1VMEA 3SRXA 3O73A 2XF4A 3I11A 3OX1A 5LCAA 4XWWA 1YDGA 2FOXA 4LTMA 2CBNA 4YSLA 1WW1A 3LCMA 1QHEA 5EA2A 4DILA 5EW0A 1WSWA 4ZVNA 5KIKA 4FGKA 1QBGA 4M0CA 4RAWA 3TZBA 3KEGA 5ACRA 2BC2A 1KO3A 3G5MA 5HIOA 5ACQA 3KNRA 1AZLA 4D1UA 3B6KA 4GI5A 4EYLA 3L9XA 4RAMA 4YSBA 3NHLA 2OHIA 3QE2A 1DXKA 5HH4A 2HNAA 4B87A 4EYBA 4HEQA 2DKFA 2P1EA 5HISA 5EMNA 1QH3A 3RPCA 2FU7A 4YALA 3PY5A 5A0TA 4Z60A 2FDXA 3QFRA 1ZKPA 2FU8A 3AF5A 4C1EA 1DX9A 2V9CA 3DHAA 2FK6A 4PTYA 2YNTA 5EHTA 3AF6A 4ZVMA 3SD9A 4XDHA 1SG0A 5LS3A 1C7FA 5K4KA 4Y9RA 3OJXA 3FJOA 3NHSA 2AMJA 1AHNA 2BG8B 3TE7A 1KO2A 2QMZA 4C0WA 4AWYB 5EAIA 3RKJA 3BC2A 1B1CA 4CHLA 3IE2A 4ESEA 3GFRA 2GSWA 5AYAA 3NHJA 1FUEA 5TGZA 5A0VA 3GFQA 2FZVA 4Z5ZA 2BF4A 5EV6A 4GYQA 4N65A 3F6SA 5LLDA 3X2XA 4GQIA 4Z67A 3MD7A 2Z9DA 4XWTA 3LT5A 3FX2A 3SPUA 3NHWA 2NZEA 4TZFA 3UXHA 2RG1A 2QX4A 4PVOA 4TZBA 4YAFA 1VGNA 5EVBA 4FX2A 1CZOA 5LE1A 4FGLA 2NZFA 4OXXA 5B15A 5ACSA 4C0XA 4R81A 2A5LA 5ULLA 1DXOA 3BK1A 4U4LA 4Z5YA 4NQ6A 3FW1A 5A4KA 4DY4A 2BR6A 3X2YA 3D7NA 3IDZA 3ESZA 3L6NA 4J5HA 3KAQA 1CZLA 1ZTCA 5K4NA 3FVWA 3OWXA 3KAPA 2QX6A 3SVLA 2OHJA 4LTDA 4C14A 4D02A 5B3KA 5HIQA 3Q6VA 5ACUA 2HNBA 2R96A 5HH6A 1CZUA 2Y8AA 3ZQ4A 5EH9A 3SBLA 2P97A 4CETA 4RL2A 4D1VA 2BPOA 4JO0A 5A87A 2W5UA 4UAMA 4Y9UA 3OX3A 2UYXA 2R2DA 5DPXA 1ZWLA 1RCFA 3EYWA 2M6RA 1QH5A 3F2VA 3IOFA 4KEPA 2BFLA 3EDOA 1Y44A 3IE0A 1TIKA 5AHOA 1KBOA 3NHYA 3R6WA 3ESYA 4H2DA 4GCWA 2I7VA 1XT6A 1BC2A 2QX9A 4RL0A 3OX2A 4YAOA
chains in the Genus database with same CATH superfamily
3IAAA 3EQ9A 5ABPA 1IC6A 5LQNA 3K70B 1ZCBA 2X41A 4Y1GA 3PX2A 5KKNB 2M5DA 2N9UA 4M0EA 3QPWA 3RBAA 3TVDA 4IJ5A 5AP9A 3QEKA 2QYSA 4HYYA 3T0FA 4JBYA 1IATA 3EGIA 2CEKA 4L4ZA 3THWA 1JEEA 1VDMA 3ZCXA 1IHUA 5CH8A 1UCFA 5C81A 1NXQA 1YJXA 3RK0A 4HDRB 4L5BA 4DJTA 4HEA1 4L8VA 3MRSA 1MQ9A 1P9RA 4AM8A 5JNUA 5FQNA 4OHCA 3LPNA 1YULA 2WJWA 3AHJA 4QE3A 5TPZD 2BI8A 3T52A 3UK6A 1X8LA 4B6RA 3AIIA 3BD6A 2FLVA 3F5DA 5EYPA 2B4TO 5JD5A 3CW8X 2FPWA 2OGSA 2VJKA 3GVXA 4KOAA 2RARA 3D2AA 4YCNA 4LXYA 3K9HA 1TMOA 4TLDA 4ZAZA 3KVRA 1TK2A 5KTRA 2A86A 3W5IA 3PFBA 2B9VA 4XAQA 3BAZA 2D2VA 4JIGA 3I0MA 2F43A 1O4VA 1EM6A 2VUSA 1WXDA 2XUGA 4TZEA 4EWLA 2O6LA 4ZJUA 4LCEA 1VL8A 4EG4A 5B4UA 1G42A 1JW9B 2QNBA 4KGXA 5B58C 4C1GA 1P9EA 1K7XB 3AWDA 1WTCA 2LE0A 3F67A 4J75A 4YRQA 2G3YA 3HDVA 4B3IA 3DV9A 5KTNA 2XHZA 1YR3A 4WNIA 3CR7A 4WZBE 1PJAA 3I2FA 3V97A 3HJTA 2XNSA 1N5IA 1UFQA 3ZU3A 3G23A 2E2WA 3CVYA 1DJLA 2Y0DA 1X80A 2DUJA 1OXVA 1U4SA 1C7EA 2CK3D 2H4FA 2OFXA 2PRSA 1W4BA 1LB1B 4PR0A 4UD6A 3W06A 3AF4A 1KEKA 5DPXA 1T9KA 4ZYYA 3AO0B 2PO5A 4ZALA 4EI2A 1FTSA 4LK3A 1PZGA 1KIAA 2J5KA 4OXYA 3QVUA 5EHGA 1KI3A 2PTGA 4Z6KA 1HEYA 2BFDB 3CUEF 4ZVSA 2I4IA 2EJUA 3S2IA 2RC5A 5CEEA 1FU4A 1K08A 3PA8A 5EERA 3TW8B 2P3LA 2JLZA 5KC8A 2ORVA 4HZUB 2C8JA 3O21A 4EHDA 3G7SA 3MS7A 2FN8A 2HJRA 1S3IA 2HHLA 3FUXA 4B4VA 4BO0A 2P5TB 4DL9A 2A92A 3AT1A 4YCDA 1GU7A 4UNIA 2ZJ8A 1NNSA 1P0MA 1XN4A 4S3MA 4AT1A 4OMDA 5HR5A 4RTMA 3MVEA 5DYNA 3FNHA 2XUQA 2HK6A 3N0RA 4AMYA 5B55A 2BG6A 4OFWA 2RHCA 3RYCA 1JYSA 2NTNA 3I8XA 3B5JA 2Q3LA 3W78A 4L85A 3DTVA 1RP7A 1IONA 1MV5A 3OWOA 3R6LA 2ZITA 5G1OA 1G9XA 3HI4A 4TV9B 2BT4A 3A3YA 2JK1A 1GTSA 3TKLA 1XCJA 3G79A 3RSFA 5KB3A 4QTXA 3NYRA 1C1HA 4HQFA 2WLTA 3AR6A 4LCBA 4G1MB 4XKJA 3T5GA 2XZLA 1L9KA 2NSYA 1CCWA 3HYRA 3OM9A 2NW6A 4RAOA 3QKIA 4OF4A 5DHSA 2LW7A 1MRZA 1O9BA 1QFSA 4CLRB 4EGFA 4QM6A 4EHBA 4RMIA 5F2NA 4HZGA 4WGGA 1C7QA 2IQ5A 4Q4JA 3QHPA 5J59A 3BIJA 3HNPA 4MI3A 3CH6A 4ACAA 4AMZA 5JWOA 1BYUA 3CNQS 3SK0A 2ZXFA 1SK9A 2VPPA 4FI3F 4FYYA 1WHSB 4IICA 4PGGA 4YAWA 1ILWA 1F9AA 5I8WA 4INJA 3QTBA 1XEFA 3KPYA 1GFSA 4EY3A 1X15A 1GKIA 3HDJA 3PHGA 1YRQA 4NZ9A 1WB6A 1G66A 3ICOA 4HQOA 2YQ5A 4L76A 1OIVA 4B4WA 4E32A 1EP1B 4IJWA 3FNQA 5IKMA 3QYPA 4PTZA 3ZY6A 4RSHA 4D9IA 3BGIA 3VU1A 1VMDA 2ZBRA 1O08A 4UE6A 1VPLA 4BO2A 4BHTA 2HMTA 4MLCA 4J16C 2NZJA 5ER9A 2HJSA 2HW8A 4LE6A 1SHJA 3CG0A 2ZQZA 5BNFA 2XEDA 5TJ9A 1C1DA 2PCLA 4AJPA 2HHAA 5JMOA 4DREA 4J1SA 5F9FA 2I9PA 3JQAD 3MTQA 2JHAA 5CT4A 2GEVA 2W4QA 1JLLB 3IJEB 4S0XA 4B4OA 4CT4B 4URVR 5D8DA 4C1FA 3AGPA 3BDAA 4H59A 4KO8A 4YO7A 1EGVB 3KQSA 2UXCB 3MIIA 1JILA 2G63A 1TA4A 1JA9A 3Q7SA 3TTYA 1ZR4A 3D3WB 3R7WB 3BORA 1WBDA 2JFOA 5LDGA 5HIPA 3NI2A 1VCIA 4CEJA 5AM4A 3DEIA 1RRFA 2N1BA 1A88A 2PD6A 2BR4A 3DAPA 2CLMB 3ZGVA 2CG2A 4KE9A 1GAQA 4BMSA 4B74A 5EWLB 4RFVA 1TQ4A 3OVMA 3HU2A 1F6WA 3TLMA 2PDAA 4H7EA 2VYQA 2H9YA 1N2JA 2WB2A 3ZDBA 2QRJA 1H66A 2AN4A 1P3JA 3PQ3A 4EYQA 1MX1A 1PJQA 3ENVA 1NI4A 1RAGA 2G7ZA 3W5VA 4D0NA 5JT1A 4QGFA 1WBBA 3F6YA 4GZLA 1EX6A 4PC2A 3PXEA 3Q6MA 1Q7TA 1VZ2A 4WUTA 4DPMA 3K05A 4FW9A 2EV9A 4ZOCA 4EKYA 1K8YB 3C3WA 3QE3A 4JLPA 2H2FA 4GBMA 5M7EA 2MR6A 2DP4E 3M0EA 4FHFA 2DWUA 2VBIA 4C7OA 4MKHA 4YJHB 4HYQA 1GL6A 3HR4A 3OEWA 3S4YA 3OJEA 2EKBA 4ZC8A 4HQNA 1I94B 1GXSB 4UDNA 4D4MA 1M1YE 4J1NA 2BMEA 2Y05A 1QF6A 3FCZA 4YIHA 1S01A 2PM8A 1ZCFA 1QFJA 2K5UA 3KQMA 3PVSA 1DELA 4FTWA 4QBKA 3UAWA 1E63A 1YR6A 4JHXA 5CEFA 3FAZA 3WHPA 3AQ4A 1CF9A 2PSEA 1D0VA 3R0JA 2JLSA 2UVQA 5E9WA 1KYIA 1OREA 1JPVA 2OZLA 3C87A 3LCJA 4OMUA 3C6KA 5I9LA 1O0CA 3JQPA 4F0JA 1R5OA 5JTUA 3TQSA 2VNIA 4MVJH 5EHQA 4CN8A 4XIYA 4IXDA 3ZDQA 2BGWA 4MKIA 2NUAA 4G56A 4J07A 3URMA 3L0CA 3AEKA 1CQJB 3PI7A 3ED1A 2SHKA 1BAPA 5FUYA 5DMXA 2AEEA 2JJMA 1U65A 1YIAA 1QZXA 3WLMA 3BXXA 3MTGA 4F6ZA 4B8WA 4W1QA 2DFTA 4LF7B 1RJFA 1LBQA 5JY6A 3EGXB 3HACA 2YV2A 3ZXYA 3HGMA 2XMSA 4A15A 2QLFA 5THXA 5L6MB 1Q1ZA 3FY4A 5AW1A 2JAHA 1RRGA 3QNMA 4LK2A 3U49A 3WRYC 4MQFA 4P3KA 1CB0A 2JIQA 4MGIR 4WZAB 1E2HA 5DFAA 3ZDEA 3ZDZB 4E14A 4TV8F 5F5LA 4C4PA 3WK8A 1UT8A 1YQGA 3LCVB 4R0VA 4WD6A 2CVQA 1E9FA 1UR5A 2INGX 1F8XA 2XQKA 2V0GA 2BFZA 3MF4A 3VOAA 2QQFA 4HP8A 3MT9A 4FX5A 3U3RA 5B3RA 2XVMA 4N6OA 3BD9A 3JX9A 5EGNA 3A28A 4F5YA 3K4QA 1UJ6A 2WTBA 2BSAA 1U5CA 2VHZA 3TTXA 4A92A 4DDMA 3D6FA 2D7CA 1A1SA 4PYJA 2KI5A 1AB5A 4DSZA 3LXRA 5LOVB 4GKKB 2VC2B 4P34A 2OUKA 3OFNA 4XLTA 1E2FA 1LUAA 1UZNA 5AKLA 3HYLA 5B3LA 5T8KA 1O9GA 3C43A 2WSBA 2OBFA 3S2GA 1DWPA 1EXMA 2A0KA 2GKOA 2PRIA 4ISCA 1V7CA 2D5AA 2B7BA 4GOJA 4A8TA 4W5OA 1Z4PX 5CCBA 4J5FA 5LU9A 2H2IA 4UTZA 4UMDA 1R0XA 3WLIA 1JEDA 1MB3A 2LVBA 3AEZA 1MT0A 1NRIA 3DBOB 1P33A 2PKCA 2WJHA 3PNKA 1U7PA 1W85B 4RY0A 4EHNA 1XXHB 3STHA 3ZHOA 4IEIA 2AC4A 2G9NA 2V97A 4UHCA 2JKYA 4JJFA 3M4XA 4B85A 2JBWA 2YNWA 4P4TA 1Q7GA 1J97A 3AX6A 4P80A 5DTQA 4G0OA 5B1IA 1PN3A 2ZKIA 3HKBA 4BYGA 4CF4A 1V9CA 3RUIA 3B5IA 2CHGA 1S8OA 3FZNA 3QF4A 4UPDA 3K72B 3CZPA 1E1NA 2F1IA 4ETMA 4GZ6A 2NVWA 1BGXT 2PQ0A 3I52A 4Q1CA 2K6GA 2VK2A 4EMTA 5KINB 1G59A 2C54A 1TMKA 4CKWB 4R54A 2ZZMA 4C05A 1HFKA 3N2GB 3C97A 5DNDA 4AJ9A 2ZULA 2DPMA 2GEJA 1JJEA 1WQ4A 1USGA 1U2TA 2VWQA 4YRPA 3ZDCA 2BFZB 3IQGX 3R8CA 1K7YA 1HPLA 3RRYA 3LBFA 5DM4A 3SRXA 4JVMA 3R6GA 4Q16A 4B9AA 3INNA 3PPXA 2PFKA 2QF7A 3IPXA 1YDGA 4YUYA 1LQTA 3C1UA 3CT6A 2AVNA 1OX4A 3P5BA 5E7IA 2ENWA 5IRCD 3QTTA 2PU7A 1B2LA 3WIOA 1N25A 4BCBA 1EVLA 4P2BA 1EUZA 1A77A 2XT0A 4B2YA 1OZGA 1KVTA 3D8RA 5DX1A 2DUWA 1SUPA 4I99A 2E89A 4HAVA 1KL7A 4NMMA 2FOLA 4RSRA 5BOSA 5CLJA 2OHVA 1EFRA 3WMRA 4F91B 2O7NA 1ZA2A 4M76B 1DX6A 2QTGA 3BFKA 5M04A 4G8DA 3ZEAA 5J4YA 5I7AA 2I3GA 2A59A 5C7OO 4JMLA 4KOEC 4I0WB 1GEGA 2WK1A 4U7PB 2ZWIA 3RVMA 2O1EA 1E79D 3VSBA 2JFWA 1IPHA 1CYDA 2HZBA 2GFIA 1ZOLA 2OHIA 1N5RA 2HNAA 3GVCA 5KSPA 2PZ8A 3UWSA 1Z2DA 2VSFA 3ADDA 4EYBA 2COEA 1M0EA 4KQIA 5E8JA 2J9XB 4F71A 1W5FA 1EI9A 3QMWA 1ISIA 1E77A 4KPUA 5I7FA 3TOXA 1Z2OX 2IF0A 3IEUA 1PAUA 3DFFA 2L17A 1OZFA 2P40A 1Z6PA 1DIHA 3O1HB 5DCUA 4CKCB 3O8RA 1NI5A 4HS9A 1Q0TA 1ZZEA 2GM9A 4R9RA 1AGXA 1XZJA 1DAOA 3ILXA 3VTKA 3WGZA 3E3OA 1N5KA 3JZAA 4BQIA 5H3LA 4RTPA 3FKJA 4C43A 4I1RA 4HDMA 3M6UA 2BFCA 5LS3A 4IJUA 3NHSA 4BFSA 4PO1A 1GNVA 2GZMA 1DHRA 3LUCA 5DJ5A 1UJBA 3M8KA 4GSYA 2OFFA 3VOSA 4DAOA 4KE6A 1OFTA 3N58A 4WTOA 2QMZA 1GG8A 3U81A 4YAIA 3C0KA 2YHSA 3CLSD 4YVFA 3VKWA 1VPDA 2DB3A 4LDAA 1LDEA 3CCFA 6CHYA 7ADHA 1MB2A 4NOKA 5IBCA 1JWLA 5TC4A 3IE2A 3CEAA 3KJHA 2POCA 3DMPA 3RS5A 2YN4A 3OEEA 2FKAA 1FUEA 3UO8B 1RWXA 4S1VA 3ST7A 3WDKA 4B7ZA 4B3FX 2E4VA 7REQA 1VB5A 1M1XB 3JQFC 4BN5A 1CD5A 3LOUA 4RGVA 1KZHA 5JAUA 2Z0MA 1U0NA 3ZHRA 3FBWA 2P4QA 4LHYA 5A9TA 2VWHA 1RLTA 2NOAA 4ED9A 2QQ5A 4FVTA 1GFWA 2B30A 3DCJA 3IAM1 1MB9A 2X0KA 4LHSA 5AVZA 4AZ0A 4GQIA 3R20A 5YASA 1Z45A 1VZ3A 1QTQA 5LL6P 2W11A 4AZVA 3J80A 4O2RA 4EFNA 5ECWA 3FDJA 4O1HA 1QM5A 2Z9DA 5BT8A 3N05A 1S2GA 2DGDA 2IHBA 1DWUA 3CWCA 4G5RA 2YWHA 1N3LA 1Y3IA 2I22A 2HOQA 2W6JD 4XSHA 5A4MS 3IVXA 2C3MA 4Z4IA 1VGNA 1RT9A 4QDOA 1M67A 3WRVA 1WUJS 4C7KA 2IYOA 4CLHA 1OYWA 4N7JA 3T61A 4R69A 4UQPA 1PGPA 5MFPA 4HDOB 1JFRA 4A3SA 3O1JC 3PGA1 4IGIA 5CM2Z 3PJFA 3OLZA 1DKPA 2XRZA 2GPWA 3OCXA 4J2HA 3S7ZA 1Q44A 2JIMA 3L8MA 4NQ6A 3C5WP 4P3YA 2WP8J 2CVZA 1XTPA 3HZZA 2OXRA 3UT5A 3H6GA 3S70A 5LDHA 4GM1A 4MULA 2DH5A 4P83A 1SN7A 1ZTCA 1ZUHA 1FC0A 1S2LA 3PDIA 4R6XA 4PN3A 3I76A 4KAAA 3MUNA 4I2VA 3STXA 3VU0A 4ALNA 4DMFA 3SVLA 3DYIA 3FAKA 4A1FA 1KFBB 5COBA 2EYQA 3L3BA 3PWZA 3O5AA 1Z47A 3F0TA 1ZS9A 3OIGA 1DUSA 3K1TA 3QY9A 2HJVA 2Y4OA 4LMPA 1G5PA 2YOGA 4RY8A 5CA1A 5JMTA 1XJCA 3GEEA 3W6NA 2PGNA 3DHYA 4MUGA 1OXBB 5DHRA 5HKAA 3I6IA 5A87A 1HG1A 1XTTA 1DE0A 4BV8A 3BXGA 2FJPA 3ZU5A 3IR5A 5IT5A 1C8BA 3A58B 5FI0B 3RODA 2M6LA 1LVUA 4LWOA 5KX5A 4HJRA 2C9BA 2O3TA 2XT9A 4M4SA 1JFLA 2R4QA 1EXDA 1KDRA 4MOWA 2O8FB 4KZKA 4RH1A 1XVIA 2YDYA 2PT9A 4BUZA 1KTIA 4XWOA 2EKPA 3ZEIA 3CE9A 4MB6A 2LNDA 1ADJA 4IVPA 3G9TA 4DFDA 3SZRA 3B9BA 2CWDA 5TGDA 4DRYA 5HQ3A 1PFKA 3RS3A 5IAKA 1E3LA 1BX1A 5CYFA 3QBJA 4IPTA 1IN5A 1X0VA 2JW5A 2OHHA 1YFZA 1YQ9A 4Y2HA 3EZYA 4Q0MA 1T91A 2X58A 1CUDA 4CEIB 2O2ZA 1Q1BA 2P78A 2JI9A 3RVSA 3Q7EA 3O4VA 4QOEA 2WC1A 2X7JA 3U80A 1DBWA 2I2CA 2Z1NA 2BKVA 2ZUWA 3OESA 3QUAA 3G1PA 4O98A 4P4SA 1OFUX 3B6JA 2PZLA 5EEHA 2OBLA 3CJTA 2F3QA 1VHDA 1HLGA 1WXGA 2B4YA 1H2ZA 2GZAA 2NSHA 2WG0A 2ZUDA 3JASB 4B34A 3HK2A 1GR1A 3VGPA 4A8JA 5KVAA 2L42A 3V1MA 1U5BB 4EGJA 3W5AA 1SVOA 3MN1A 4KFUA 3B7GA 1PJ8A 3ANYB 3AIMA 4CV0A 4YHHB 2BTNA 1NP7A 3NBFA 2IYQA 4CFSA 2AKYA 3MJSA 1K4MA 1LRKA 3B1FA 4HNAA 4QU8A 4F8EA 4QARA 1ZMXA 1UK6A 1VL2A 3DL7A 2VP3A 5FHQA 4OHMA 2XHEA 2VJLA 3UJCA 4JP3A 3I01M 2QMOA 4AO8A 1EHYA 1Q17A 1DADA 1P19A 3E5RA 1BVUA 2I3BA 3WLOA 3B1KA 3TPFA 4QOIA 1RDFA 3WK5A 2W6ID 3BHIA 1Z4NA 1S8NA 1EFHA 1L8QA 4PYIA 2BGRA 1V4BA 1Z36A 4PVCA 1UAGA 4JT8A 2V45A 1PSWA 2ZSJA 5LJLA 3BH7A 2NQTA 1M2KA 4OHXA 5HH5A 1B74A 2QNIA 4F1KA 1SO8A 4O29A 2JLXA 2A5JA 4ZAXA 2OV4A 2RD2A 2N75A 3VBEA 1HKHA 1L4FA 1ODKA 4RVUA 2DQZA 3LBAA 1LTQA 3SJAA 2V4MA 2YFYA 2P2ZA 2DJ5A 1JDPA 3IERA 4KUGA 4EG7A 1GOTA 4X93A 3KOYA 4QSHA 5CA0B 5A9SB 3SZUA 1N9KA 1E6LA 4JJEA 2HI0A 4O8CA 4L28A 4HYTA 2IUTA 2KW5A 1PR2A 1OBCA 2Z5FA 1Z25A 2E48A 3BSSA 3IT1A 4MMXB 4LC9A 3A1VA 1SBYA 1CR1A 2XCIA 2LXNA 2FPGB 3MLAA 3O2QB 4LYGA 1T8PA 2F1OA 2JJ1A 3I61A 1XA0A 3RT1A 1P0PA 2EZUA 2X3UA 4TZ6A 4U7WA 2M6KA 4BO8A 3FCSB 2CJYA 2BMDA 2FP4B 2NPOA 2QHXA 5CT6A 1VLLA 1M0SA 3QBTA 1GRCA 3K4HA 2GR9A 5DVZA 3QWAA 3KO8A 1ONOA 3MT0A 1TAQA 3VSEA 2C42A 4ME6A 2CZQA 1E2EA 4NZOA 1P1KA 1E3MA 4FB5A 1OA0A 5C8VA 2XLBA 4QWWA 1Y3BE 1E0JA 1H8EA 1V25A 2I5PO 2REBA 4EG1A 3L93A 3ABZA 3QU2A 5IHXA 4FBLA 3CNNA 2JFQA 4UOZA 4X6YA 2NUPB 2IIBA 2C94A 1KI6A 4CQMB 1QPZA 4PXAA 5BQ5A 3S8YA 1XQ6A 2PL1A 3NETA 3LTNC 3HL0A 5JJKA 1GUDA 4OATA 3TWOA 1V8FA 5LZ2A 4MVXA 1R5NA 4IIUA 4TTRA 3TOZA 1L5YA 3E15A 4DIMA 4NU6A 1CUVA 3DZIA 3FF1A 5A2QA 3P2KA 1YXMA 2QUKA 4XGKA 4MKGA 1HTTA 3ZD7A 2PGAA 4LQ4A 1JXQA 4ARZB 2EFJA 1P8JA 3EDQA 1HEUA 4HNSA 5HUJA 4NLLA 3B1VA 5ALNA 5C8YB 1RPJA 2LTAA 1BIFA 3K32A 4AJJA 5HOEA 3P9SA 3C8UA 1HZZC 3AIOA 1CETA 1BZYA 1PJ3A 3GMDA 3ITKA 2CY0A 2NV0A 1TPYA 2VHCA 3LG2A 5AYVA 2HEIA 1GLVA 2BLNA 5HE8A 4BE9A 1R12A 2YZ7A 5LPNA 4C6TA 2OO5C 4KX5A 1UPAA 3M49A 4JJKA 1PR9A 2OILA 1TQ6A 4Q37A 4TRJA 2GEKA 1I7QB 1WMDA 2JCGA 4NYMQ 2HLDA 4QUEA 1ZMBA 4X90A 2OR3A 4MAFA 1TZ2A 3AV3A 1GZ6A 3KR2A 3ESAA 1T8UA 3LUDA 4MVJM 5ERYA 1JB1A 2VYVA 1DDIA 1KTVA 1WO8A 2EVWX 3NHUA 4WZAE 2NP6A 4FINA 3C1OA 3HCAA 1MNQA 2CKDA 2RJ3A 5HX7A 4XZ3A 2HA7A 4CL2A 5FQBA 1MZVA 3K15A 4JOSA 3MWEB 4ON9A 1ODIA 3OJCA 2B2XA 1B2RA 4HB2A 1NUUA 4LEIA 4PRKA 1XCLA 5JD4A 4FLFA 5LQMA 3IFSA 2ZNBA 1DIBA 1X7DA 1AA9A 4HTAA 4IH1A 5TB5A 3DE5X 1I33A 1ODLA 1ZD2P 5P8WA 1E6UA 2ZSIA 3B6MA 4WA7A 1FQOA 3VOBA 1KI8A 3SM3A 2ZRIA 2VXOA 3Q3EA 4P8RA 4Q4AA 3WOVA 4YCCA 2PUEA 4H18A 1WVMA 1U7XA 2BM0A 4EG8A 4YAEA 1LSUA 2XB6A 3BZUA 4KGVA 5BUSA 1CUFA 2XRFA 4P31A 3PHCA 4IXTA 4NECA 5CNKA 3T35A 4EUEA 1D1TA 4EPYA 1QKIA 5HZGA 1VLVA 1G20B 4YSKA 1M6HA 3AR4A 3HS3A 4LJKA 1DAHA 2WB4A 4ZRDA 1XTQA 2I66A 4UU7A 1UBNA 2H2GA 4H7IA 4YRJA 5JSFA 4B6FA 5U9CA 1ZI9A 3A4TA 5LQCA 4M98A 3QQPA 5FPPA 1AHPA 3NWPA 1EBUA 1K3UB 5BN5A 2X42A 4RZHA 3G2OA 5JS2A 5KWVA 1DAFA 2FB9A 2V7UA 4G26A 1E1CB 3FWZA 2M2IA 1Q7BA 2KJQA 2B0CA 3Q3VA 4H3VA 4GHWA 4KQXA 3SKYA 3GARA 1GVNB 2AC7A 3CUTA 3CT4A 1AU9A 3UHFA 3VR6D 4QGSA 2O54A 1DAGA 3K8ZA 4K6HA 2O6HA 2AXPA 1EX1A 5T41A 4E70A 1DKQA 1NNUA 5DLDA 1L5SA 4Q48A 3JR7A 1XCBA 3OIWA 2OC4A 1YDMA 2PXCA 1H0KA 4GOMD 1SQ0A 4MGHA 3QOYA 5LCXA 2XNKA 2RE8A 1COZA 1P2TA 3VAAA 3RU2A 5A1JA 2J09A 2Q4OA 1LF5A 4G36A 4BNFA 1V2GA 4CDRA 4TKVA 4N5HX 1X77A 4K9LA 1X7GA 1KBQA 2D1SA 4Q9KA 1OFGA 1D1SA 1QB8A 4UBLA 5J2TA 3LLSA 5ACVA 1T0BA 4LDRA 1KNXA 2AT1A 2JAOA 4H17A 4JU9A 5KKAA 5JZOA 4QDXA 4G5FA 3DP7A 1SQ6A 2Q5FA 4YQEA 3ONNA 2PV7A 3IPCA 1GVHA 4GWLA 3WJAA 4D0RA 3IE1A 2QM0A 2VPQA 4Q3DA 2V55B 3OY7A 5GZ3A 3V4RA 1TKAA 3G6KA 3IAXA 3E3AA 3JRNA 4MW6A 3U3JA 1NNI1 2QW1A 1N4AA 4YDQA 1GPDG 5AIJA 2OORA 3EH2A 1W25A 2YUTA 4WNYA 4BE7B 2HJ9A 3ZWVA 5ANRB 1KPIA 2QX8A 5FI3A 4EY7A 1DEOA 2RI1A 5AFSA 1UZUA 3ADBA 3F74A 3JYLA 4KWIA 3ASYA 1JPNA 1ZONA 4PFSA 2VQ3A 3C3EA 3M6LA 1YFLA 4G85A 1DMRA 1YQUA 2G77B 5A5FA 4Y2YA 1PQUA 2Y67A 2GPNA 3OQJA 4HEJA 4QQKA 3T6KA 1UMBA 3ELBA 3SC3A 3HJCA 1P3Y1 3KQOA 4QKQA 1VMAA 4LGMA 1O5TA 1RTKA 1PDVA 3HBNA 3SPXA 2ZRHA 5BQFA 4NBLA 5EP1A 4BQOA 3DZGA 2Q1YA 1SUWA 3DO8A 5EUBA 2GEUA 4KIUA 4RLQA 3SMQA 4S2EA 3C3XA 2AEJA 2IDJA 4IHAA 4TSRA 1W36B 1H5UA 3KEQA 4AW9A 1VECA 4CMKA 4AN4A 1BDBA 1R15A 1D6NA 1SUEA 5BV7A 5EJ5A 3M1LA 4Q4JB 2I4NA 2AJTA 3NHFA 3PRJA 5KTOA 1A9ZA 2QT1A 2ZJ7A 4KE7A 2RJOA 4EJFA 1EUCB 4KB5A 2Q4DA 3CSSA 5DNUA 3QPUA 4Q05A 4O1IA 5HBRA 4CU2A 3WNVA 1DAEA 3ZWMA 1T5OA 5CYPA 4OU4A 1QH9A 4PPGA 1ZEJA 2XUAA 1ESCA 3QU4A 4TMYA 2CEAA 1C4KA 4U7FA 4M1OA 4J4TA 2GF0A 1R4MA 1T2FA 5DXFA 3UK0A 4LNHA 5KYUB 3NJ8A 4UUOA 3LIIA 2F9LA 4OB8A 2H2DA 1FDTA 2PT6A 2OTCA 3IOEA 3IGFA 3PXUA 3Q98A 4QRHA 4BLPA 4EP1A 1OWOA 3NEAA 4MV0A 4O2BA 1CV2A 3EUFA 4MLPA 3AVWA 1RYFA 2A58A 3U7IA 4GS5A 2M6SA 4BJ5A 3B3JA 8ABPA 5HKBA 1W4RA 3R5TA 4POOA 1G2PA 4XLZA 4X60A 2EP8A 2GRAA 1RZUA 2O8NA 4H1UA 1W36C 2CNOA 4PQYA 2DPLA 5KHLB 3BIOA 2ZCJA 4RA6A 4Q1AA 1Y7PA 3ISTA 5EKXA 3PNQA 4LDNA 4QGAA 3RRMA 4JBHA 2I6TA 4HG2A 3W9SA 2OKCA 1UOOA 3RYIB 2B25A 3UMMA 1IXYA 2E4AA 5JOQA 1WU8A 2IY9A 2D06A 5AI9A 2CMGA 4EUHA 1TX4B 3ZE2B 4AJHA 2YWEA 2BHLA 5KDOA 3JQBA 1E2BA 1DC7A 5CGQB 4JC4A 1VI5A 3G5MA 3IT0A 1O77A 1VG1A 2ATVA 4G0PA 4S12A 4WK6A 5DRYA 4F9GA 2IBMA 4TN1A 4DJFC 1EJBA 1NBEA 3NDIA 2HIAA 2Z2XA 4Q7JB 5A06A 2HA5A 3K5WA 3A6ZA 3KHUA 3STVA 3MS2A 3E27A 2BE9A 3MD0A 4WAUA 2YWBA 3I6MA 2NPIA 4DEVA 4ZYWA 1UKAA 2GCIA 3GZJA 4Y0AA 4P4SB 3KJNA 5CM8B 5F7JA 1N3BA 5DP2A 4TYMA 4AO6A 5L7TA 5EMKA 2Q4TA 1W75A 3FCOA 3L8DA 1DX9A 3BWMA 5KHAA 5TMDA 2V9CA 5ALFA 5TMBA 2UVDA 3DHAA 2B9EA 2BKEA 1JEJA 3VDXA 2GCGA 3FHJA 1SG0A 2Q6OA 3GH1A 3H3XA 4GI1A 3U7QA 1QORA 3SYMA 3L6RA 2W42A 1X94A 1GXSA 2NQ8A 4KSCA 3ELWA 4LZJA 4ZPXA 1BE6A 2Q0QA 3MINB 3V1YA 4AWAA 5CFLA 1PSZA 2PVCA 3PHJA 1KSHA 3GEDA 4DV1B 1SKUA 3CF4G 1YBMA 4YJ3B 5D2CA 3WLHA 5A5GA 2JAPA 3O4JA 1SEPA 3WHIA 2B82A 2ZRAA 5AYAA 3V8RA 1C41A 5KQGA 1UANA 1NW9B 2PSDA 1RRPA 3EUWA 1PQYA 3E7XA 3RKUA 2X86A 2OKGA 2FEKA 2VDUE 1Z4MA 2HPZA 3SFZA 3WGMA 5JBIA 1AV6A 4IUBS 4IXNA 1IAQA 3IMFA 5DPMA 1ISMA 1KQOA 4JV5B 2Q28A 2AN9A 2DRIA 2LKCA 4QSMA 1EK5A 4ONEA 2DLCX 3N74A 2ZDGA 2EJCA 4LVOA 5EN4A 2CSXA 2XOXA 4HGNA 1W4CA 4TTPA 2PMWB 2Y76A 4PHGA 1GJRA 1UKZA 5F3RA 2QTVB 1XYGA 5HJ7A 2OXCA 3LZCA 2I2XB 3SPUA 2JF0A 2P1RA 4R6WA 4BFZA 3A4LA 3RANA 1MVLA 2JVKA 3IDQA 4YJ3F 3O9ZA 4YMGA 4PN7A 4PHCA 2YOHA 3SE0A 1C7RA 3IJ5A 3VVMA 4C4TA 3RNLA 2C5GA 4II7A 4BTLA 3I2JA 5HIJA 4MDFA 1X7XB 3REQA 2WV9A 5IF9A 1ECBA 4EMBA 1FW8A 2FPXA 2CDAA 1M5TA 1CUCA 2XZTA 1VL5A 4CLOA 2Q6IA 3AZQA 3BTOA 4R84A 4CUJA 5CCEA 3NHAA 3U1TA 1IJBA 1Y6FA 1W19A 3GUVA 4F3RA 1A8HA 2F2TA 1QGDA 5C8YF 3B7PA 1QVZA 1ZVMA 4XX1A 4IZOA 2JGNA 4GXTA 5TQ0A 2NVUB 1XRLA 2AUTA 5HMLA 3RVBA 5B6IA 4HGRA 1UPTA 3R74A 5MHTA 2HCFA 3OPMA 1Q7CA 2ERXA 4LHEA 3T3MB 4DF3A 2WM9B 5J3JA 1NU6A 3F5FA 3IO5A 3T8YA 3VBCA 2GPAA 1RAEA 3HUDA 4WOBA 3ZWWA 3OAAD 2NUPA 4JR2A 4BKRA 5HIQA 2XVXA 3TAHA 4BQSA 4XIIA 1ORVA 1T9DA 2ZTMA 4RJLA 4OYLA 1N5LA 4JQYA 2VHJA 1IDOA 2R2AA 2XIJA 1EXWA 3BSFA 3MSCA 3OP1A 1X39A 3C7AA 4NNOA 2UZ4A 2O8BA 2VQSA 1BROA 4J1QA 1J0XO 1NUPA 2XPCA 3N2EA 3T54A 3BTUA 4BC0A 5JHGB 1JQ3A 2XE6A 2KS6A 3HEBA 3OX3A 4WLUA 1JDVA 2VRWA 2VSYA 3CJQA 4FQ5A 1KRHA 3WDSA 4LQLA 4LPKA 4CMAA 1DQYA 2P2CA 1I0IA 3UWKA 2GYYA 3WFIA 2OBYA 2PKQO 3RIXA 4RIGA 1J0AA 2IRWA 3FYDA 4CUKA 1YZHA 4ZZ0A 1JXAA 4B45A 2H54A 1IHPA 1ZNWA 2OXFA 1C3EA 4BEJA 5DN6D 2ZZKA 3L5OA 4WASA 1BCRB 4MKZA 4F6RA 4UOEA 2HR1A 4F5DA 2XDWA 4OHOA 1XBTA 1Q5PA 3HUUA 2YH2A 1EQ2A 5IZCC 2D3TA 4PLGA 5IWAB 5FR2A 3IXMA 3Q40A 1E79A 2MYPA 1QGOA 2QMYA 3NTRA 3T3GA 4P3PA 4DCNA 3U61B 5HM6A 2UDPA 1W94A 3FCXA 1XVUA 2I1VB 1ZHHA 3PD0A 1MTZA 2V65A 3B13B 3QKUA 3BL8A 4MRRA 3V7WA 5AOBA 3S1LA 5ARCA 4HK4A 4IFTA 4F4IA 1U7HA 2O52A 4JB0A 2X5NA 4UDOA 1FPMA 1HUQA 2IP2A 2GK3A 4FJ0A 1Z29A 4YXFA 5KYGA 2Y9PB 1XELA 3ESXA 4BEBA 2I1QA 3V33A 1PGOA 3I9FA 1U1IA 2ATEA 4MTCA 3GLHA 5F76A 3VC2A 1OGYA 3L0OA 1RYNA 2IY7A 4HN9A 1NLFA 4IG9A 4KAJA 4P7GA 1ZGHA 3IB6A 4ZO6A 1TUGA 4MV8A 1RJGA 4P7FA 1JNXX 2PYDA 1OT3A 4J6EA 4BB5A 1LSOA 4HFNA 5DYYA 1Z0AA 3VNAA 3KPVA 4LF5B 4CN9A 5BR1A 5KOHB 3QPDA 1G4UR 1E64A 3TUIC 4EY5A 5JI3E 2I2AA 4NAHA 4FKMA 4XQEA 1IEWA 1GUBA 2O4CA 4XGIA 3B48A 4ZOLF 4Q4LA 5A04A 4YRKA 1UBHS 1U3VA 4LOIA 1QK3A 3UHAA 1GDHA 2PAFA 3HXLA 4M7WA 4ARCA 2H1CA 2F48A 5E1MA 2CLLB 2XNDD 4MVJI 4Q3CA 2R6HA 3OC6A 3N6XA 3P2OA 3RTBA 5JW6A 4YAJA 3NUGA 1WWKA 1FDSA 3KEOA 2FEPA 1DDKA 4G1EB 2XQFA 3QVKA 3Q0EA 4DRZA 3H4MA 4P7BA 2OY0A 4MPDA 3FDZB 1OR8A 5BNTA 1U6KA 2IODA 2C99A 1Z4OA 3IP8A 1G8GA 4KQMA 1V47A 1E98A 1VRVA 4RM3A 5LXTF 3MMPA 3RVQA 1GL7A 2C4MA 3O8QB 4C88A 1P18A 1WA5A 2HRZA 1C4OA 4N39A 3T7RA 5A4JA 1ZCAA 1B6RA 3Q8XB 5IWCA 3ISVA 1CQWA 1SZJG 4RD6A 3JARB 2AZTA 3KKOA 3T41A 2H85A 4GKAA 2ZZNA 3U4GA 2BFAA 2FW7A 2QN3A 2CHFA 1UWCA 1FQWA 1H2EA 1F4VA 1OI4A 1TAHA 1N2HA 3TI7A 4JP1A 3BERA 2V74B 3TSCA 4JCCA 2WM2A 4KVFA 4XIFA 4R2MA 2BDTA 4PLCA 1P7CA 1GYPA 5LD2B 1T43A 4BNXA 3OMWA 4HBGA 1NZFA 3LKVA 4BDTA 3CVVA 2CNNA 1MW8X 4MR7B 1FBTA 4LZPA 1E96A 1EMDA 2BGLA 4J91A 3E58A 2CK3A 4C76A 2WILA 2RGYA 1GKYA 1C0LA 3A70A 2YC2C 3GPDG 4HYEA 5KNCA 1RXVA 3RC3A 1T5BA 2ZBUA 5AXRA 3DOEA 1JVSA 3KKZA 3TZCA 1ZJWA 5A23A 3FVTA 2JRLA 2XE4A 4MPRA 4CVNA 3CBQA 3FNFA 5BORA 1OYVA 2I3ZA 1Q7EA 2H2WA 2Q2WA 4JENA 4PSKA 4BKMA 3L7DA 5ECDA 4CL0A 1GTMA 1NKVA 4I1OA 2NU7A 1JKIA 3TEMA 3DQQA 5JAHA 1ZNBA 4J0QA 4UNPA 1OOEA 2MSDB 1X9IA 2ZBQA 4KU4A 1C9EA 1Q0SA 3SQXA 4IP0A 2WQZA 3UT5B 2YWJA 1XIVA 4ER3A 5AW4A 2Z8XA 3PTLA 1W1WA 2O5CA 4CT0A 5K0EA 5ICMA 2I34A 1LPSA 1WQ1R 1XWIA 1ZDMA 1SAYA 1M83A 2AZMA 3LWBA 4QG7A 5LJIA 5HJEA 3U2QA 2C9OA 2JS7A 2YXNA 3H05A 2D1FA 3BL5A 3O8DA 2WP0A 1DIAA 3WQHA 1PNVA 1LZLA 5MF6A 4Y2JA 3QVGA 4I9FA 4C0BA 1P0QA 4MHOA 2Q0XA 1FFSA 2Y1OA 5MN4A 4KDFA 2II6A 3LVZA 1Y9EA 3DNMA 3NBUA 4O4IF 3ZGXA 1XO1A 4UQLA 3ET5A 4RTLA 3VYUB 1R4MB 3S1AA 2WSIA 4GU5A 4KG7A 3NBAA 4LOJA 2C4WA 1FDWA 4GQBA 3PNSA 2PEYA 1T5DX 2DJIA 4NYIQ 3ON5A 3LIPA 2HREA 1XDWA 3EIQA 3KYDB 1MCZA 4UFNA 4AICA 4P82A 3OQOA 4DR7B 4RQBA 1R6VA 4H9GA 4Z7QB 3DE0X 1DO0A 5BO5A 3SSAA 2ORYA 1LTHR 2R00A 1TNDA 2BOVA 1KEUA 3PFNA 1V11A 1DZ3A 3MXTA 4UWSB 4H4CA 1EQAA 4U2BA 1IHYA 1SB9A 3I9NA 3QV1A 4K05A 5ILOA 2EDCA 2XXAA 2JDID 5FD8A 4RKQA 2HBYA 1ZXXA 3N2GA 3NDRA 3SE7A 4EH1A 4L0DA 3C3MA 4YRCA 1GFIA 2PX0A 2GVNA 3IUMA 1Y98A 2PPLA 2V5VA 4P92A 1AT1A 1LDGA 4RAQA 4M0DA 3ZHXA 2R87A 4I4TA 3G9ZA 1QVRA 4MGZR 1XYYA 3ZE6A 5E38A 1RXSA 3DT6A 4NCNA 1AQUA 4JB8A 2PIDA 2V7PA 1QYXA 2V8OA 3H75A 3W4JA 4MRMA 2YRFA 1MMFB 1ZMOA 4Q19A 5DBHX 4ZAFA 5BYBA 3TW6A 1SM4A 2VNHA 3F71A 1K7EB 2IH2A 3TDNA 4ENQA 5BYKA 3GJ3A 4HQKA 1NRWA 3HG7A 1GPBA 1VPVA 2WYOA 4LOLA 4P53A 4W1SA 3VISA 4F1JA 5LQKA 5B7NA 3H5WA 1WZ2A 1U7UA 5AW0A 1LFAA 3QIAA 2ZYAA 2IXBA 4QPJC 3KLBA 5JCPA 4ZCPA 1SD2A 3DWGA 1J8MF 2AK2A 2FNAA 2W2NA 5DYGA 1M8JA 3DM9B 4C09A 1K0UA 4TLLB 1FLAA 2DT8A 2GCNA 2E9SA 3NYQA 1P9NA 3P2IA 2ZROA 4C4ZA 5IYZF 4YJKA 1L5FA 4D8VA 3L8EA 2C92A 1J1ZA 3NT5A 3OF5A 3PG5A 3W79A 2OD2A 1RWVA 2QVYX 4MRSA 4YXWD 1C30A 4KBFA 4BB9A 4HB4A 2Y6UA 4UXIA 5GY7A 2QRZA 2VDLB 2IF2A 5DIZA 2HB6A 2ISQA 1ZHFA 5BXYA 3PYLA 2HWXA 1ZD9A 4YJFA 3A26A 3A2NA 3MZ0A 3W4IA 2QZJA 1K88A 3QWIA 2BEUA 1YMQA 2O7RA 2Q6LA 2IIQA 1SQSA 3LQQA 3PYXA 3MXOA 3F90A 3WRXA 2MSEB 3ZQ6A 4QGHA 1XPJA 4DQXA 1NVKA 1G7CA 4E1VA 3R2UA 1MO2A 1ENZA 1R27A 1CXZA 5P21A 4RULA 4DV2B 4F04A 2HPVA 1NVDA 1JEOA 2HRBA 1JHOA 2NO4A 2JLVA 5I01A 3IULA 4F97A 3I53A 4V0OA 3VNQA 3TRFA 5JPDA 4XVHA 5LU8A 2YVKA 2FCRA 4GUAA 3RUPA 4JS0A 3WYCA 5KVSA 1LPOA 2OUIA 2QZ9A 1RZ3A 2PUTA 2ZI5A 3BMNA 4GNRA 5AJZA 3VOTA 3WIBA 5K6TA 3OLYA 3Q8LA 1Z7BA 4RVGA 4GOOD 3GX1A 4YQZA 5D6OA 2B7LA 4GOKA 2HH9A 2NMVA 3GQVA 1JAIA 3K9FC 1MAUA 2X5KO 2Y1KA 3DXZA 3AERB 3PFWO 3QKWA 4OK5A 3FRIA 3ULKA 1YI0A 1X7XA 3H9JA 3KKNA 5HF8A 3REQB 3HYCA 1KARA 3HO6A 1UM9A 1WPRA 2YRXA 1E5VA 5I7EA 3DPUA 4S1OA 2J31A 4UMFA 1ST3A 1F8FA 4MS3A 4R71A 2P91A 3TIIA 1PX2A 3VHRA 2WNIA 2DHCA 4CIAA 4V24A 1QLHA 4YIKA 1X2EA 4BV9A 2ZXEA 5BWBA 3D6AA 4NQ4A 1JKJB 3G3EA 5ADVA 5JVDB 2OV3A 3FROA 5AVQA 4ZGWA 1QTIA 2WAOA 4MWCA 1M7HA 4U5XA 3RFVA 4DW8A 3BWVA 2CL5A 3AVYA 3CLUC 1FNMA 2QRKA 3GT7A 3OD1A 4E2XA 3KQQA 4RLSA 1PL6A 1HE5A 1ZXLA 2Q9UA 3F4BA 3NPMA 3KZCA 2DHQA 1G18A 1PNTA 2C9CA 3EEBA 1ADYA 4GP9A 5E1BA 3I72A 5GOTA 4YV2A 2GOYA 9ABPA 3OQPA 1ZICA 2GPYA 2B1IA 4XYEA 1Y8QA 2HK7A 3VO8A 3LY7A 4TTVA 4YA6A 3W2HA 1CVRA 1YDHA 2AUNA 4HWGA 1FJ2A 4JLDA 5C53B 2JA1A 5HIMA 1JG4A 2Q5JA 4Y1RA 4YONB 4DWJA 4D26A 2DWPA 4M1QA 3IMKA 1ETHA 3O83A 2ZM5A 2QZPA 4HJXA 1OHHA 1VIVA 4K9QA 4YR7A 3UMFA 2REQB 2XQVA 4B46A 2BGJA 4FT4A 2EWMA 3K09C 1F7UA 1RYMA 3P9YA 4YLEA 5EW0A 2BGKA 2NVOA 2IIVA 3VH1A 1UXGA 4QTTB 4IDNA 1OFUA 4ZU6X 1QZTA 2WWIA 3AEQA 1QBGA 3FRHA 4M0CA 3B85A 5TPWA 3ZLBA 3R8FA 2KYRA 3H83A 1KEEB 4BP9A 1BTOA 3KEGA 2IHVA 4V3CA 3EMKA 3RFXA 4Q21A 4ALJA 4CMBA 5ACQA 1T34A 1M8GA 5CDUA 4DCCA 5D1NA 1JMYA 4I3FA 1UJ5A 5FUWA 1VA5A 1TTTA 4RPKA 3V46A 3V3TA 2FR0A 2IXFA 5AKEA 1DJQA 3MFYA 1IQ0A 3LK7A 3RC7A 4UAJA 1KO4A 3PHBE 5ELXA 2ZI3A 5CFQA 3FFTA 4F4UA 3DWFA 2WTMA 2M32A 3I58A 2F67A 5DNVA 3MLEA 2P0AA 1VJ5A 3W5HA 4DN6A 2R84A 4QVKA 8LDHA 1SNYA 2OZKA 2EBHX 1L4UA 3K94A 3KOUA 3NCHA 4IIVA 5AHXA 5CFNA 4PX3A 3LDAA 4P5DA 3VKFA 4W5RA 1SU7A 1XNRB 5E1DA 1K8RA 2PL9A 2W43A 2HCJB 1QPBA 4C89A 3T7SA 1JJFA 3IAS6 1BMFA 3BHNA 4IIEA 1BVRA 5J4HA 2R65A 4EW1A 4HDRA 4MQ6A 5EE0A 3ZQJA 3L46A 2JAQA 3TE7A 3UMJA 2C2OA 4D92A 2NUBA 3EOAI 2DQKA 4JBLA 5LB2A 2BGTA 2RGGA 2RHMA 4A8JB 4ENUA 1T36B 3Q5DA 4Y6OA 3K0FB 5B36A 3NDBB 1M2JA 1GP2A 1TT7A 1DQPA 2R00C 2NXJA 4I66A 4KLZA 4MQ5A 4OKIA 5EJMA 3WK7A 2XYQA 2ZSFA 3DBVO 4AJLA 1PG5A 5CVEA 4LJYA 4YRBA 5ARDA 5J23A 3LRPA 3N5KA 3NVAA 1C8KA 3V7YA 1GZ4A 1SUAA 3RV3A 3VPHA 3WZMA 5HVNA 1N2CE 4OG2A 4C0LA 5BQ3A 1HFWA 3BIXA 3ORQA 2BTOA 2IYEA 1PW7A 2WWGA 4LRSB 1JJIA 3RVDA 2OMEA 3UT0A 2FVYA 3V2HA 1MEOA 4OGKA 4WFQA 4C5BA 3H4VA 3UV6A 4WD3A 3OTIA 5C7LO 3N2KB 4HQRA 3SVTA 1E99A 1QVVA 2W2KA 3PQCA 4XWTA 4YRRA 4DMCA 2O19A 2V1UA 3TNJA 2A0XA 4TYWA 1XCOA 1T9GS 5I51A 4EM6A 3IC5A 4IH4A 3VR3A 4CV2A 4A73A 1GARA 2XCLA 2HF9A 1KXZA 3IRVA 1DBIA 3ZS8A 4GPTA 5M2QA 4FGLA 3FOZA 2C8LA 3STTA 2ZYHA 1U1FA 3Q5GA 5ECYA 1SCUB 1Z8FA 2F8LA 4UULA 4F12A 3SKVA 1E0AA 2B4KA 3GAFA 2VK4A 4GBED 3PKIA 5EPUA 5IVKA 1KS2A 3C3YA 5IDXA 2KM1A 1XL0A 2A94A 2ZRNA 4JC5A 1QK5A 4Q3EA 1BH6A 4WKPA 3V7NA 4HVLA 1OSNA 2F90A 1RNLA 3WGLA 5JJ5A 4W5WA 2WIGA 1OJLA 2PD3A 4AYXA 4PDXA 1U9IC 4OHRA 3BSWA 2FRDA 4B8ZA 3UJ7A 1IHXA 1CZLA 1F6BA 1EFDN 1QK4A 1XZMA 1XU4A 1MVNA 1Y48E 2PJDA 3O90A 2NTJA 5DNEA 2BGUA 1WOMA 5FI1B 2O8DA 4DV7B 2ZR0A 2B4RO 5BYJA 3V2UA 3PGJA 2GN4A 4OSEA 5DLEA 1K63A 1OUMA 3RASA 3D0OA 3NKFA 1JQDA 2C3UA 4JP8A 4KN9S 5B53A 2F1JA 2Z58A 4IV8A 2QRGA 1HRKA 2X0EA 4C4RA 4ZAWA 1KETA 2EJTA 3P0EA 1F9EA 2W5UA 3AB7A 2P75A 1KIMA 3LUJA 3O74A 4G1FA 3STWA 3H5TA 2O7QA 3IQEA 1N2BA 2ACKA 1XD2A 1ZFNA 4YJ2A 4X6XA 1TK3A 3ZXXA 1Z28A 4HO1X 3L77A 2JH8A 4GEGA 3X1JA 4AKTA 4CR7A 1I7LA 2F3UA 2OV2A 5FYQA 1QXSA 3LZDA 4A5SA 3FWYA 1V5WA 2FE4A 2V6GA 5HKLA 3RK1A 3KV1A 4MINA 1E4YA 3TZHA 3I1IA 1JIKA 2A9KA 1GSHA 4XCVA 3E9YA 3Q9SA 2RHHA 1O58A 1YZTA 3NIFB 1NQVA 2DR3A 3W2EA 1QRRA 3A05A 5DEOA 3M4YA 5TQ2B 4MYHA 3SGLA 2QTZA 3HA2A 4ZT3A 1L8LA 1KPGA 1XKLA 3QLVA 4WERA 1JR2A 1NHWA 4C4SA 1S0UA 3AF0A 1P91A 1KA9H 5HIAA 3B1JA 1XZKA 1A7JA 1C0EA 2N1MA 3KKLA 5CDHA 2RIPA 4Q4CA 1PJZA 2ARKA 2G6BA 2QTNA 5HUQA 4FFDA 4LGVA 2K7ZA 3HFSA 1O2DA 1EZ1A 4JSTA 5CJ2A 4UM9B 2NN3C 1NXTA 3OLVA 1DOZA 1G3RA 4KV9A 1Y6GA 3EULA 4BEWA 3F6PA 2UUPA 5CIWA 3UOWA 3C48A 2G76A 4RZUA 1KSJA 3LCUA 1A96A 3P20A 1NP3A 3LC2O 1RMQA 1OD6A 4I4LA 4NBSA 4FS3A 4MR8B 5EVJA 2PX4A 1QFZA 1NF9A 3CONA 2BV3A 4OM8A 4BEVA 2I7TA 4KQGA 4J90A 2WFLA 1MAWA 1PTJA 1RLJA 2P5SA 4PSDA 4B81A 1E3QA 4GMDA 2W0MA 3FUTA 5A7GA 3S0JA 1B8UA 1W0JA 4JYAB 2HMVA 3SHTA 3A6DA 5EUQB 3T5CA 1AIPA 4NZPA 3W7VA 4DQUA 4UNNA 3UA4A 1A9PA 3QJGA 4E07A 3UH0A 1CQPA 3PENA 4ZI2A 2ZRGA 3QEJA 1SKAA 1UIMA 4Q4AB 4C30A 5E3HA 4PZDA 3RIYA 5LIRA 3R8XA 3THRA 1QQAA 1HDXA 4LIPD 3P4UA 1UKBA 4YFYA 1Y6ZA 2H29A 3FF4A 1PFYA 4F4CA 1P73A 1V8PA 3ETEA 4JUAA 4Z9AA 2RHGB 5BSMA 3SCZA 1C1XB 4I1SA 1FW6A 4D3ZA 4UXHA 3Q2OA 2E87A 3U3KA 1FTGA 1HQKA 4PYKA 5JH7A 4V0HA 3GB9A 2FI1A 2WD9A 2GCEA 2A14A 3G59A 3IEKA 2FW6A 2OXTA 3UW3A 5KPDA 1N34B 4HR7A 3DLCA 4E2FA 2K87A 4MDYA 5BN5B 3BWYA 4EPVA 1NKSA 5DP1A 5EZ6B 3WK6A 3TEFA 3A10A 3KL7A 3JCZA 4TXHA 2O3RA 3RG2A 3MPOA 1ZC3A 5L3ZA 1JRLA 1BD4A 1RE0A 4KSBA 4O1MA 4P35A 4B7AA 3U44B 5HMMA 1IM8A 2BY4A 1WV0A 1YK1A 1RJ9A 2D8AA 3U37A 4FFLA 1NSFA 4PZLA 3HY4A 1Y3AA 2UZAA 1Z7EA 1JJAA 3W77A 2FSHA 4XTRA 1BC5A 3N2ZB 4PZPA 1BQ3A 5JIBA 4NU8X 1E1KA 4YMSA 5BN4B 4BN0A 2JD1A 1G6KA 3PQ5A 2QE7D 2G80A 4N3BA 4TZ9A 1TMGE 3OZ7A 3K2BA 4C1HA 1MRSA 2I4RA 1Y9DA 2WIAA 5DLPA 3RUAA 3DVLA 4JKYA 3GLGE 5BMOA 2ILVA 5G4KB 3RC8A 1IVYA 1P7PA 2IZ1A 3CG4A 3DAOA 2W7TA 1C3OA 3IAFA 4J43A 5WRFA 1WB5A 4KQ1A 4RJKA 2BMWA 3D7SA 4FIDA 1VKNA 3CFYA 5F12A 2H8KA 2O2JA 4DLWA 1QHNA 3ACCA 1BKSB 3DMGA 3P5SA 3B51X 4M8SA 4ZGGA 5L9AA 2E55A 3V8VA 3O1IC 3K6JA 1KOFA 3I4CA 3KKQA 4FOLA 4E6EA 1OLUB 4FMDF 5ARBA 3K2QA 5A5ZA 1G5HA 1YA4A 1AGYA 4ISBA 4EKIA 4HNRA 4MV1A 1HDRA 4HDNA 1W1UA 4N12A 4WZZA 5IH7A 2OG1A 2VP4A 4GZ5A 5EHNA 1JHMA 1UODA 1OASA 4HNGA 1OXTA 1A5SB 1PQ4A 4U6SA 5NLLA 4AO7A 4FHEA 3KUKA 4RY2A 3GUUA 1Z82A 2WE8A 4LJSA 4ALLA 4IFIA 1E1LA 4BNYA 4QU9A 1KZ7B 1LK7A 2OXEA 4PG5A 1XD9A 2GPBA 4RCYA 3A1TA 2AE2A 3VMFA 2GSDA 1JFTA 1FFGA 3RUHA 1KC3A 3IX7A 2JFYA 3ED5A 2IX9A 4QX6A 2WVHA 1T0JB 3ESDA 3LK6A 4OEHA 1W4LA 2W90A 4BKOA 5JMWA 2UZIR 3KUXA 2W71A 1JU9A 2HSWA 2OK8A 2J4CA 1WZIA 3HPRA 4H08A 4L78A 4PBSA 2QQ0A 3ZG6A 2CMDA 1MXFA 5LQUA 4ZK2A 3BAFA 1ZPDA 3IHWA 1G8YA 4QEDA 4HH0A 1YVRA 4DANA 4IDQA 1P74A 3GRYA 2P6MA 1G8FA 2GM3A 4G6ZA 1ZGZA 2BH9A 2HIHA 4C3ZA 1YZQA 1JGTA 3U0BA 3GN2A 4KDCA 2FRDC 1EFCA 3VR3D 5AVVA 5DXAA 3NV7A 3RJMA 4LHXA 2EZTA 1Y89A 2QN9A 4N01A 4EX7A 5F3WB 3FXAA 1HLKA 5ENDA 3JQEA 4U5QA 4WKNA 3C4JA 3AHFA 1YZNA 4KIJA 4LGYA 5DNAA 1CUWA 2ZUTA 4FR7A 2A78A 2PWAA 3OSUA 4C78A 3EOZA 1KR3A 1KR2A 3FCEA 2IOYA 1JT2A 1X1DA 2LDBA 4LYEA 5AVJA 4EAQA 5HJ5A 1K6IA 2BFDA 2Z2ZA 3JQ9A 5AKKA 3HZOA 1T36A 3CKMA 3UENA 3ZCPA 2P2LA 3KLMX 1BSVA 4O4LF 4TYTA 4P4UA 1PWZA 1ZH6A 5HP4A 1J0DA 2GS9A 2WYVA 3G5TA 4BNNA 4QYXA 5TF0A 2MHCA 4FHGA 2QVBA 1EJ0A 1PD0A 3DCYA 3EY9A 3NRJA 3R44A 3ODPA 4HH1A 4KGZA 4AD8A 4B40A 3KQTA 2XCRB 1L4YA 3AU8A 1NX9A 1MP0A 3LL7A 2CF6A 1DBVO 1LBTA 2J48A 4X7BA 1CRWG 4XFKA 2H0QA 5HILA 1WSAA 4G01B 3VXKA 1AC5A 2XJ4A 1PLKA 1G20E 2WWWA 3IELA 3O26A 3WP0A 1XYVA 5I45A 2VI5A 3HDQA 3NOQA 2QG4A 3PL5A 3DKRA 3PXBA 1KWGA 1W7AA 1T2CA 1Z5NA 1BDJA 1YB4A 2EFEB 3C14C 3IBYA 1WCIB 4NBKA 2JVIA 3KEFA 4QPCA 3COYA 4LXUA 4Y1RB 4Z5XA 3ZR9A 4NX2A 3Q72A 2WJ6A 2HLPA 3EGOA 1X7ZB 1DTEA 2ZUUA 3IT3A 1JFVA 2JIRA 2JCXA 3ZTYA 4PZ0A 3QBEA 4R1MA 3T38A 4F11A 3JVIA 1VSBA 4QJ3A 1N0IA 1UDRA 2Q0HA 2J3DA 3E22B 2Q27A 3N8GA 1SB8A 3EXIA 1PT8A 1RLIA 2D3WA 4L51A 4OJYA 1H1LB 4GPAA 4J9VA 5KILA 2YYYA 4KVGA 3Q9UA 3K96A 1BNCA 5FQOA 4DLXA 1E1QA 3DFIA 1LJLA 4OBWA 4OP2A 2GYWA 5ALPA 1U80A 1ZM7A 4PAWA 1CQXA 2JI7A 5EWJA 3FWNA 4DDTA 3PJGA 1H2HA 3L7NA 3Q1LA 1ODFA 2F3PA 3R3WA 2L19A 4RBSA 1DTSA 1IMJA 3JQQA 2ZJZA 3MJVA 4ZWNA 1SVLA 3RSCA 1NX6A 5M34A 3IOGA 3HU5A 4ZCIA 3V5NA 1Y3HA 1FYFA 1PTJC 1FDUA 4IKOA 4RV5A 1LBIA 2NU8B 4BMPB 2J5RA 1UOPA 4ZHQB 5LA6F 2O8VA 5EJ8A 1FUYB 1TUBB 3B7WA 4RGQA 4D44A 1O96A 5E9JA 1G21B 3THOA 1EBBA 3V4VB 5KWSA 5KYYA 2BHTA 4FDVA 1YDEA 4BKPA 2A7XA 4F4DA 2XZDA 5JCJA 3HVKA 1BRMA 2PMKA 2NUTB 4JT9A 4O5OA 2A3RA 2D4AA 1O94D 3IEXA 4R9VA 4UEKA 3VX4A 1R6XA 2C8KA 1AZSC 2P4SA 1LVHA 3AUXA 3GEMA 3CNBA 4A9AA 5C9ZA 3L4KA 2UXDB 2CUTA 1SD1A 3JQFA 3DR3A 4RIEA 5ALQA 2ZJ5A 3KTDA 3OHSX 3V8NA 4DCOA 3ZDYB 5K0FA 1N9ZA 1R9NA 3RQSA 2IXTA 2WKPA 2VLBA 3A3KA 3MGAA 5D3KA 3F3KA 1AKWA 3MTBA 1ODCA 4P3OA 5AXOA 5ES4B 2NO6A 1CQZA 4DKXA 3OY2A 4YV0A 1QJCA 1ZESA 4AULA 4WY5A 5E2BA 1EDEA 5DWDA 2XMDA 1EVEA 1RMYA 1C0KA 1P60A 4DJ5X 1P7WA 2WPDD 1EGAA 5F64A 3ROFA 5JASA 3RAEC 3FNEA 3LO8A 1MJNA 3OZXA 4CYMA 5BSWA 3QKTA 2GTPA 2MT9A 3OLQA 4XTCS 2JGFA 3O75A 1M34A 1XEWY 2IHKA 1J07A 1D2CA 1J56A 1KDPA 1EDZA 3A8TA 2FR8C 5E6SA 3MGCA 5FOUA 4MA5A 5B64A 1EK6A 4L6CA 4X20B 3RU3A 4AN1A 3AONB 2WWXA 2XEXA 3RIEA 4BLWA 2WG1A 3RHFA 2I6FA 5EVDA 2EW8A 4D82A 3GW8A 5IW8A 5CB8A 1A8SA 3CH7A 2BFPA 1VDZA 5D84A 3P0HA 3R9KA 3LNCA 1HYQA 3U60B 3O9MA 2BSQA 1LBSA 1SEVA 4LSMA 1QONA 3PX3A 1D5WA 1SCKA 4JT2A 3KT8A 3FTCA 4C4YA 2HD4A 4P0TA 4PGHA 7AT1A 3B1WA 5EA2A 1QIMA 4RSMA 4P33A 3PJEA 4LKRA 3WYBA 3P9QA 2FSUA 2OG2A 1JP7A 3NQ41 3GRUA 4YDHB 4W63A 4B73A 1M1YA 1EA7A 1F2UA 2JFGA 3B5EA 1ZN9A 3D5EA 3URKA 3ZX5A 2JCVA 4Q9DA 3I4FA 4MCAA 2IITA 3D4OA 1KAOA 3QSGA 5GQSA 1KY2A 2YHUA 4V39A 4LBZA 3L9XA 5IKPA 3SZOA 3X1XA 1DXKA 5DNYB 1E4OA 3NYWA 1DC8A 4A0SA 4DJJA 2CHEA 2Q6TA 4N1AA 4AY2A 2CDBA 4RF4A 1NY6A 3ENZA 1XG5A 4RZ2A 3X3HA 1KJJA 2YMMA 4BWGA 2IEZA 3QELA 3TJMA 3OQ1A 1UP4A 3OCJA 3QFRA 4HADA 5F4ZA 3DO6A 4AMUA 3AUYA 2FK6A 4W1PA 3KL4A 1NL3A 3I34X 2B0JA 3UJ3X 4DB2A 4G25A 1TZKA 3R24A 4CEHA 1E3EA 1BE0A 3FKQA 3ZJYA 5AESA 1EB8A 1M6NA 3FMVA 3KJFA 4P22A 5FL7D 2WUWE 5FTLA 3TRDA 3WYNA 3JATB 2QD4A 3WSVA 5DM70 3LQFA 1COWD 2B8WA 3ICCA 2FH5B 4FJ2A 1WUHS 5AK5A 5AW9A 2BG8B 1ZU5A 4V2UA 4RTJA 4PQEA 3BC2A 4HFMA 1J7KA 3QUSA 4E22A 2YV1A 1GPMA 4WXMA 3RS9A 5K8IA 1YC2A 1RR6A 2O23A 3GLHB 1DRVA 4LXGA 1VB3A 3RS2A 2PGJA 3DLAA 4LVCA 4XB2A 1VE6A 2HC9A 2B99A 1K5DA 1AGNA 5F23A 1GITA 2MSWA 3EPHA 3AF2A 2PLWA 1Y8RB 3MBOA 2VLIA 4O4JF 2FZVA 3DUFA 2EX1A 1ML4A 1A04A 1ID1A 3BFVA 2XA1A 3MEQA 3CW9A 4XD2A 4E09A 3I01A 1U7DA 3BTSA 1LCIA 1SUFA 3I9OA 1MORA 2FEXA 2FKNA 3LWZA 4NDNE 4DNXA 5KO2A 3MD7A 3BEDA 1K8ZB 2D54A 5EP3A 4FBGA 3VX3A 3NALA 2H92A 4Q7EA 1KORA 1MG5A 2OP1A 4XEUA 3W8EA 3E7DA 5JYBA 1AXRA 1V6AA 1WCYA 3IUNA 4JD5A 4I1PA 1DDGA 4O2AB 2H7YA 4TMXA 2ZYVX 5ALGA 3SQMA 3QF4B 3ZKWA 2Q8PA 5KBYA 3Q8MA 2VEDA 3MINA 3HB4X 4YCJA 2XGGA 3SAJA 1XZNA 1SOUA 2Y3IA 3GUCA 2VUUA 2W9XA 1TLFA 4MW9A 2LV8A 1YB7A 4FXOA 2FMIA 1JIVA 4XB6B 1U4OA 1YGPA 2IYXA 4UM8B 1Q16A 4Q9LA 4YMTA 1ZUWA 4E4YA 1EFLA 2G08A 3N59A 5G0WA 1Y7LA 1KRXA 3WLTA 3RVLA 4WJZA 2A1UA 3C4VA 2GD0A 5L3QB 4QBTA 1ECLA 1JYFA 4D0GA 1DHTA 4H6WA 2OYRA 3R9WA 2GAOA 1OLSA 1QYCA 1FSFA 4I1UA 3INYA 2YS7A 2Z8YA 1CS0B 1GNTA 2OHJA 3ORSA 3ORFA 4I9GA 5B3KA 3Q10A 4MR9A 3TLXA 2Z6UA 3UZUA 1HTBA 4M22A 4UD2A 1SRRA 4WY8A 3RVPA 1RZRA 1NY5A 1DQRA 1EHCA 1T8YA 4IMRA 4HRVA 1GPKA 4G1CA 1NAIA 4QPPA 5A02A 4LRTB 2OL4A 5G0VA 4Z4GA 4RCVA 3KB8A 3Q9LA 4PANA 4NXMB 4D1VA 4DMHA 1SCAA 1Q57A 2FMUA 3Q3JB 1RYZA 4YRSA 1MX5A 3EVTA 2QJFA 2F17A 3ILSA 2HA3A 4PPNA 1VE9A 1NJFA 2CW5A 5AKGA 2X2FA 2CXPA 5DYTA 3F7MA 1MTOA 5JYEA 2QUAA 1BXGA 1N2IA 2OQVA 4KQ2A 4JI1B 4PM4A 1QO7A 5TVGA 2A30A 4LSGA 1CR4A 2ZANA 3F49S 4PLZA 4TTIA 3ESYA 4H2DA 3RD5A 3WO0A 3SQOA 1A8UA 3F98A 5GTDA 5IUJC 2ZI7A 1OYOA 5G4LA 2ODWA 4PNHA 4GPZA 3W7BA 5JZBA 2LP4Y 3AOGA 4BO6A 1XZEA 4PR3A 1Z7WA 5FOTA 2PZFA 5DV9A 2BZ0A 1L7OA 3PUZA 2OCPA 1F12A 5F5NA 3HN2A 3MGBA 5CB6A 4XIGS 2HK9A 1TYBE 1IEVA 1VE1A 3D3QA 3T4XA 1MG0A 4GT1A 2R6CA 5KQPA 1NYLA 2BFEB 2OC9A 4JVLA 1NV8A 3JARA 4C1NA 4QDKA 4FU0A 2VRCA 3BDIA 4DABA 2YJZA 3GLFE 3L7YA 2J4DA 3B82A 4L2IA 3HL4A 4CHGA 3PEWA 3EAGA 3JQGA 3IR7A 3GG2A 1HYHA 4L0MA 2XGSA 4RTKA 2GWHA 2CLEB 3L1HA 4U9IS 5ALIA 4B5KA 1U3CA 2WZCA 3TQFA 2WYUA 5B4VA 5JS8A 4EUFA 2B94A 4BX3A 1HSZA 4ZV4A 5CVTA 1ZAYA 1Y5NA 3P71T 2GCPA 4QUAA 1A3CA 4Y18A 3SMVA 3ZE9A 5JE8A 3P2EA 1PDOA 4FYKA 1KDZA 4E4RA 1E8MA 2I71A 3NM4A 4RQAA 1KZ1A 4MR7A 1ORHA 2CJWB 1KEPA 1KVUA 1ZA1A 3B20A 1US8A 2ZDHA 4MUHA 5E9QA 4WUVA 4EKEA 2I9KA 2GXUA 3KJXA 4X92A 2P77A 2CB9A 4C1CA 3P97A 4DQVA 1QO0D 4Z1MD 2DTEA 1D8AA 2WT8A 3LXXA 2ABWA 3KQNA 4R2KA 4AXXA 4V3BA 5FYDA 3ECSA 1SKYE 2C2WA 3UUGA 5G40A 5EVCA 4W6ZA 1KEVA 4DC1A 1FNCA 4J0FA 3U62A 4D9KA 4ZEVA 3H2YA 1V1RA 5C31A 2UVPA 3MGGA 4GVPA 4IWNA 1ACLA 2HX1A 4OGLA 3SHVA 2WJZB 3E0QA 1MXHA 1UWVA 3C8HA 1J0BA 2FX5A 2VRCD 3E3NA 3H11A 3FSEA 3OJOA 4NZZA 1J24A 4TWJA 4MVJD 2XOKA 4EATA 5KQSA 2HNKA 5FPTA 2DF8A 2YV3A 4WZ6A 3UEOA 1DBRA 721PA 5J4VA 2D1YA 2IPMA 4RXTA 4FYPA 1C2YA 3OUTA 1IBCA 1SIBE 4DIUA 2P8JA 4DXDA 4RK1A 3QBVA 3HCCA 1ACJA 3PQDA 3SZ3A 1AO3A 2ZRLA 4HQ0A 5F2EA 4QODA 3FCYA 2FPSA 4MV6A 5CLGA 2GJAA 4U2FA 5HPYB 1II8A 1NBME 1VBFA 3WLPA 1WRAA 4YNBA 3OBBA 1GGNA 1T4CA 3OCVA 1JIJA 3D5TA 3KBOA 3FTNA 4NS1A 2EGUA 4DA7A 4D9NA 3H2BA 1AUXA 2X9GA 3IT2A 2P2GA 3UH1A 3W6PA 3JALB 3T9DA 4B6JA 4LJLA 4L9SA 1VL0A 1YGYA 4NYJR 1WXWA 3DEAA 4KAXA 1BYIA 4KO4S 5FNZA 2GYUA 2FGJA 4IMPA 1KAHA 3FVQA 3HZHA 4KWCA 1X1EA 3AG5A 4KFRA 4HD8A 4M2LA 3ERCA 1P2UA 4EMSA 1AKUA 5D3MA 4YC7A 4AJ4A 4OA5A 1Z6QA 1Z5GA 1SOAA 3BTVA 3QV2A 4BFVA 3PJDA 1BE8A 3DAYA 5G41A 3V6LA 4E13A 7MHTA 4BBZA 4GI7A 4RDCA 3TI9A 1QCCA 4A6XA 3QX3A 4QBFA 2B5OA 4MV3A 4ROSA 3TH5A 1NXVA 3C3BA 1L2TA 1OIXA 3R3ZA 1UJCA 1W9MA 4YWJA 3T15A 3H4TA 1W0KA 2GPSA 2O05A 3VR5H 3GJ4A 3VPXA 4QVIA 1BDMA 2W2PA 3AEXA 2AHRA 1Y5LA 4DM4A 4Q9IA 3S40A 4CDGA 3IIKA 3OE4A 1WHSA 1W46A 1E6EA 2CD7A 1C8VB 1Z35A 2CFTA 2QSYA 4IVQA 4K6FA 2Y2VA 4UW9A 1C9DB 3WC4A 1QPGA 4MW7A 3PTAA 3TLKA 1DJPA 1G5FA 1JQJC 4MW4A 3PL1A 2AQHA 4KXYA 4US2R 1CE8B 2G0TA 3OZVA 1KKMA 3OPYA 2ODEA 3QFFA 4NG4A 4OQMA 3SYTA 3ZU2A 4JLWA 3AFHA 3R0QA 2OQRA 4B7UA 4DG5A 2ZT6A 3AQIA 3WB1A 1RKXA 1P7YA 5KI6A 1U31A 3QG5A 3ZGNA 2WJPA 1CJSA 3MQFA 5D7BA 2Q42A 4IIBA 2Q07A 4ND3A 5CLHA 3WKBA 2NO1A 2QYOA 1YJQA 1U7OA 1GPH1 1AS0A 1NPTO 1ZVQA 2CJXA 2H1SA 3H2JA 4L8YA 1J9GA 1PTKA 3IVMA 2TYSB 3NNNA 1ZN8A 3CRW1 4HGQA 4J49A 4IVNA 4A1OA 1P5ZB 4YROA 3F6RA 3OPYI 5CNJA 5H5JA 3HJHA 3TR0A 1RSZA 3DMTC 4IL5A 3GEBA 3N8NA 3E35A 4JLNA 2QP4A 3BBPA 3PNMA 4ZGBA 1YQEA 4PYOA 4ZREA 2X4LA 3THSA 2P9CA 1ZRMA 5DI3B 4X54A 3VPFA 5JALA 1JDNA 1M34E 2VBGA 3BIFA 4GO1A 3G17A 3BC1A 2FUKA 2EOAA 2PGIA 4ABTA 3KYIB 4MPPA 3W2TA 1QWSA 4MKRA 5HQTA 2O8EB 3CIFA 5ALKA 2BKUA 3NBZC 2VDJA 1X19A 3KT0A 1U7ZA 3TZEA 3R75A 2OYSA 3AY3A 1J49A 1Q0UA 4HLUC 4JELA 4RK4A 3C3CA 4JB2A 4E21A 4OLHA 1TM2A 5T4EA 2B69A 2PZAA 1PEDA 2BRUA 1EFRD 1UF9A 4CMCA 4I5GA 2O14A 3S8EA 2A0UA 3W4KA 5AVOA 1GGEA 4QT0A 1NVVQ 2O5VA 3N7AA 1XMOB 1VL1A 2QVGA 1S2OA 4TM7A 1AKEA 16PKA 2ZBFA 2NACA 2EARA 3R7SA 2PFGA 5FI5A 1CX9B 1CFZA 2WHYA 3MQ2A 2VZ0A 3I3OA 3ND8A 2E4WA 1EWKA 3LH5A 1SQGA 1GUAA 2KE5A 4IEFB 4JQSA 4K03A 3M83A 2I1LA 3I0VA 1P2DA 2PBZA 1LDYA 2RGNA 2PU5A 4JEUA 4UCXA 3ZI0A 2XX3A 3COJA 4PLHA 2VYCA 3G5UA 3DVAB 4GYYA 2KLBA 4WDQA 4DZZA 2FMTA 5C8DA 1ZM3A 2JEYA 5FFMA 4ZEMA 4R68A 3L8CA 4PC6A 4RMHA 3IJPA 5CT9A 3EBPA 2H0RA 3JWIA 3G49A 4ESHA 4YT2A 3IL2A 4R83A 3M5DA 2WTXA 5JMPA 3EYAA 1C1YA 1D5CA 1DJNA 2Q21A 4M1SA 3IQFA 521PA 2EQ5A 1GV0A 1KJ8A 3T7IA 4Z6XA 3JPWA 3NG1A 5D5HA 2CG3A 3LBHA 1GRNA 2GN8A 2J8ZA 4O3FA 2YZGA 2YN0A 3FOWA 2C07A 2OCLA 2YXPX 3HSYA 2C97A 1EE1A 1L5LA 2DKNA 5FUMA 5FPHA 3JVUA 1SXIA 2QQEA 2R60A 3HP1A 1JKJA 1OLOA 3E53A 4MIOA 3AI7A 1QCZA 4ZP1A 4BY9E 4RM2A 3CVUA 1NUAA 3UGKA 4F1WA 3FCAA 1UEXC 4Q1DA 1Z5VA 3VYRB 5LMCA 3BGSA 1CUHA 1JNYA 1NJ6A 4D46A 1P8AA 3IVRA 3L0IB 1T5TA 1MJGA 1TKRA 2HXYA 1XTIA 3QLTA 1DTWB 2R8YA 5KYUA 3RUEA 3TW0A 3V7UA 2P6NA 3AHEA 1YBVA 5FJJA 5BV8A 1PE0A 4D9MA 4DMMA 1YS1X 4LDJA 5EXEA 1XZQA 3JU3A 2YJ5A 3T94A 2G36A 3UMBA 4FR5A 4DSUA 4PLPA 3T5DA 5AIAA 4OK6A 1XV5A 2FHXB 3JVDA 5F9MA 4EW2A 1U9JA 4EY8A 5AUOB 3BGDA 4N0EA 3ZJUA 2CL7X 2GJSA 3VU9A 3GMTA 1HE2A 3ILVA 5K2MA 1EDDA 3PEVA 2VIIA 4TKUA 1DBSA 3NC0C 1GCGA 2VRBA 4KQKA 1OWLA 4CIDA 5ACTA 3M82A 2PRYA 1XNQB 3SOZA 1M2NA 1X1TA 1GL3A 1RBMA 3BCSA 3HSKA 3ETJA 3I37X 4GKVA 3KPUA 2ZWPA 3O8LA 2VW8A 1TA9A 3L8HA 4BASA 2Q46A 1FRQA 2W2QA 3DYBA 1JVNA 2CVPA 5H0IA 3F46A 1DKOA 2V58A 2WKRA 1XJ5A 3DBRB 2MSCB 3TLCA 4HEA6 2Q2NA 1RFLA 3PUYA 5EZSA 1FS6A 1V1MB 3UPDA 4DLLA 2HT1A 1FOEB 1Z8DA 2Q6VA 3OJWA 1YJCA 4K1XA 4INZA 1L7PA 5BNIA 4AECA 1XPRA 5TT0A 1M3SA 3TM5A 1XFAA 3DBHA 4MCJA 4B8YA 4PHHA 5J1SB 3CMCO 3CR8A 3IHTA 5EIBD 2IPXA 2H7VA 4B3RB 5FTWA 5C3MA 4CIBA 3M81A 3T5BA 2R6R1 4KN5A 2DFVA 4LI3X 4E1BA 1RQNA 3KPJA 1NHGA 3BE8A 4K87A 1Q3HA 2XAAA 3I12A 3ACBA 2YVLA 4CRWB 1ABEA 2PUVA 5IVIA 1DFHA 1DQSA 2AFVA 3M9XA 3IALA 1KI2A 1Y8AA 3QVXA 1YOBA 4HVAA 4QOSA 3MUOA 4ZO3A 4L9WA 5F7ZA