1YCHA

X-ray crystal structures of moorella thermoacetica fpra. novel diiron site structure and mechanistic insights into a scavenging nitric oxide reductase
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
398
structure length
398
Chain Sequence
SQPVAITDGIYWVGAVDWNIRYFHGPAFSTHRGTTYNAYLIVDDKTALVDTVYEPFKEELIAKLKQIKDPVKLDYLVVNHTESDHAGAFPAIMELCPDAHVLCTQRAFDSLKAHYSHIDFNYTIVKTGTSVSLGKRSLTFIEAPMLHWPDSMFTYVPEEALLLPNDAFGQHIATSVRFDDQVDAGLIMDEAAKYYANILMPFSNLITKKLDEIQKINLAIKTIAPSHGIIWRKDPGRIIEAYARWAEGQGKAKAVIAYDTMWLSTEKMAHALMDGLVAGGCEVKLFKLSVSDRNDVIKEILDARAVLVGSPTINNDILPVVSPLLDDLVGLRPKNKVGLAFGAYGWGGGAQKILEERLKAAKIELIAEPGPTVQWVPRGEDLQRCYELGRKIAARIAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray crystal structures of Moorella thermoacetica FprA. Novel diiron site structure and mechanistic insights into a scavenging nitric oxide reductase.
pubmed doi rcsb
source organism Moorella thermoacetica
molecule tags Oxidoreductase
molecule keywords Nitric oxide reductase
total genus 131
structure length 398
sequence length 398
chains with identical sequence B, C, D
ec nomenclature ec 1.-.-.-:
pdb deposition date 2004-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ychA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1ychA01
2KQUA 3GAMA 5EA2A 4UAMA 1WUOA 4YAOA 4EXSA 3VPEA 2BFLA 5F12A 3BK2A 4ESEA 1L9YA 4YAWA 3W7AA 1QRDA 5EVDA 5LE1A 2UYXA 4EY2A 2WC1A 5A0VA 3TEMA 3GFRA 3U7RA 2P1EA 5AYAA 5AXRA 4CF6A 3JXPA 3MD7A 4H0DA 4GCWA 1DXOA 3B6MA 3O2NA 1RLJA 4RAWA 3KLBA 5LBUA 4F6ZA 4LE6A 3F90A 5ACPA 3ESXA 1WRAA 5LMCA 1ZX1A 3H3EA 3RKJA 3HA2A 4AWZA 1X8IA 2R97A 5EHTA 1J8QA 3NHYA 3ZQ4A 4F6HA 3TP9A 5DPXA 3LT5A 3SBLA 1FVXA 3EDOA 3K1YA 4C1CA 3B6JA 5LBTA 2MOKA 2Q62A 4FGKA 3I14A 3NHFA 1CZKA 1P9EA 3RKKA 2Z9DA 3OVMA 2QDTA 3UXEA 2XODA 3QE2A 2M6SA 2X2PA 4QOIA 3TE7A 5ULLA 5FA6A 2FAXA 2WYMC 3ZHOA 4RL2A 5AHOA 1QHEA 5F4BA 1MQOA 4RBSA 2FK6A 4RL0A 4M0CA 5LM6A 2BZSA 3DHCA 2Q0IA 3PY6A 4HL1A 4YQEA 5HH4A 1OBVA 2P97A 3IEMA 4C1GA 4UBQA 2X2OA 1C7FA 3ESZA 1CZLA 4GQIA 1AKWA 1JA0A 1F4PA 4GYQA 3I13A 4F8YA 2HPVA 4BMPB 1D03A 1C7EA 2HNBA 5A4KA 3T9MA 1CZUA 1YOBA 4PVTA 3Q6VA 4ZNBA 4HS4A 1T5BA 1CZOA 3SFPA 5LJIA 2BC2A 4P62A 1ZWKA 5EVKA 1CZHA 1X8HA 5ACQA 3N3BC 3L9WA 3X2YA 1OFVA 2QMZA 2WYLA 5KILA 1XT6A 2WHGA 3W78A 5ACRA 2QDSA 1Y44A 4DIKA 2HB9A 1JJTA 4ZVNA 2BIBA 2XOEA 4UWRB 5LCHA 3ES9A 1YDGA 3OWXA 4C1EA 1DX9A 4EFZA 2F1OA 2ZO4A 4J5HA 4QODA 4ZO2A 3OJXA 5B3KA 1VGNA 4ZEJA 2OHHA 1H66A 4EYFA 5LSCA 2MWMA 4UA4A 3U7IA 1YCFA 4GYUA 5ACXA 1DXKA 1WSBA 2FZVA 2Y8BA 2QMYA 4NULA 4RAMA 3KAQA 3I15A 3B6IA 3KL7A 3TZBA 2NZEA 2KLBA 2V5UA 3OWHA 3RPCA 3S0ZA 4YALA 5EAIA 3KAPA 2Y87A 4U7GA 3HLYA 2GKLA 4U4LA 5HISA 5AHRA 5HH5A 4HEQA 4LTMA 2Z9BA 1KO2A 4DILA 2QINA 3IE0A 4OXXA 5K4KA 4O98A 4Z6XA 2FZ5A 5EW0A 4XWWA 2BTNA 5FQCA 2YNWA 4AD9A 5LVAA 5B1UA 2Q9UA 3DHAA 4S24A 4PU0A 2B3DA 3SD9A 2D5IA 4CETA 5B3RA 2BG7A 1SG0A 1FLVA 4D1TA 2FM6A 5FUQA 2BGAA 2W5UA 2ZWRA 1A7TA 1WSWA 3FJOA 2HNAA 2QEDA 5LS3A 2R2DA 3FX2A 3T3NA 1BU5A 4LAFA 4Z7RA 3NHSA 4D1VA 3BC2A 3KNSA 2Y8AA 2MTBA 1RLIA 2BG8A 4TYTA 1ZWLA 2BFZB 2I7XA 4Z5YA 5A87A 2GFJA 4UWOB 4EXYA 2AMJA 2YNUA 3ADRA 1J9GA 5FX2A 4GR9A 5NLLA 4PTZA 1ZNBA 1ZKPA 4QOFA 3QH8A 1K07A 3NHWA 1JJEA 2XF4A 3IOFA 5HH6A 5HIOA 2RG1A 2N1MA 3RPEA 1KBQA 3FCZA 1CZRA 2FHXB 1KO3A 3JSXA 3IE1A 4Y7CA 3GFQA 1BMCA 2E7YA 4R81A 3FNIA 4D02A 4V0HA 2A7MA 3K20A 3AF6A 1GG5A 4J5FA 4TZEA 4JO0A 2BG6A 4XDGA 2YZ3A 1FX1A 4YAFA 1KBOA 5BUCA 1QR2A 2BG2A 1XI2A 3SVLA 4TZ9A 3BV6A 1DXQA 3O73A 3X30A 1TIKA 2AZ4A 2FU9A 2DOOA 2NXAA 4C0WA 4B87A 4RM5A 2ZNBA 2ARKA 5FQAA 4KEPA 1HLKA 4UWPB 4C76A 2FU7A 2FX2A 1A8TA 4XDHA 5LCFA 5ACWA 2FU6A 1B1CA 3PY5A 3X2XA 1J9EA 1VMEA 3OJWA 4FGLA 2P4ZA 4ZO3A 3I0VA 3LCMA 4Z5ZA 3ZWFA 5B15A 3N3AC 3BK1A 4BZ3A 1XYVA 5TGZA 1XTOA 3OX1A 1YCGA 2NZFA 1AKQA 2YNVB 1I1OA 1J9ZA 4C14A 1AZLA 1QH3A 4YSBA 2FCRA 2I7VA 3L9XA 4ICIA 2CBNA 4FX2A 3NHRA 3VQZA 4EYBA 3N39C 2R96A 4N9QA 3EYWA 2OHIA 2QX9A 5EMNA 1BVYF 3GFSA 2QX4A 3S2YA 4NQ4A 3P0RA 2M5CA 4TZBA 2Q42A 3ESYA 2GSWA 4AWYB 3KNRA 1V4BA 4D1WA 4BP0A 1XYYA 1BVTA 3IOGA 2FU8A 4Z60A 4AX0B 4FGJA 1XM8A 3T3OA 4PTYA 4ZVMA 4NQ2A 1DD6A 4J8PA 3F6SA 1KR3A 2QX6A 4N65A 4Z67A 3F2VA 5ACVA 2Z98A 3X2ZA 3FW1A 1SMLA 3ZNBA 2YNVA 3ESHA 3L6NA 5AEBA 3QFRA 4QOEA 4LTDA 1YCHA 4H6PA 5ACTA 1FTGA 2WYMA 1OBOA 3B6KA 4BMOB 1FLAA 3IEKA 3AF5A 2V9CA 1AKRA 2YNTA 2AIOA 4U7FA 1YKGA 1QH5A 1AKVA 2MT9A 5LLDA 3DHBA 4HKYA 1AHNA 3NFRA 4QOJA 2M6RA 5FQBA 3OX2A 4QOGA 1AMOA 5K4MA 4YSLA 3SRXA 2FOXA 2DKFA 2QJSA 4C1HA 4C0XA 2GFKA 4FR7A 3SW3A 4HL2A 5AXOA 5ACSA 1WUPA 1FLDA 3FVWA 4GI5A 2BFKA 2XR1A 2FHXA 2FLVA 4FEKA 3NLLA 4QOHA 3NHUA 3FAIA 1SQSA 5EVBA 1E5DA 3IELA 2FVXA 1FLNA 3SPUA 2ZZIA 4KEQA 2Q0JA 3DH8A 2BR6A 1YRHA 5LCAA 1M2XA 3D7NA 5JROA 5IQKA 1RTTA 2BN4A 4ZVLA 1D4AA 4YAUA 4CHLA 3PG4A 3I11A 1VJNA 1AKUA 5F51A 4TYFA 3QFCA 6NULA 5KIKA 3UXHA 4D1UA 2FDXA 4Y9UA 3HR4A 5K4NA 1H69A 4H2DA 4NLLA 1T0IA 1D04A 5LJLA 2BG8B 2OHJA 5K0WA 3W79A 5A0TA 2BMVA 5EV6A 4NQ5A 4N82A 1X77A 3NHPA 4EYLA 3AJ3A 3R2UA 2NYPA 5HIPA 2ZKIA 5EV8A 4AX1B 4C1FA 4TZFA 2GCUA 3G5MA 4U7HA 2Z9CA 4FSBA 3NHJA 3P2UA 2OYSA 3KEGA 4DY4A 1NNI1 2BPOA 2BMIA 2V5VA 5HIQA 3F9OA 1DDKA 4WD6A 1TLLA 4UWSB 4LTNA 3WXCA 5EWAA 1ZTCA 3R6WA 2GMNA 2YNTB 1AKTA 1JT1A 5A5ZA 3A4YA 4XUKA 1FUEA 2P18A 3LVZA 1WW1A 2I7TA 5ACUA 1CZNA 4XWTA 3F6RA 3IDZA 5B3LA 4YSKA 1AG9A 1BC2A 4Y9RA 4NQ6A 3G1PA 2BFZA 2M5DA 5NULA 3IE2A 1JA1A 1RCFA 4LA4A 2A5LA 5EH9A 2QR2A 2VW8A 1QBGA 3OX3A 3ZR9A 1X8GA 2WRSA 3W77A 2H6AA 3NHLA 2QX8A 3NHKA 4PVOA 4ZVKA 4C09A 2QWXA 4C1DA 2BF4A 2YCBA
chains in the Genus database with same CATH superfamily
2ZETA 4KH0A 1V6CA 4KVGA 5ENDA 2IBMA 2QT0A 3D4OA 4HXYA 4LJYA 1ECFA 3GR6A 4YAOA 4DMLA 4YRLA 1CR2A 1JEOA 2YJTD 4C4YA 2W2MA 5K3FB 1JLLB 3U7FB 2OCDA 2NXNA 3R8XA 1W4RA 1FTSA 3ELYA 2HK6A 3N5CA 2UVDA 2IP1A 2P6PA 3GNTA 3FLMA 4C4RA 4PVDA 4ECAA 3AF3A 2IXTA 3OJLA 3RYFA 1VL2A 2AFHA 4EVRA 2GTIA 1N0IA 2BBOA 1D2RA 1QQTA 2PCLA 5CBPA 4MW2A 3KR1A 5JHGB 1E4VA 2JLRA 3DM5A 1W4BA 1IZZA 3DOOA 5IDXA 4DUGA 3K0CA 2DWPA 2NPOA 4RMHA 4UPDA 4X41A 5FWYB 3IX7A 3ICOA 3O75A 5JRDS 3CVVA 1LDEA 3T4UA 4RXMA 3I2IA 4JX9A 3PWSA 2P0YA 3ENWA 3BULA 1XL0A 1H2RS 1NJ5A 2EZTA 2XADA 3COVA 3HUDA 5DYGA 1FUUA 1LDYA 2RAFA 3GJZA 2JFZA 3PUZA 5LBUA 4MCHA 2QRVB 3HYLA 1KTVA 4XRRA 3BXHA 2AUMA 1ZUIA 2QZSA 4F46A 2BKUA 2GZ1A 3C6ZA 2D7DA 5AJHA 1U2DA 3R76A 3KT8A 3D4NA 2YZ7A 3QZUA 4LUCA 3GAZA 4P5EA 2XVMA 1AN9A 3EUFA 3ZGLA 4QUAA 2EGGA 5I7FA 1PUIA 3B6ZA 4DZRA 3RC8A 2YXPX 4MIEA 3WQHA 2ZTLA 2X0KA 1RI3A 3FTPA 3I9KA 3E6AA 3R3UA 4TUYB 1GUBA 1W4CA 4Y9SA 5AI4A 4RNDB 5KNBD 3UOGA 4JLJA 2BCEA 3Q3HA 3MWKA 1CRWG 3KK0A 2PD4A 2PMEA 2FE4A 4TZ6A 4KI7A 4YIHA 1DQNA 3JWPA 1E59A 2Q3JA 3Q85A 1UZNA 3O4VA 3A0UA 4I14A 5H1YA 2J9XB 1XVLA 1EM6A 1ZD9A 1E58A 2ET6A 2VEOA 2WFMA 1N0VC 1QFZA 1H4TA 4Y67A 3SE0A 1UWVA 2P4SA 2AXPA 1TUEA 3LHKA 4ZZ2A 2LDBA 3UXEA 2J0EA 1PJCA 2HKIA 1H93A 2XODA 3B51X 3A8TA 3CO5A 4IH9A 4LC1A 4AZ0B 2AI3A 3RASA 3VKVA 4FW8A 1KAMA 1PNTA 5AICA 4DY6A 1CW2B 3N7AA 4X7PA 2NSYA 5FO0A 4E1BA 1MQOA 5B58C 2YH2A 3D8NA 3LWBA 3FSJX 4NU5A 4X61A 5L3VA 4RL0A 3U3MA 1U7PA 2PX0A 2PZGA 3V4ZA 4M0CA 1ODSA 3BMOA 3HN7A 2NT3A 2GA8A 3N75A 1LRLA 2EARA 1YB6A 3DTTA 3EVTA 4Z9FA 3ESZA 2X13A 2VF7A 3TBFA 3T3EA 4FI3F 2I4IA 4YR9A 4FILA 5C8ZA 4Q5IA 2H4XA 1EX9A 4UNIA 1K6IA 4X6YA 3M6UA 5ED4A 2ZPUA 1C7EA 3DUWA 4F72A 5A4KA 1YVPA 3T9MA 3CNBA 2NPIA 4GE3A 5K3AA 1RRVA 1SCJA 1DQRA 5GV8A 4C05A 5CFNA 1ST2A 3TR0A 1QAQA 4F1KA 4XB6B 3IJ5A 3KYCA 4JQCA 1XA4A 4PS0A 4TS3A 5FADA 3SX2A 5K3SA 3C74A 1MC1A 1U3DA 5COAA 4X8OA 5JAOA 3O7WA 2NO5A 2IOYA 1ZXBA 4KN8A 3N3BC 3L9WA 4CJXA 4PAQA 1DAFA 2GK3A 1OB2A 3P9RA 3RIYA 4KCGA 3UWOA 2GEKA 3EVFA 3H6HA 1R4MB 2AEJA 1X7XB 1ADBA 1AS3A 5FYQA 1GSHA 2X5KO 3JQAA 3GX1A 4IIEA 5G0VA 5LA6B 2G9QA 3UHJA 4C1EA 2QTRA 3R0QA 2ZTMA 4HQKA 4UQLA 1Z4JA 1ZQ9A 4G8JA 4LMAA 1XCJA 4QODA 4RMNA 4TKZA 3SYKA 3KBOA 1NBHA 1J39A 2O2ZA 1GZ3A 4IPTA 3WJ7A 3B3GA 1MO3A 4HUQA 4BTVA 1NR7A 4KDCA 4PLWA 2RGNC 4U6NA 2W6ID 3PYLA 1J1UA 4FFMA 1QZTA 4I1VA 3U1TA 1WSBA 2PLNA 1QVRA 4JBWA 4NULA 3LL4A 1CU1A 5DCYA 1FXSA 1KVQA 1N2EA 1P2DA 1Z36A 2YJGA 4GXNA 4Z9AA 3KL7A 3I15A 1GQRA 3BGOS 3NDIA 3ADKA 5DYYA 1MB9A 3MS4A 3OLZA 2QN7A 3RU3A 2KLBA 2H1CA 4QWMA 2OAP1 1Q12A 1U0TA 2FETA 2V5UA 4XPZA 4WAUA 2CNWA 4CQNA 2AC4A 4LBZA 3THWA 1C4XA 3VVCA 4U4LA 4NY1A 1GTRA 1PVOA 5HH5A 1ORHA 1FDIA 4L9RA 4GPIB 3RG2A 3DDHA 3RI3A 1R9JA 1C1XB 2XT6A 4G0NA 3ZJ5A 5F98A 1GQ2A 3CO0S 4IF4A 3BRWD 5JE8A 5CLIA 2Q9UA 1R0RE 2YL2A 3PBKA 4HUQB 4BNNA 4DG8A 4ZJPA 1E8DA 1UK6A 3PUHA 3PXGA 4E3WA 5TVGA 1CJVC 1C41A 1XTQA 4LBVA 4O29A 1ONOA 2NQTA 4N01A 3EPHA 3VFDA 4H0FA 2PZJA 3ZUGA 3QVKA 4TLMB 3IH5A 2NP7A 1PDWA 1LDNA 1J1IA 4Y0AA 1PWYE 4FEYA 5JCOC 4LCEA 4ANFA 4DCCA 5MN4A 3DOJA 2XT9A 4W5OA 1W0KD 4EB3A 3K4PA 4Z7QB 4MNTA 1C7ZA 1DINA 3DYIA 3UFBA 5EKSA 2FHPA 2RONA 4DDKA 5GAJA 3HDGA 1FU8A 4EIWA 4MQ5A 1LZKA 3E9YA 4XVHA 5E6SB 1JDPA 1RLIA 1T5LA 2DBZA 3SVZA 3F71A 1C5KA 2PDAA 2WJ4A 1PNRA 1Y3DE 2EJWA 3D54D 4N6OA 3JD0A 3ZI0A 2D1FA 4RS4A 4WNYA 4BO7A 5FX2A 4HDNA 5K45A 1GZSA 1WZEA 1HNWB 1YR2A 4LISA 5ALYA 1J0CA 2OM2A 1OBCA 1S96A 4J0FA 4M9CA 5F76A 2QGZA 4NXMB 4J3FA 1HFWA 3A05A 1UDXA 3M6XA 1A9XB 1J20A 4GX2A 2NVUB 1JLHA 3EZNA 4QSMA 3IOFA 5BMVB 5HIOA 4OD0A 2G7ZA 4HQFA 3NHZA 2E18A 4F5YA 4YV1A 2OGZA 2RHLA 1IFXA 3QXJA 4U2GA 2LP4Y 4GIBA 3BMOB 1SXPA 3GFQA 1E1CB 1Z6GA 4MYHA 5HJ7A 1ABBA 1WMFA 2X5NA 1NX6A 1W5BA 3P19A 1YH3A 3CSDA 4GSLA 3AHJA 1T5OA 3CF6R 4EPWA 4UDXX 1X39A 3GP3A 1EAYA 1M76A 3ZK9A 1A2OA 2J9ZB 3LSTA 2JFVA 3QPVA 1XJCA 4BLPA 4N47A 4C06A 2BZGA 1J2UA 1E3WB 1Y5IA 2O0HA 3GT4A 1M1NB 3U0VA 1XCOA 4WOCA 3EQ6A 1U81A 3ONWA 3PV0A 4LSMA 4CM8A 2CNOA 4H4CA 2HRQA 3THYA 4PBRA 3WLEA 4EVQA 1GTJ1 3NTXA 4Q93A 1IAQA 2QDKA 3Q5GA 3R44A 1GAWA 1UL1X 3WZMA 4DGQA 4M6WB 1RYMA 3QP9A 4PLCA 4B0OA 1CP3A 2ZRQA 1GJRA 1NQXA 4AL4A 2DP4E 3OA0A 3L0PA 4JMLA 3ZCXA 5IJWA 1GCAA 3EHEA 4KDEA 1ABFA 2JFOA 5TX7A 1MZVA 3KKNA 3DOFA 2X19A 3NH6A 1GU0A 3OOYA 4YJHB 4BZ3A 1O6BA 3OQPA 4X44A 1K27A 2H00A 4IX1A 4GUDA 4RY2A 3WWOA 5C7OO 2QVBA 1JLKA 3ORFA 4GOMD 5AVZA 4NMMA 2YIMA 4OQYA 4Y9DA 5AKLA 3KETA 1W5TA 4O3MA 1QO7A 4UUBA 2VOJA 2OEPA 3AU8A 4FT4A 4Y6OA 4J0HA 2P6NA 3GQBA 3AV3A 2OQRA 3R2JA 2CBNA 2FPLA 4JK3A 3PF9A 3RVLA 3SQLA 3ZIDA 4UAVA 5IJ9A 3NM4A 5G41A 1M54A 4FDUA 1GPAA 1TYEB 4RTRA 3HO8A 4V0SA 2FMKA 4I46A 3UAWA 1HGXA 2H6EA 4R8KA 1CJCA 2HSZA 4YRFA 3W3AA 3NM5A 4W5WA 2I8LA 1CQPA 1HDGO 2CFOA 1ZNQO 2EAUA 3QJGA 4B47A 5ITZA 2Q42A 5L3QA 5D8DA 4D1WA 3OPNA 4MGEA 1T2FA 5T8KA 5I48A 4BP0A 3SQNA 1OBHA 2LVBA 1XNJA 2QW0X 4KXFB 2ZSKA 3K35A 4OOFA 3UQYS 1IOVA 4CN9A 2AOXA 2L17A 2FU8A 1MG0A 4JDUA 2FZWA 2ZSUA 4DAEA 1HSOA 1Q3KA 4PTYA 4Y3UA 4ZVMA 3QSGA 4ZN6A 2I8CA 2WTBA 1IUOA 1KEWA 1Y48E 1ESNA 4IHAA 2QX6A 4UTOA 4ER7A 5JSQA 3A9UA 4DLLA 4QXAA 2RI0A 1ZNXA 4RQUA 3DF7A 4C7JA 2WNHA 1A88A 1DAGA 2YHUA 2DTDA 1R0SA 3C8MA 3RYFB 3P2JA 3W90A 4EEXA 2OGWA 5HRUA 3ESHA 2LR0A 2G5CA 3FZQA 4AU1A 2C2KA 1V47A 3EY9A 1XHFA 2YJ3A 4LTDA 3VPCA 4DIFA 3EPRA 1UC4B 2JIRA 4EPRA 1QBKC 1TYBE 2JI8A 4K3VA 5F2NA 1XVVA 2QUHA 4FHCA 3GEEA 3M4YA 4I8DA 3FA2A 1GM5A 1XMQB 3C3AA 2G06A 1J2EA 3ILYA 3ZG6A 5KWEA 4LV5B 3A26A 2FN7A 1JSRA 2MT9A 2PJDA 3A10A 4OOEA 4QC2A 4BO8A 2HJSA 1CC1S 3B1FA 5BVGA 2AN9A 1CY8A 1Y8AA 2GJ9A 4CFSA 5EQDA 3NBUA 2WMYA 1K6MA 1LPAB 1YB2A 4KQKA 3LHIA 5KB3A 2DKFA 1V6AA 4DRYA 4UHHA 5AI9A 3UAZA 2W2TA 4B73A 3VPAA 1F1BA 4O2AA 3IBYA 5DXJA 2VHYA 3DCNA 3RW9A 4Q4LA 1MENA 2MSEB 1C7JA 3X2SA 1A76A 2GKOA 4GSYA 1B7GO 1C3EA 2FXIA 2R85A 3STVA 1IZ0A 2BEVA 2EP5A 4I6JA 1R2QA 1D3AA 4L6CA 2DRIA 4O4IF 3BA6A 4B43A 3WMFA 4INOA 2ZXUA 3R6LA 4RPHA 3VMMA 2OT3B 1SC1A 1D2NA 4URXR 2VNKA 5AM0A 1H8EA 1LNZA 3QKRB 5HF6A 2C54A 2GETA 3BF7A 1WVMA 5EE1A 2IY9A 4MROA 4RF5A 3ODGA 3UUEA 3GJ6A 5K0CA 1M2XA 5IKMA 2G6TA 2ZUVA 4D3FA 2GN9A 3PC6A 3GROA 4EOGA 3RRZA 1LBSA 4AKHA 3TZLA 4EJSC 1UKCA 5A3RA 1D4AA 3PGA1 3CKMA 3I01A 2FKNA 3HYNA 4LV6A 1P5RA 5T57A 1E2DA 3ZXUB 1XWWA 4ZHQA 4R8RA 1CQJB 5AVUA 2GXSA 4ARSA 3PL1A 3UMRA 3KWFA 3IQFA 4WNIA 3T5MA 1TF2A 1D2EA 1FQJA 2Z6UA 1TZBA 4MW4A 3BHJA 1Y1KE 3VAAA 4Q48A 3I6YA 3T12A 4L08A 1A97A 1OT3A 3JQAD 1XALA 5FOWA 4B80A 1YDWA 3R7SA 3W2HA 2ZAMA 4O1MA 2GS9A 5HJ5A 2PRYA 3RLFA 5KUTA 2R8RA 3FCOA 5A7HA 2UUPA 3BSFA 3ONVA 5I4BA 3U19A 1MHPA 4RFSB 2O7NA 1BHJA 4JB0A 2PZFA 1F4VA 5FI3A 4EA8A 4F06A 1R4AA 1P1IA 2H5IA 3LRTA 3PI6A 3HJFA 2VNJA 3QE0A 3R7LA 1EUYA 2QRZA 1E1DA 3BXZA 3T4EA 2GCUA 3OMLA 1XNRB 2XUGA 2GZSA 3GNLA 1JEQA 3ZJVA 2OZLB 4RK6A 1SXJE 2OBFA 1KYWA 1DEAA 4P4SB 4G1BA 4IF6A 5EPUA 2PT7A 4YQFA 3EXG2 2I6TA 3IEIA 3P0JA 2ZJ2A 4P4GA 3W6PA 3AJRA 2WQ7A 1DCKA 3Q7QA 1SUSA 1ZOIA 3OKCA 2PBFA 4KVAA 1R3UA 4D1YA 1KDTA 1QH8A 1PZGA 1Z4MA 3K6SA 4K6FA 1KOGA 5ITZB 5EIWA 2CDAA 2P2SA 2ID9A 1ZHOA 3HPRA 1JR2A 5EZSA 4UOQA 2AOUA 4CMIA 3GZ4A 1NIPA 3T9BA 3ZDZB 5K6AA 4AQ7A 1B1AA 2MYNA 4J03A 1VZ3A 4PAOA 3ZLJA 1TJ4A 2I7TA 3M9WA 2ZE5A 4ZT6A 1R0BA 4KH1A 1AHHA 4OYHA 1MA3A 1XU9A 4O4LA 5JMPA 4I6GA 3GQBB 3WDMA 2Q5OA 4Q4HA 1TJNA 1QRAA 1C7IA 1D2MA 4RM3A 1EHCA 1DEHA 2WV9A 3UJ7A 1AO3A 2QGNA 2NX2A 3ITNA 4UMVA 2AEMA 3QWFA 5FH9A 3L02A 2HEGA 1H2BA 1Z4PX 4RVHA 5DHPA 2B4RO 2X2EA 4WZAA 5AKKA 3W77A 2JLVA 1X3LA 1MAAA 1G2PA 2IE0A 2B8WA 2W2KA 4GYKA 3H9EO 3SKYA 5EZYF 5EYPA 2EZ9A 1SIWA 1FUKA 4UTRA 1Z07A 2NZWA 5L4NA 2IVFA 2AYZA 1MIHA 1XTPA 4NMWA 5JD6A 2FX5A 4A91A 1AV6A 2X8JB 2R68A 2I7CA 3GLKA 4R1MA 1L7OA 1AKMA 4GECA 4UFNA 2BELA 1NZJA 5CH8A 2QZPA 3HLTA 4YRIA 1E61A 3PKZA 1H1DA 1B2RA 4R1SA 4PZLA 1TU0A 5EA2A 4B35A 1Q16A 2OB1A 2Z3ZA 4IILA 3VC7A 1K66A 4D81A 4Q4CA 1P3Y1 4PICA 5BOVA 4JBLA 1YE3A 2J6IA 1BSVA 2P2GA 4OQFA 3H18A 1PW7A 4R7GA 1LY1A 1USVA 4FYYA 1JU9A 1FYFA 1QRDA 4U8GA 3HN2A 3ZLUA 2WC1A 1K7FB 3LDHA 2F9FA 3AR6A 3E7PA 4X8HA 4X6UA 3RH0A 3FCXA 4BBJA 5C7YA 1TLTA 1GCIA 1RIFA 3AUJB 3CBQA 2OWEA 1E2JA 4LK2A 2CUKA 3U7RA 5CB4F 4RA6B 1R37A 5AXRA 3D3NA 3PUVA 1A3CA 3BXOA 1DV2A 3KZXA 4NP6A 3UTDA 4C6RA 3T3MB 2P35A 4PNZA 1OTHA 1ENZA 4QYXA 1V3VA 3TRDA 4I9UA 1CCWA 1Z37A 4QQ8A 1K6XA 4IZ6A 3OE1A 4GCWA 2QP3A 4MA4A 4WDQA 4BASA 3I12A 2CFRA 2F43A 3K7EA 4DANA 4WD3A 3BIJA 3DQQA 1Z2DA 4JFAA 1G2QA 1I1QB 1XZLA 1JKIA 2BH9A 3DM9B 5GPBA 3DUFB 1E69A 5E0KB 2OHVA 4PFSA 2AC2A 2EX4A 3NDJA 4DR2B 2PMDA 3SYMA 3C1TA 4CMIB 4CQMD 1I2ZA 5REQB 2XSZD 3C3PA 3NONA 4EAAA 3SIRA 1E9EA 1H0KA 3HA2A 2BW0A 2H4JA 1SUIA 5HRCA 3HGTA 1XAGA 3ECSA 3TIIA 2JLXA 1WZCA 1CRPA 4L5JA 4WXRA 2AMYA 1GA4A 4RANA 1L8AA 2J5RA 3IDFA 3TQRA 2BR4A 2ZJ8A 1A8UA 1GR0A 2X9VA 4I1YA 5H3HA 3AG5A 5ADHA 3E82A 3FWPA 4NZ9A 2R0QC 1X9HA 3ELUA 4P35A 3VC2A 1T36B 2JCXA 4HVTA 1DZIA 4KO2S 1QTQA 4D1UA 2A9FA 5AH0A 3UATA 1DKOA 2G63A 3IPRA 3CH7A 3OZSA 3I14A 3ZQJA 4LYFA 4JOBA 1KRXA 3TLGB 1NJ8A 1ZN8A 2CJXA 4M1KA 2OORC 4EPVA 4WUVA 5DSZA 1NVGA 1E3IA 2O50A 4RFSA 2PQ6A 4N7RA 1BWRA 3A4MA 3ONFA 4FC7A 5ULLA 3GY0A 4PC3A 2D0PB 5FIUA 5FF9A 1QHEA 3R0VA 4X65B 1T4BA 1JG4A 3PHJA 4IIFA 3ROQA 4LDJA 3UHAA 3FSGD 3WK6A 4PN7A 1DADA 1QAOA 5JJLA 3AF0A 1PUXA 2XZPA 2C5SA 2R60A 3FPCA 5P8WA 3SG0A 5IZCC 1PT9A 3N1UA 4GLBA 4B33A 3WK7A 2EXXA 3ADOA 4M6WA 4HEA1 1C29B 4H16A 2JGRA 2VPZA 1T9BA 3IBCA 3DZGA 1ZJ4A 4HFMA 4PR0A 2ZJ0A 1N1MA 3A9SA 3L7YA 4RK5A 5H7XA 1OH7A 3K0CC 1QFSA 1PJZA 2E37A 3F47A 1S4MA 1O95C 4MGKR 4MJLA 4XQEA 2V7TA 3SZOA 1TA9A 3K8OE 5C80A 3UAOA 2C7GA 4MV7A 1OHHD 2HPVA 1KK2A 2VBIA 4OFXA 2OVBA 1PL7A 3TXAA 3A25A 4G0ZA 1GARA 1KZ7B 1CZUA 2WUVA 2BZ1A 2V8BA 1P8JA 3FFWA 1QFMA 2P7IA 3L82B 4G5SA 3Q3VA 5BR1A 3CF4A 1WPXA 2V58A 1RQRA 2Y77A 3QLVA 4IINA 3UHFA 3UYKA 1EU1A 3VO8A 3T9DA 3K32A 3VUFA 1ADCA 1J0AA 3ABOB 1NNSA 1UDWA 4L4ZA 4DCOA 3SMQA 2UZ4A 2FW8A 1MCZA 3LS2A 3M7IA 3PC7A 2EFDB 3N2YA 4TTJA 4NONA 5FPQA 4CIDA 1Y7PA 3NHBA 2QDSA 2IYAA 2WYUA 4BP8A 4IDOA 2JJYA 4UD2A 1KERA 1OH5A 3OOEA 3CCCA 1IHUA 2TECE 3ES9A 4R1QA 4QPNA 4TRJA 4CLOB 2OYRA 2GM3A 2O2HA 2NTYC 4P81A 4EG6A 1DHTA 2ZO4A 4ZO2A 1BROA 2JGNA 1XAIA 4GX1A 3ODPA 1W29A 4POOA 3AM1A 4AXHA 2MHCA 3QXCA 5IN4A 4QTXA 5IDYA 5B6IA 2Y76A 3PWTA 8OHMA 2EIHA 4AJPA 4GXQA 1QKKA 2FN4A 1KMCA 3EDRA 4OXNA 4ZYXA 3PTLA 1PTJC 3AM3A 3TXXA 3FPGA 1DQPA 3OURA 2XCSB 1XXLA 1RRGA 4NJMB 2J32A 2VHUA 3SC2B 2XRZA 3KB8A 3A2NA 5CM8B 3PDUA 3F6CA 1ARZA 3TI7A 4CIYA 3DZCA 4HN9A 5E3JA 1C2YA 4D7AA 3DBHB 4JASB 4Q1AA 4F5DA 3AONB 3CKYA 2UYCA 4NCAA 3P9CA 1DWOA 1E9CA 4MWCA 5FPKA 1UPBA 1DPFA 2B1RA 2FW9A 2HK9A 4WFIA 5CNJA 1NASA 4BGEA 4EZEA 2VTBA 4HEQA 2O7RA 2FUCA 4OX9B 4Z3OA 2JKVA 4X1KB 2KBFA 1ZA2A 3NBXX 1ZGCA 3WMEA 4KYIB 3HSSA 4HAZA 3IQWA 4RV5A 5K0SA 5FAXA 4HYEA 3L5KA 4D0LB 5DCLA 5JQGA 1BKDR 3DOIA 2VDWA 5KI6A 1OC2A 4YCDA 5E7JA 5D5PA 3DV0B 1V7CA 3VDXA 4LQCA 3JY6A 2CCGA 3O1IC 4RDIA 3SD9A 1L5ZA 1VI6A 3BB1A 1T1EA 3R5KA 1QUEA 2P2NA 1WV1A 1P5JA 3F9IA 4HAVA 4HFRA 4V39A 2CLFB 4YONB 4NOJA 3G1TA 1PK7A 3EFBA 2NUPA 4CMEC 521PA 2FG7C 1CUVA 2LNDA 1K5DA 2YN4A 3BMCA 3TOSA 3PHHA 4J1NA 5DSTA 4UHDA 4MUAA 5GIPE 2WA1A 5JR3A 2V96A 5E38A 2QAGA 5GONA 3KPVA 2CDRA 3HBAA 3SZRA 3X1WA 5DBEX 4WRRA 1VL8A 3HUEA 1UINA 2W6JD 2Q5CA 2NQ2C 5FHQA 2FQWA 4TSKA 4C21A 3ZNOA 3NNNA 5E1MA 3VR6H 1DBIA 3USES 2MTBA 4TWIA 2OCPA 2JGAA 1KY3A 5DHAA 1SUBA 4V24A 4C2TA 4E08A 1X9IA 3GT7A 4IO1A 4N7BA 4US0R 1XP5A 3PEWA 4ZT3A 2HTEA 3LYLA 4K03A 3D8SA 4FYJA 4Y1RB 4ZMSA 1YRWA 4C7OB 1TK3A 3FHLA 4C3OB 5J5AA 1ZK2A 3N53A 2ZUBA 3BCHA 3REQA 4QOFA 2OYCA 3ENVA 4KPEC 3V32A 3AIMA 3LKDA 1PR9A 1N8SA 2ID4A 2GJAA 3OJOA 3V8EA 4YJFA 3ZE6A 2IYRA 4MWEA 1X42A 1KBQA 3FCZA 3GH1A 2B7LA 4M38A 1OR8A 1P9LA 4H7KA 1L4GA 3B60A 4F2PA 1EGAA 4ZHSA 2FWRA 2O52A 1XZPA 3H1BA 3HDJA 5CCBA 4RKWA 5T3UA 4F4FA 4WCDA 2HK8A 5T64A 1IUPA 1L5SA 3K05A 1Q0RA 5JSZB 3A04A 3AERB 3B89A 3GLVA 2QENA 3RBVA 2X8AA 1TW3A 4YCSA 2G83A 3NUZA 3WWDA 4X3OA 4M7WA 4V2UA 3KQTA 3QEJA 4X90A 4PIMA 4ZJZA 2P6UA 3BRSA 3GUUA 1ZK0A 2ESRA 3KOWA 4DDMA 4DREA 4YO7A 1KI6B 2VYND 1FNSA 1Z33A 2ZKLA 3BWCA 4JX8A 3BWBA 2PXCA 3DDUA 3EUEA 1FW8A 1Z0JA 4PM4A 3RC3A 1QGAA 1DJPA 4R7ZA 1CWUA 4XIJA 1DOAA 3T15A 3G2KA 3KB6A 5A5VA 1ILEA 3V3KA 2VQFB 4EZBA 3UJ8A 4NVRA 1H8ED 5D5QA 1SAYA 1U6JA 2GPNA 4OFZA 1A8IA 3GP5A 5J2UA 1GFZA 3B1JA 3UC9A 4WZAE 2IDMA 2P4ZA 5JCPA 2NVUA 4DA4A 4Z5ZA 3ZJTA 4XM0A 3RUIA 2ZAGA 2IPLA 2V97A 3A3YA 3QEMA 3GV0A 4WGGA 1P0IA 1XTIA 2XCLA 5AXCA 5HFJA 5I51A 4R6WA 3F46A 1JT2A 3RCBA 4KYUA 1MH9A 3TZEA 1BHSA 1WNTA 1PT6A 2C0QA 2I3DA 3GNSA 4LC9A 4BVKA 4F96A 1WVIA 2EKBA 5EHXA 2AS0A 1M1UA 3R7AA 2G4LA 4C4SA 1Z2PX 1G6Q1 2I62A 2WF6A 2JZCA 1IIBA 2ZIGA 1NATA 3NBZC 1IXRC 2QLJA 3F8SA 3NP9A 5I9SA 4BTEA 4N5IX 1IZ9A 4I1RA 1WY7A 4UJ3A 4HWOA 5AJVB 3L46A 2FZCA 4EKGA 3FNRA 4WVFA 4YRNA 1X70A 2JVKA 1ECGA 5JAPA 2LZ0A 5FUWA 4IDGA 1NUUA 2DFNA 4KWIA 4Y2TA 5IM5A 5FULA 4P36A 2PGJA 1AA9A 4P1ZA 4UPVA 3UWSA 1KP3A 2PH3A 3IT1A 1CS0B 3JQ6A 1E79A 4D25A 3VNBA 2Q2WA 3DGEC 2D3TA 2H2DA 2XNHA 1OIWA 4FE7A 4MA0A 3PD1A 4RF3A 4TLBA 1B0ZA 3WB1A 2AC7A 2Z1NA 3ZR4B 1N9KA 3REQB 3CLSD 4L57A 4NQ2A 1RHJA 1WBJB 3AKDA 1T29A 4Q18A 2QLNA 1L5VA 4RELA 1XEXA 4FDLA 1K2WA 1AXEA 3RGWS 5AJZA 2ZJZA 1HURA 1K06A 3KD2A 3R77A 3EBOA 4D9MA 5HZKA 1W19A 4K7JA 1E3EA 4CU2A 5BN4B 4E51A 3W1EA 5ECWA 1H2FA 1LPSA 2BMAA 3EQ8A 4OHOA 2BKVA 1UJCA 5DM4A 2FTKE 4W1SA 2BWJA 4GLLA 4DMUB 4V03A 1FTGA 3K9HA 5JI2E 4XX1A 1DLIA 3I05A 1QB7A 3OTIA 5KYVA 1YASA 821PA 3AF5A 1HT3A 2KWIA 1KSHA 2V9CA 4NYIQ 4DJDC 4M46A 4NH4A 4NH0A 3LZ6A 2BHSA 3OT4A 4NFHA 5JAQA 2IYUA 4RM5A 1M0SA 1T0JB 3EVEA 5JALA 4HGZA 2M6RA 2P9EA 5CA1A 4IDDA 5JCJA 4TZKA 3BJEA 3K09A 1JNXX 3QXXA 4Y2VA 4ARUA 1ZD3A 4V0LA 3D4LA 3OUTA 4KFUA 2VA8A 4HX5A 3TJZA 1N2HA 2WR8A 5TS2A 3CFYA 3QVXA 3QYPA 4H7FA 3KZ1E 3QW4B 2ZRNA 5YASA 3HP1A 3F7MA 5KTRA 3L7LA 1U1CA 4NATA 3DPUA 1EG2A 4S0XA 1S5PA 1D7AA 3OOWA 3FVTA 3JWGA 3QIAA 5FDFA 1JW9B 3AUUA 3NHUA 1B76A 1E1RD 2K4MA 4D8VA 1ZU4A 2X23A 1CVIA 2F3RA 3EXFB 4EARA 2UV8A 5C53B 2C7RA 4FD2A 1HA3A 4MI6A 3SPUA 4O02B 1IY8A 2ZAYA 4FCTA 1CYEA 4O5OA 3FB1A 2I9PA 3SEQA 5F23A 1QWSA 1WDWB 5A4FS 3I5UA 2LE0A 2RGXA 1SUDA 5E9WA 3ZGVA 1ZNWA 3O83A 2IA5A 3DVRX 1FMJA 3DZKA 3I1YA 1AQNA 1XTTA 3V8VA 2YRWA 2ZCUA 1G8JA 3V2GA 5J58A 1FFYA 3DFZA 1TM7E 3AR4A 5C31A 4P22A 2PUCA 2V9PA 1CIJA 3E7WA 4H35A 4KQ1A 5DCUA 1JKJB 5TQJA 3D59A 2NZXA 4YCJA 3RFVA 1Z29A 5FFMA 1UJ2A 1KR2A 1GKLA 2H9IA 3VR4A 1TQ4A 2WVHA 5CA0A 5DISB 1H69A 4NU6A 1G16A 3GEHA 4H2DA 4Z4FA 4LW8A 2OHJA 3QU2A 3HUFA 5H3LA 3UPUA 4YDQA 1C9EA 1PVVA 4N82A 2AJLI 2WT4A 2JHCA 2ZIXA 4W8GA 5HZHA 1ZH2A 2YWDA 3AL3A 2H2AA 3EQ2A 1MT3A 2Q0SA 4BLQA 4JGIA 2ZKIA 3U39A 4N8SA 4QX6A 4R31A 4RHUA 2OK7A 5D3MB 3TLEA 1IY1A 1P6XA 3JYOA 5ALIA 5EMMA 3WJ1A 3FNBA 4DA9A 1XJWA 4X84A 1XZHA 3BFJA 4FHFA 3S5JA 4AJOA 4HEA6 4LVNA 3SHVA 5A1JA 4P53A 5A3SA 2B9EA 2B1JA 5A5DA 5C1OA 2AF4C 2GEUA 3NEJA 1G9TA 2HJGA 3AR5A 3NT2A 4K9RA 4LOLA 4LZAA 4NYIR 4OMUA 3O31A 2VNHA 3PNPA 2XOXA 1E9BA 4IZHA 4J0JA 2V9ZA 2W6PA 3PUWA 1NJGA 1R8QA 1VCMA 1Y9EA 3OZWA 4LTNA 3V9PA 1YI8A 1U3UA 2QRLA 5DIZA 1ZW1A 1U11A 3VU1A 2I2DA 3C70A 1G5IA 1DNPA 3IODA 3T5CA 1G291 4HUJA 4R3UC 1P2UA 3OCUA 3T7JA 4PN3A 4XUKA 4AURA 3HFRA 2HA4A 4HB3A 3KS9A 4IJKA 2FLKA 4ESOA 2PYIA 1KI2A 1DZ3A 3GCWA 5AW2A 2YZMA 4DA8A 4JI6B 4JLSA 2BDTA 4IH4A 3WX0A 1AG9A 5DMXA 3MMNA 5LUAA 3VPEA 1X7YA 1IB0A 2HC9A 3WGHA 2W7TA 1YONA 1RAGA 1ZGZA 2PUAA 2H11A 4JXXA 4WNCA 5TSDA 5CCXA 3CLUD 2QR2A 2AE2A 1UBTS 4JQYA 3VYSB 5FUBA 1QHHA 3KTAB 3WDKA 4N48A 1JILA 2A0XA 5GOTA 5FORA 2F3TA 5LBIA 4IJQA 1DAKA 2IV7A 1Y5RA 5IYZB 2DXIA 1RQGA 1UODA 5LPNA 3HCBA 2OAEA 3I9JA 1VJCA 3M4ZA 4B44A 3JYPA 1RU3A 5CD9A 5HZMA 4LZJA 2NGRA 3IKVA 2O06A 3DFUA 5C18A 3SEZA 1KFKB 2V7BA 4QLOA 3HYRA 3UICA 1M6YA 1VPVA 4AIRA 4N0PA 4U4AA 3R4CA 5JI3E 4UU1A 4H7HA 5DX1A 3R3JA 1SVMA 1P72A 3GAMA 3KVVA 4QFBA 5MF6A 1Z39A 3B2QA 3HADA 3LBAA 1GSAA 4CTKA 1B0PA 4IHJF 3TCXB 5REQA 5F12A 3A9TA 2KJQA 4OM7A 8LDHA 3MWYW 1WCYA 2X1VA 1IY9A 3TOZA 1FDOA 2XDWA 3V8QA 2J9RA 1V16B 4J2TA 4A6EA 4PFJA 1SR8A 2PH7A 2J3HA 5IVDA 1I4WA 2WKSA 1RRPA 2M1XA 1UT6A 3C45A 1UXKA 5HCNA 4A1OA 2JGFA 1NW8A 3ZCUA 4BL5A 4BMVA 4UNRA 4K3UA 3GDWA 2DPGA 2QRHA 3BORA 4AKTA 4DVJA 2QY9A 5I9MA 3EWSA 3EIQA 4DMMA 2R5NA 3CLSC 1E8MA 5E6UA 4EKNB 2KS6A 3OCXA 2VT3A 4QRDA 3V4OA 2MMGA 4R16A 4EUFA 1BH6A 3TRJA 3AM5A 5FOSA 3DW1X 1VIYA 2A5DA 3JATA 1WD5A 3KLBA 5C5EA 5HHTA 2D5LA 3NDRA 2BCJQ 3DNPA 1L7AA 1LX6A 4OGLA 5KWIA 5GJCA 5ALZA 3RLIA 4DV4B 4XIIA 3AK4A 2VK1A 1NE2A 4TSFD 2C8LA 2B4KA 1QCYA 4JC0A 3NWOA 4QPZA 4RY8A 3S1AA 4LDRA 3SC6A 4EKEA 2D74A 3BKWA 1CSEE 3RU9A 3RKJA 1KFEB 2BTQB 2EW2A 2QRJA 2X14A 5ALSA 3HV2A 5JZ9A 2CLSA 4MKZA 5KQMA 1PT7A 4I5FA 3HUTA 4D4JA 1H6BA 4I4NA 5IJXA 1Z45A 3CZ5A 1N3BA 1JEDA 3ZDYB 2YS6A 10MHA 2Z2YA 5FCDA 4X71A 5CA0B 2IZ0A 5HBRA 1J97A 3UIEA 1BQEA 4PG5A 4WKBA 3FOFC 4D43A 2BBWA 2I4LA 4YHBA 4AUNA 3OPMA 1V8FA 1WMEA 7YASA 3AYZB 4YUZA 4NAUA 1E6MA 5LP6A 1GADO 1ADJA 2R6ZA 3FY4A 1GTMA 3QVGB 3ZY3A 4KR3A 3B9QA 1J90A 3CEPB 3ZHBA 5FI5A 1XKTA 4H1WA 1O6GA 2PRZA 2QBYB 5IJ0B 3DZDA 5U4XA 2ATEA 3SF8B 2BEKA 4TZEA 1P3DA 5CDFA 3MLBA 1PKEA 3B1VA 4CU5A 1VIVA 1PTJA 1ZRNA 2QG4A 2FSGA 1VLVA 3LBFA 1GKKA 1AMNA 3NTLA 1VP9A 1YZGA 2I2BA 2X0DA 3BICA 3LYUA 4G0MA 1RHUA 5BXQC 3NYRA 4NR0A 1TA4A 1GQQA 4QEDA 5G1OA 4WADA 1AT1A 5D5HA 3S7TA 3MCVA 1CV2A 5EWMA 5J9FA 5T6MA 3WBBA 2FJPA 3NGXA 3R7WA 3ZWQA 3LMKA 4CKCA 3I2KA 2H8GA 4PYOA 2Z58A 3QNMA 8ABPA 4LCBA 4RK0A 2VH1A 4E5VA 2PFGA 1PGPA 2K2QB 1YZUA 2YCLA 3AO0B 1UMCB 3MRVA 4RGQA 3W4KA 4KE7A 1NKSA 3HJTA 4F3CA 3ADDA 2BC2A 1I36A 3JWEA 4HNQA 3KYIB 4RZSA 3OQMA 3LC2O 3KJQA 1Z56C 2WSMA 4J91A 1SURA 1ENOA 3RSGA 1HT1E 1WMAA 2XQFA 1QGOA 3UK2A 1JBKA 4YMVA 3HJRA 3WYBA 3VKUA 2WSIA 5BQ3A 1E89A 1NP3A 5HS4A 2HDWA 3JS5A 4KQJA 4QUIA 5DKFA 2MSKA 4UM5A 1CIVA 3AGPA 2NXEA 4JQSA 1L1FA 3GVXA 4WZZA 5BUQA 2TMYA 2HJHA 2OOSA 2DKNA 3WJAA 3C6MA 4Z54A 1FF9A 1NQOA 1QF9A 2LD4A 3H05A 5EQTA 1O97D 2H0QA 3BIWA 4W7IA 3ROTA 3HXKA 2O3JA 4H3HB 3NIGB 5MHTA 121PA 1BGVA 3DEIA 4DMKA 3C8HA 3PE6A 3OO1A 1GG8A 1Y89A 5ACWA 2FZVA 4FHEA 3C8ZA 4BV8A 2P65A 3S40A 1ZI9A 3MSCA 1GGMA 4FIDA 4HXFB 3ZHCA 1ESEA 1S3FA 1SVLA 1ZY2A 3MC1A 3X0DA 5AVRA 4TYWA 4F3NA 3DBOB 1M2WA 3IFSA 4PG4A 4W63A 3FSGA 3TZBA 1JIXA 1PNVA 3UVEA 5JQGF 1RJFA 3T5PA 3UK0A 5FJJA 1JPJA 3S0ZA 4ZZ0A 3EZ6A 3HZZA 4BKOA 4U7GA 4RTSA 3M5WA 3PC2A 3GLHE 5IULC 2VSYA 3H5RA 3IJPA 3T1VA 4DNXA 3U7EB 2GFHA 1KO2A 1JG7A 1ZG3A 3OD1A 4ID9A 3VHXA 4PGHA 3O92A 4FYMA 4O98A 5HDQA 5KNDD 4QUJA 2O7QA 2HSJA 5M04A 4OXIA 2PX4A 3PX2A 4B3RB 5E3IA 1U5BB 2Q46A 5A7FA 2FSVA 1HT2E 1M1NA 1ZD4A 4YJGB 2WRZA 4Z2YA 2B1QA 5FOTA 2GLTA 2TMKA 1CVLA 1ZOPA 3WKCA 2I03A 4Q3EA 2CB9A 1WX1A 3LFTA 4D96A 2OQVA 4UBJA 4NMXB 1ZUWA 2QQ5A 5KTMA 2IKSA 2W5UA 3V8RA 3JQ9A 3LQYA 4REOA 3WA7A 3ILVA 2YNMD 3WYAA 5KEIA 2PCJA 3G89A 3LF1A 3L7JA 4HD8A 3BGSA 2OD7A 5C9ZA 4H59A 3S8YA 6GPBA 2PSEA 3WAJA 5GJVC 4FOLA 4CL8A 1M0WA 2W4QA 5KWJA 2Q8QA 2EBHX 3ESCA 1W46A 4HB4A 4I7EA 5T41A 1JVSA 1OXVA 1IQ0A 1BJKA 1J49A 4PLFA 3EXHC 5D3ZA 4RDXA 4LKRA 3O8BA 4TYTA 3KIPA 1CUGA 4IXWA 1XBTA 4M4SA 2IXBA 4ENWA 3PLAE 4WT7A 3A1TA 1AGRA 1L5FA 1O97C 1PEKE 4X7RA 4X66B 3U56A 3IDSA 5H9WA 1VJRA 3BKXA 2XWQA 3SX4A 4TM7A 3H0EA 3MAAC 5CGQB 3ZWCA 2R7AA 4EHKA 3CJTA 2GGSA 1M7GA 3KSZO 1SJ9A 2NO7A 4M0UA 2ZPAA 2J4FA 4PTZA 3WLKX 5FAKA 5MGBA 1MW8X 2WHRA 4NCJA 2F4NA 1J99A 2PGXA 4PTLA 2QI9F 3VJRA 2JJ2D 3JQ8B 3NHWA 3OSUA 4NV0A 1PFWA 4UCQA 4EQ6B 3WY9A 2YZ2A 1E6CA 3JQCA 1BDBA 4WJKB 2FHXB 1TPYA 3GDGA 4MYCA 2L2QA 4P7BA 4QREA 3KEMA 5EOVA 1F2TB 2Z0MA 3M6IA 2R8YA 1CFJA 1BRTA 3PCXA 4Y7CA 5EIFA 2O8DB 3ROGA 1R15A 1YJQA 3MIZA 2NNLD 4H0NA 2A7XA 1M74A 3IUMA 1LS1A 2WAYA 4MX8A 4B5LA 4UREA 4WA8A 5FNVA 1PHPA 3SHOA 3P27A 2PUWA 5E95A 4PHFA 1XLTA 1M8PA 3IMGA 4DIMA 4OHYA 1SCKA 1W5FA 4GOKA 4MQ4A 1DQZA 2JIBA 3ANLA 3N2ZB 1R8JA 1F8FA 3I42A 4TMZA 3PD0A 1O95D 2Q2QA 4S1TA 1FP6A 4PC6A 2OP1A 4P31A 3DLBA 1QR6A 3I52A 4IRMA 4OHVA 4BFXA 2CL6X 2WI8A 4FMCF 5JXJA 1KZ1A 1Y80A 2UUOA 1KJNA 3K96A 1KOJA 1Z0UA 1Z5WA 2OM6A 2PL1A 1UDRA 4GBED 4HC4A 4CV1A 4IXDA 2ZUFA 2ZNBA 4BLUA 1DBSA 4JLOA 4ZCMA 2PMCA 5TRTA 4UWPB 4KQ6A 4IQ4A 4LFCB 4LZOA 1NPDA 4JITA 1LTKA 5TMBA 1JMYA 1SCNE 1QIJA 4MS3B 4EEZA 1OXUA 5I9LA 2IUTA 1IEQA 3ZHQA 4NURA 2DHEA 1RP1A 3TIGA 1TW2A 3QLUA 2PT5A 2XMDA 3OZDA 3K09C 4HYYA 3BK1A 3LTNC 1ORDA 3CYFA 4CG1A 3KUCA 4LY0A 4OAQA 4YCBA 3RIXA 1RPZA 2IYYA 3GLTA 1Q17A 4IOMA 4E2FA 3ROFA 1ATZA 4CM4A 1CDZA 4FOSA 3KB1A 2GM5A 1ZM9A 2JK1A 3LIPA 1X1SA 2JCVA 4UUNA 4KJZA 3JQEA 5G1NA 3HH8A 5K09A 4G8DA 1ZLXA 4PZPA 1R6TA 1FQKA 5FEUA 2C3YA 1FTWA 3E81A 1VLQA 1GDDA 3EYWA 2QRVA 1XTJA 4Q7JB 1BVYF 3ORYA 4HVCA 9LDBA 3MTJA 3HXQA 1W0KA 3LOQA 4Q3OA 3RSCA 4KBFA 5AD1A 1V43A 2C5LA 2VAPA 3IBGA 2ZVDA 2ZS8A 3GRCA 5IHPA 3K30A 4WOBA 2Q4EA 3RS5A 4GVXA 4Q03A 2VT6A 3FF1A 1M1YE 4YMUA 2JARA 2VHVA 3E9EA 4I1IA 2DJIA 3C24A 3WKEA 2RFLA 3CVWA 1M34E 2J67A 1IY0A 3LUBA 1IOLA 4IFIA 3NPMA 4DC0A 2BEWA 4KODA 2JD1A 4R1OA 1G63A 3Q3GE 4FJ2A 1Q92A 2YYSA 5CDHA 1S2MA 3WIBA 4FGJA 1OFIA 3DL2A 1O57A 3JPYA 4B2PA 4OH1A 1K9SA 4OYLA 1RHMA 3VDMA 4B7XA 1I3CA 1YR8A 2EYQA 3EB9A 3VYUB 4DM3A 1AH2A 1FTQA 2OBBA 3MCWA 1TM3E 1PG0A 3GDHA 2OSVA 3U40A 2PMWB 4PRLA 2BISA 1P75A 1G1MA 2E55A 2Z98A 1QCZA 2R1VA 4Q1EA 5AM3A 2WVJA 5AUQA 1VSVA 4DEYA 3QKIA 4MUGA 5C2JB 1TZJA 1VYVA 2QSUA 3PQ6A 3STUA 2GHQA 3SXPA 2E85A 1KS9A 3BHNA 4RHFA 1ISRA 3C7CB 8GPBA 3PXBA 4J16A 3B6KA 3CLKA 4UUPA 2AHRA 2ZYGA 4DQXA 3NCTA 4OHKA 1QC5A 4PLZA 1FJ2A 1GFIA 3VO2A 2WWVD 4MTCA 1AKVA 1V8ZA 3C3KA 3I01M 3CISA 4P82A 1K5GA 1HFJA 1NN0A 1EK2A 1VI5A 1AHNA 1RWXA 1T4GA 1DEOA 2RC6A 2G28A 2X86A 5CT4A 5A04A 4KI0A 5KX5B 1AMOA 3MTBA 2ZBEA 2XTAA 2AFIE 1NQVA 1F2UB 3NNSA 2JZOA 1WE2A 4G01B 5CFMA 2UUAB 1SC6A 2HT1A 5T5QA 2VXBA 1J56A 1JJFA 3ASUA 1AKNA 3DZBA 4IV5A 4ES6A 2FSPA 4ZCRA 2G0TA 4ODIA 4CM4B 2NYRA 4RLHA 5HF8A 1RM4A 3GCZA 3BSYA 2Y9PB 3K0AB 3OE4A 4LVCA 1DC7A 4PC7A 5DV9A 2PLWA 3SGLA 1Z4LA 3GOQA 3O21A 4E5DA 1CK4A 1F0PA 3HY6A 2HGSA 1WXXA 4JC4A 2D2VA 2R7LA 4PGAA 2X6QA 4KXNA 1IWPB 2WY2D 3IXLA 3CM0A 4L8FA 1MQ9A 1OZ0A 3DMGA 4NZYA 3UJCA 1GT91 4XYMA 5F73A 4UHKA 4MAAA 3TK1A 2DR3A 3RHZA 4L3VA 2IZ5A 1XTSA 2G88A 5JS8A 4NPHA 2IJGX 1Q7BA 4H4DA 4ESVA 4QXOA 4MA5A 4O8ZA 4DBLC 4A5SA 4H77A 1XYGA 2BN4A 2FPKA 2YINC 4JBGA 4RQTA 4AXXA 2UYOA 2GBIA 2WWTA 1I0IA 1CX9B 2XWSA 4E31A 4P34A 3UJHA 3BJRA 1NVTA 3QLEA 4Z0HO 3H1GA 3UJPA 4GMFA 4CL0A 2QV7A 3AETB 2PD3A 4CGZA 4XB2A 2OP0A 3D6FA 1J33A 1NSYA 2AD5A 2V8OA 2YIJA 3HR4A 4RMGA 1GRNA 1L7QA 4XVRA 3GGPA 4E14A 2FDRA 3RVBA 1MOQA 4G0VA 1WMBA 3H1TA 1DT5A 3F5SA 4I4LA 3SHFA 1PS0A 5D85A 3UG7A 1O4VA 2AVDA 3W79A 5A0TA 1SIOA 1Z35A 4C0HA 2OZPA 3EE6A 2GNOA 3K0FB 1KI7A 4LN1A 3T3DA 3PTAA 1XPUA 2VP0A 1PJRA 3WA6A 1YDEA 3KKLA 1MMFB 4DIBA 2A0YA 2SBTA 3RS9A 4CEIB 1E63A 1O94D 2Q6VA 4TTVA 3BWMA 2LGJA 4AX1B 4OM8A 5F21A 3Q5DA 5K6RA 5BSTA 2XKKA 5ALFA 4CG0A 1ORWA 3G5MA 1FJGB 5A5GA 2YIDA 2B9VA 1N6OA 3SBDA 3WE7A 1W2WB 3R3XA 4U7WA 5K8VA 4LJ9A 1V2HE 4X6LA 3TW8A 1MA0A 5C4IA 1L4KA 5I47A 4M0KA 3OOJA 4YREA 4QXMA 5CDTA 2XUHA 3BWEA 3WB9A 3N8KA 4DLXA 1AXRA 1CNFA 1O89A 1SU4A 2Y27A 1U5BA 3WRWA 1IN7A 4O2RA 2P4QA 4DPMA 1ZTCA 4DUZB 4KNWA 2YFKA 3R0IA 4FR0A 3M2PA 3EZGA 4M9QA 3KT3A 1YVEI 4YRJA 1XAHA 2Y1GA 3ZS8A 2FPMA 1YBVA 2C59A 1YC5A 3A4YA 1WUHS 3BQ9A 1RXUA 1TDJA 1U2GC 3LXXA 2IQIA 3RUCA 1X94A 4R69A 4UCXA 1OZFA 3EA0A 5DYIA 3OBBA 4MMZB 3ZLTA 4A73A 1AXGA 5LIPA 4ZT4A 4UAUA 5LMUB 3S70A 4PLTA 1YFJA 3WGUA 4NV3A 1QIHA 3MFYA 3I92A 1JHUA 4QBHA 5SZIA 3TH5A 4JP5A 3TSAA 4F85A 1PS9A 1MW9X 2IIPA 2HV8A 1GCUA 4LA4A 3STHA 3ZE7A 4DGSA 1W0CA 3OX3A 4EX6A 2OK8A 3CX4A 4NECA 1QGED 4DCMA 2HADA 2YV4A 4EYQA 1RVV1 2N47A 4F45A 3HVJA 3EZ2A 3H4IA 4F6RB 1BS9A 1NF8A 2O7SA 1UWCA 4BY9E 3EZ9A 1KEUA 2ZUSA 4KPUB 5JY1A 4PVOA 2IXEA 1BTOA 2HHLA 3CZQA 4HFJA 5IUJC 4Q9LA 5JWRA 5DVZA 2I4NA 1I7QB 3RT1A 4EHDA 1NQWA 4TV9F 1YL5A 4WEQA 4EPYA 2D13A 3NJRA 1EHYA 3S2GA 1UIRA 5FQNA 2D4AA 4QRHA 4HAXA 2PX3A 3QWBA 3W5SA 2ZSFA 1K5HA 4XYEA 4DMGA 2Q27A 5DNYB 2XZTA 3IQZA 3OIYA 1D4ZA 4WIAA 3W0LB 1APBA 2FMUA 2X41A 1NN3A 5BR7A 2HBYA 1B3BA 1WEKA 2J07A 3FUCA 1E7MA 1W36C 3Q9UA 3UGTA 1EFRA 3CN9A 1N5DA 3PKJA 4LF5B 1Z7EA 4TL8A 2VNSA 3AZPA 3JXEA 2B2XA 1K7EB 3SR4A 5JDCA 1BOFA 2YTZA 1IHYA 4MITA 1P74A 4QUDA 1TUIA 1JG2A 1NBME 1ZOSA 1VL1A 1WZ2A 2CV1A 3O2NA 3CE6A 1EFKA 2OBNA 4Q1CA 4B82A 1YD7A 3IHTA 2H92A 2X4LA 1J0EA 1L7NA 4L0DA 2CC2A 1Z4NA 3KE8A 2SKCA 3OZXA 3TKYA 2JLQA 1KFBB 2WWIA 3AEUB 2WUGA 3QITA 2H31A 4B32A 3GVCA 3G8YA 1E6WA 2QUBA 2Y1CA 3LT4A 5AYVA 5SY6A 4N54A 1JLLA 3FFAA 4YQZA 1W4LA 3DEJA 3H2SA 2EL7A 2AG8A 4TL6A 1HR0B 4YJ2B 5KTYA 4G86A 3NHYA 2AJ8A 4RVUA 3ASYA 1XTBA 2D3WA 1P39A 2IY8A 2RHWA 3C5HA 1NUAA 2N46A 1TZCA 2O2SA 3WLLA 5EJAA 1VCHA 4X20B 1T13A 3U81A 3RUHA 3KZKA 4CRWB 3R7WB 3EXHA 2CLEB 3ESRA 3BRCA 4RAOA 5EP3A 2VL7A 4RXUA 3A37A 2PVSA 1WB5A 1CZKA 4RIEA 4BFYA 4C0QC 3ZX4A 5CG2A 4HWPA 4DS3A 5G0TA 5CEJA 4NYJQ 4OI2A 3HFSA 4RH1A 1A4IA 3QMPA 3TEFA 2AG5A 3T06B 2AOVA 5BRAA 4I1PA 1V1MB 4J16C 1CE8A 2UZIR 3H9JA 4N3CA 3UQZA 4Q1DA 3NR2A 4RBSA 4YRCA 1PJ8A 3BGDA 2O8BA 1E92A 3LT2A 2WB4A 1OH8A 4B4KA 3DC2A 2Q6OA 1IUNA 2DFPA 4EBFA 5K4GA 3TINA 5LP6B 3H5LA 1KR5A 2IHBA 5D51S 4ZDKA 5L8VA 1HG0A 1L7MA 1RYZA 2I6XA 2ZWOA 1O6ZA 4JZYA 5FUMA 1O0SA 2D0DA 2F8MA 2X2FA 4IDFA 3ZW8A 2JDID 2IF2A 1T3GA 2Z2XA 4XXHA 5CVCA 1M6VA 5A1TA 1VJGA 1T4CB 3U1VA 5FBVB 1STOA 1U0GA 2I4OA 5JC1A 1C8BA 2JFUA 4UC0A 2C82A 1FRQA 2FN8A 4V1CI 5DN6A 4EL0A 5LD2C 4QIHA 2RBEA 2WFLA 5I8PA 3U4QA 4ZAXA 1QF7A 5CDYA 3L1IA 3LYHA 1ZD2P 2B4AA 1J8VA 5FPHA 3JZAA 3W7BA 1DIGA 1P5HA 3FLBA 3COJA 2VJMA 3AT1A 4EGFA 4TT3D 5FA8A 2XA2A 1JX6A 2Y1EA 5JH7A 4FMDF 5IKXA 1KVSA 2HU7A 3QVSA 2NM0A 4BFLA 1MKYA 1C1DA 3B52X 3FDJA 4LDQA 4CUJA 2FF5A 3KPYA 2YWJA 2GR9A 3F96A 2HA2A 3EIUA 3TQOA 3ZV6A 4E03A 1XT6A 2VP6A 1SUWA 5JXIA 2WSSA 4YAIA 1IM8A 4LY9A 2WZBA 1ACLA 4CKBA 5EKTA 2HIAA 4KACA 5E8RA 1OX4B 4BNLA 3LY5A 1MJGM 4H18A 4BNJA 3DGFC 3SI7A 1I2DA 1UXJA 2CVPA 2YOFA 1NOIA 3O5AA 5D3MA 2CV0A 2AQKA 4IWXA 4P9NA 3SEAA 3RF6A 3SZMA 5A2QA 2A1UB 4JVSB 3ETCA 1ZMXA 4U7DA 1L5MA 3UMYA 1QDLB 2Q49A 3COPA 3OWOA 3PT9A 3DEZA 3KOMA 1LDMA 4PSDA 4R7TA 5K2MA 3X30A 1EQ2A 1GPMA 2HSEA 2SCUA 3ZN2A 5I7RA 5LZ9A 4UW9A 1YL6A 3EXHB 3H2GA 5EFZA 3MHTA 4XVCA 3WS7A 2ZBVA 2CN1A 2ZRLA 4G5YA 1HC7A 1LC3A 2XCQA 4M49A 1U04A 4YK7A 4RLFA 1Q7TA 1C9YA 4PYLA 5A9SB 1Q1GA 5D7BA 5K8IA 3IL2A 3V8NA 4EW6A 1CDEA 1A82A 3EMBA 2XGMA 4ZJUA 1RWNA 2A4KA 1U2GA 3MJCA 5JD4A 1HORA 3MCTA 3A6DA 1RLMA 3MMSA 4FFVA 4MR9A 3NTVA 1ML4A 4JP3A 2Y87A 5JXGA 4HWTA 1FSGA 1TYAE 1UR5A 1V5GA 3IQXA 5D86A 1CQIB 1GL6A 2YHAA 2YWGA 3RF7A 5AIJA 1XQ6A 1Z6QA 1AQIA 1KIAA 2VJDA 4Y2YA 1Z8DA 1RXIA 1NU8A 1U7DA 2SHKA 4IQGA 1SQFA 2QN2A 4MYDA 3TZQA 2P2DA 3V3TA 4KOEC 5AXBA 5KYXA 5KNCA 1KJQA 4PZAA 2GYYA 1BDMA 5JJCA 2VAMA 2RB5A 2X76A 3PD7A 1UH5A 4JH0A 4S24A 4TS9A 5F35A 5J2TA 3ISVA 2SICE 4H1HA 1F9AA 1FVOA 3H84A 1FU4A 2HD4A 2BEUA 2XITA 1BCRA 3B3QA 4H7JA 4P5PA 4TYMA 3RBXA 3I62A 4D1TA 3DWGA 3GPDG 4RKFA 3A6HA 3EYAA 3L8DA 1XZJA 5DCWA 4GRIA 1MRSA 3UH1A 2D1QA 4GNKA 2I6GA 1KORA 2XYVA 1JG6A 5DYNA 4EGAA 5AUNB 5LS3A 4QPDA 3S6JA 1W4AA 1V8OA 3NHSA 5T7BA 1SRQA 1GPNA 2C9BA 2JLBA 4R8VA 5DTRA 1KHTA 4CF3A 4BUJA 2B83A 1VGRA 2O9JA 5DM70 3L8MA 1BJTA 4FHZA 2AK2A 3IDAA 3O1HB 4TXHA 4EXYA 3LP5A 4KU4A 4X1IB 1A71A 3V4LA 3A1VA 3EXIA 2VPIA 4C4ZA 1EFDN 1D8AA 3UWMA 3CR3C 3VPBA 1UBKS 1YRAA 4R83A 1ZNBA 3OETA 3EA4A 1XTUA 3V7WA 1M2VB 3IO5A 1T0UA 2HJWA 2W2XA 5DPMA 3LDGA 5T8KC 1KSGA 1E1QA 3TTSA 1Q1AA 2O8BB 1OU4A 1Q0ZA 3INYA 3GPCA 2CVOA 4X1YA 1GKYA 3RSFA 1PV4A 2HQSA 1A9YA 1DIAA 3BN3A 3O1JC 4P3YA 4C4PA 5BV2P 1P2TA 4C07A 1ETUA 3VM6A 3GLFE 1KO3A 3BRQA 2Q8NA 4NDAA 4NOMA 4PO9A 1VFPA 4FGZA 4P7JA 5A5EA 1RJ9A 5C8VA 1DEKA 5AKHA 3U09A 3FH0A 3K20A 4M9XA 1S2IA 1EEHA 5AQEA 3I58A 4EY4A 3DE7X 2F3UA 1EUCA 1XTZA 1VSQA 4YAFA 1MP0A 4GI1A 1QR2A 1PQYA 5CU7A 5BUCA 4OX9Y 4AJLA 2FW6A 1XI2A 3ZS9A 1JIQA 2AQIA 1F3OA 1GFWA 3WHLA 3NORA 4JU9A 1GT6A 1NKVA 1W30A 4NBLA 3CIFA 2O3UA 2P9FA 2NXAA 3EEIA 2N42A 1PE0A 2CLHB 2BM8A 1USKA 2Y92A 2ECFA 2W0SA 3I9V6 3JRWA 4UAGA 3FFBA 4OSEA 1TPZA 3REGA 3UMGA 5JJ5A 1JPUA 2NAFA 1E6UA 4DSTA 3LSYA 1FNDA 2FX2A 2QPTA 1S9HA 2PNJA 1QGYA 3O9ZA 4UHEA 3AG6A 1CUJA 3WFZA 4MVJI 5J5CA 5JDIA 5IWAB 1ZCZA 3DAGA 1J9EA 2RJNA 3OJWA 4FGLA 4P3KA 2REBA 2VSFA 1Q7GA 3NOQA 4N5HX 1Q50A 3CE9A 2QRGA 4Q34A 2ZIAA 4LMBA 1CUAA 3SLKA 3GJYA 1NVVQ 2FEXA 2VJCA 2Q4DA 3DYBA 2BM0A 3KJEA 3WAKA 4C7VA 1A1VA 4HDMB 2CJFA 1U7ZA 2YJZA 1XR3A 3H87A 2EP7A 3QLJA 4BMZA 4C7BA 4EJ0A 2PWBA 4PQYA 2HCBA 4XDYA 4XZ3A 3NWBA 5TQ2A 3HA5A 3SOZA 4Q3LA 1B4DA 1GAQA 2Q99A 3BFXA 4MVJG 4JJAA 3NDBB 2B92A 1QHGA 4OJKA 4EYBA 2C5FA 1IBLB 2XTZA 4EJSA 2GA9A 1I6MA 1ELOA 2OHIA 1CLEA 1ZZGA 5P21A 1JWLA 3GYBA 5TMPA 1RQLA 4QXPA 2FB9A 1NXTA 1UK7A 3CNOA 3CPSA 4B6OA 4DLTA 1XA3A 2IZ1A 2W90A 5C34B 3RVPA 4EY6A 1KI6A 1PW5A 2JBAB 1Z3IX 3BB3A 5FB3A 3KC2A 2NUAB 2AV6A 1G6OA 3WK4A 1BFDA 4B34A 4DLRA 1B16A 3KNRA 1XU7A 3M89A 4UUAA 4UU7A 1L5RA 1TC2A 4NBSA 4Q7KA 3RREA 3W8RA 1L7BA 2W43A 2J85A 3IAS1 1VBMA 4DT1A 3DG9A 1C8LA 3DOHA 2BFBA 3RJ9A 1LLFA 1YKFA 4GGMX 1RWMA 2QP4A 5DNWA 3RYHB 1M83A 2NTVA 1HKHA 1ZVKA 1RAFA 1CG6A 1A4RA 2J41A 2WJAA 4EDHA 2HF8A 2OFWA 2HQRA 4OY3A 1V25A 2F9LA 2NT4A 5BWMA 2AN3A 2ZXEA 2GK7A 3F6SA 3W8DA 5JCJD 1Q3HA 3IILA 4AF8A 1NR5A 1LPOA 5GZ3A 2QE6A 5EUCA 4X24A 2BM9A 5ERXA 5ANRB 3P2KA 4K6OA 3R7FA 3U49A 3Q2OA 1DUIA 3BWVA 4PHGA 3N6RA 2QV0A 2VSOA 3KHSA 3KKEA 2C03A 1CUBA 4URYR 4YP1A 1H42A 2DLDA 1KAHA 2G70A 1UQRA 2A1TR 1C8KA 3CEJA 3L7IA 4R98A 5HA5A 1C9KA 3RR2A 1FXWF 2P1RA 1IYZA 4K46A 4X64B 2CFUA 1R4MA 1XCGB 4EELA 3J81k 3AF2A 5KOHB 4U2CA 4U7FA 4G4IA 5A62A 2ASVA 1U1EA 4F5ZA 4O2AB 2BE7A 2I99A 1G38A 5ALUA 2GLXA 1WAMA 3HE3A 1R9MA 5AXAA 1Q77A 5DN6D 1JMKC 3R9XA 5EE0A 3GIWA 2O3TA 4KIWA 2WMOB 1XQXA 1IMJA 3CRZA 4PXAA 2F00A 5SY9A 2GZHA 2HR1A 4FR7A 4HL2A 3KFVA 3MEQA 3IULA 5E6SA 3HACA 1V4VA 3W5VA 5JATA 1X8KA 2BFWA 2Y1DA 5ICCA 1VJ0A 4I3FA 4MIOA 1WDLA 3RT7A 1K1EA 3ST7A 3T0IA 3V6MA 3TG8A 1XN4A 1IBMB 3RUPA 4ALLA 5HZGA 4BVLA 4Q12A 2EQBA 4LWQA 2GNAA 2J3QA 3AVQA 3ZBPA 4F4DA 4CLEA 5JXHA 1G20E 3GJQA 3G0IA 2MSWA 1EUQA 1BH2A 1XMJA 1EQUA 2QMQA 2JH3A 3RHTA 3DH8A 1OXTA 1TNDA 2Y67A 1Y37A 1I8TA 3EHDA 2X9GA 3AJEA 1QNFA 1ETHA 2ZTVA 1MO4A 4I1SA 1PS8A 2C20A 5EJIA 2PSHA 4BAUA 1KVUA 3FSRA 4EJMA 3ZVNA 2GFIA 1XEWX 1G8SA 4A0HA 4JGBA 3BL6A 1XPOA 3LM8A 3QWIA 3KXKA 1Z8HA 3QJYA 4O63O 5AM4A 4CLHA 5IHXA 2Q9CA 1YULA 4HRXA 1KGSA 3Q7SA 3QUQA 5IAOA 1LLUA 2PRSA 4G3XA 4X45A 3PQDA 3MUOA 2AZMA 4OQZA 1A0OA 3UXHA 5HNKA 4U2BA 1PR1A 2XLBA 2NLOA 2O0KA 2GASA 2FZ4A 2VKQA 1MZPA 1G8YA 5L3RA 3D6TB 3ZTTA 5F7JA 3G7NA 4EYGA 1I94B 2ZSAA 4KW7A 3NATA 1JR3E 3F3MA 5KZMB 2QW1A 2CVHA 2RB4A 2V4MA 5H02A 5E7IA 4ZDJA 5EE9A 2YC4C 2PX2A 5ECGC 4MPTA 4MWTA 3AJ3A 3ZE0B 5A9RA 3C8DA 4JEHA 3HC7A 3VO9A 4H7PA 1QIGA 5LU9A 3IC5A 4KUHA 1QUFA 1ULSA 4JI3B 1XU4A 1OREA 3UCEA 2BDEA 2IH2A 1Z6PA 2H07A 1E1NA 1TMKA 2JIMA 2PZMA 3DOCA 1X86B 3EQZA 3QA3E 2XE6A 4OUKX 1MAWA 4PO1A 5HGJA 4AP9A 4MEJA 2Q3BA 1P4AA 2BPOA 3BAZA 4HNRA 4M9RA 4E5MA 4REMA 5EIEA 2GBFA 4TMFA 1WCIB 4WCVA 3WV5A 3NIWA 4JY7A 4WXHA 1DB3A 1TLLA 2ACEA 5EWAA 2GMNA 1SRRA 5FBLB 4BUCA 1JF8A 3BWDD 1F1JA 5K4HA 1UQUA 2E4UA 2C2MA 2C58A 2G5PA 3LXUX 4BNWA 2YN0A 3F8WA 3RTBA 3EQ9A 4KUGA 3THWB 4JCOA 3KT6A 1WMSA 3M1LA 1THGA 4MARA 1PG5A 2NO1A 1THMA 1ZD1A 3J81A 1T3ZA 3AVXA 1EGVB 5BVHA 2ZJ5A 1N2OA 3U16A 3INTA 2QVYX 1X3SA 2BP7A 4GM4A 3UK1A 2C04A 3T9EA 1KEPA 4P3PA 5JW6A 3EC7A 2V7QA 4NZZA 4YRGA 3E48A 3H5VA 5AESA 2ZJ3A 1HYGA 2JFYA 4NQZA 4OBEA 3C43A 4CHGA 3LPNA 5BSHA 5LSAA 1VLJA 2RGDA 2YMLA 3L6UA 4ZVKA 4C78A 2JRCA 2O8CB 2Z4SA 4HGPA 4N39A 5EWLB 3PHLA 4IDEA 1VJDA 4XCXA 3VKFA 3BXEA 4GYYA 4CKEB 2IHNA 3WSVA 4PRYA 5K0NA 4ENPA 3BEOA 3A28A 3LO5A 3CKLA 2CXRA 4R2JA 5BT8A 2CFIA 4Z5XA 3TIFA 1TF5A 4C43A 2D1SA 2HLPA 1JFLA 4O2AF 4PV7A 4UATA 4TN5A 4BCCA 4NJMA 1NLUA 5TT0A 5AM2A 4KR2A 2PRJA 2GN4A 1FZQA 1S7CA 1ZSVA 1JBEA 2Q9BA 4GW3A 4A7PA 3QOWA 4L8YA 4TN1A 3C3DA 5EKDA 5FBQB 1G8PA 2YWRA 1Q0UA 3TIVA 4BLVA 2VDKB 3OFVA 3MWDB 4MJXA 3WXBA 4CMHA 3TEMA 3G2NA 5IPFA 1CLUA 4B7ZA 2ORYA 5TGTA 1PN3A 2KE5A 2BOVA 1QYCA 1X2EA 2JFWA 3CT4A 3KOZA 3R3YA 4FP9A 3RVNA 4FU0A 3UWDA 1MR3F 1TCBA 2XUDA 3N2NA 1N6HA 1JTFA 3ZU5A 2Q6TA 1H3FA 1SG6A 3Q8XB 3NJ4A 4US2R 1IK6A 3ET4A 3Q41A 4NF2A 4IZIA 5DX8A 2ZBRA 2WU4A 3K0FA 3MLAA 2JIQA 4RPKA 3B6MA 4Z9BA 4L16A 1L5HA 4G2NA 2YVQA 1R66A 2FPIB 4J7AA 2CDBA 4JEMA 4UCFA 1QS0A 4CF4A 1GEEA 5KJEA 1QVVA 3ZWBA 4Q1BA 5EIOA 1JT9A 3I39X 2IH4A 4HNGA 1Z4QA 4EATA 1XD8A 3UG6A 1PAUA 2F59A 5AVJA 3C6KA 2RHHA 3B2NA 2FE1A 2R3SA 3O3CA 4K5QA 2Q3FA 4KIUA 4DJAA 3KHKA 3CJQA 4MQMA 3UAXA 3DLTA 3ZDFA 5HP4A 2WF9A 4XWOA 4CW7A 2QSJA 1NHGA 1V9SA 1YR3A 4X60A 1YE5A 1QP4A 4HYTA 5TXGA 2PYZA 1BIFA 2V6IA 1XF9A 3K1YA 5HXAA 4WBNF 1SOAA 3B6JA 4JJ6A 2PS9A 2BFFB 1U8ZA 3HL4A 2J87A 5CVTA 2H08A 5HM8A 2IFTA 3VVLA 2MOKA 1S3GA 2I6SA 1J5XA 3CA8A 1VC2A 4L5BA 4QBIA 5AW3A 2H0AA 4UVIA 4BNYA 4UVEA 3N2EA 3H0KA 4MV5A 1E5VA 2YYYA 5CVDA 4WV3A 4EO4A 5DI3B 3FGNA 2J3LA 3G0DA 4TVKA 5BN3B 1JI0A 2M6SA 3S2SA 2PKWA 4W1RA 1P9OA 1HQCA 5JARA 1R5NA 2CXSA 2ZT7A 4D8UA 5F4BA 3WHIA 5KYYA 1EFAA 1AK2A 2YHSA 3CNNA 2FK6A 5KBYA 3OIFA 1E3MA 1P7WA 1ZD8A 1QHNA 1VXRA 2ZB4A 3O4FA 2HHCA 3HCWA 4HTFA 5IAJA 3I61A 4EJSB 1LK0A 3CZMA 2O8FB 3FRHA 1M8KA 2FZEA 4ZV7A 2ZYSA 1O9BA 4CCWA 4W6ZA 1WCXA 3KXLA 4P54A 5K8TA 3FYUC 4C1GA 4YBRA 1R88A 2ZCVA 4D9KA 2NYVA 4D98A 1QHSA 4BNKA 3HYSA 1FYVA 1EFTA 5KNBH 1YA8A 3AUKA 4ER6A 3HVRA 3WGMA 1ZBQA 2OC9A 4CMEA 1WEHA 1IULA 3KSRA 3AH8A 4HY3A 3EK2A 1DWQA 2AR0A 3P94A 4R71A 5KVVA 4ZNBA 3PGKA 3I28A 3THOA 3DBLA 1IZ7A 3TKLA 4Y2XA 3IV6A 2C7VA 1Y8RA 2WHXA 3I2JA 1YKSA 2BFDB 3NRJA 3VO1A 1XIVA 4YRDA 2QZ9A 4RIGA 4OGWA 2CSXA 1QYIA 1OFVA 2ZE6A 4GICA 2BHNA 4IUCS 4D6PA 5ACRA 5B55A 2ZU6A 1V95A 3C1AA 2VDWB 4PQEA 4XLTA 4AF7A 1VCIA 4WOPA 4YJGA 2EG9A 3CT6A 1JJTA 3E7DA 4KQHA 4UWRB 2BFCA 2VP3A 3PNKA 1YDGA 2YJNA 3JYQA 4KWEA 1W1WA 4C0LA 4EFZA 3H2HA 4KR7A 3HCDA 1EUCB 1H4VB 3N0TA 3VZQA 1IEVA 3C2QA 1O3YA 3OJXA 5BO5A 4IY1A 1TT5A 5HK9A 1BMFA 2DU8A 4ZEJA 1Y4DE 4G0QA 1DC6A 2IUEA 3EC1A 4IP0A 1NWCA 1UF9A 4WZAB 3KQLA 4JODA 3AUSA 1QHYA 2OXRA 2ZBPA 3BMQA 3G17A 3B6IA 5A0FA 2VZEA 2HK7A 4L4SA 2WZCA 4JWTA 4M8NE 1EZ1A 2IU6A 4QDZA 4JZKA 1J42A 7ADHA 1ZKMA 1WPGA 2YR0A 3OWHA 3RPCA 2NV2B 4FEGA 1G18A 9ATCA 4QVGA 1QH1B 3QX8A 1DG9A 2GO1A 2ZRDA 2FWAA 2M6LA 3TWOA 4R9VA 1QZ3A 1RBYA 3V4VB 5IVPA 2FFJA 1XDSA 2A5JA 1VSUA 4S1PA 4R3WA 3VZBA 4WACA 3VA7A 1QP0A 3QHPA 1VHTA 1OKKA 2PIDA 3WBJA 4HATA 3O8LA 4EZIA 1ISHA 3PFGA 1NP7A 2P5SA 1U0NA 5IM4F 1LLDA 3S55A 2RH9B 4A2QA 1T9ZA 4U39A 4BWFB 3NB0A 4YJ3A 3SXUA 1P9RA 3RYCA 4LF6B 2HLHA 2C83A 2I8AA 3VKWA 2D5IA 5AKZA 5FWAA 4ZQGA 2MMCA 2OUIA 3AC0A 2FG6C 4TWAA 1H5UA 5ALGA 2GEJA 1DKLA 3F49S 2FSVC 4ISCA 5BSMA 1ACMA 4X95A 3S4YA 5MGNA 1KSJA 3V6LA 1M34B 2NXCA 1RFLA 4BX9A 3LD9A 4UTZA 1QLJA 3OTHA 3RE1A 3WG9A 2O07A 2WA2A 3I6QA 2BCGY 1T6ZA 1JB1A 4UVHA 5L4SA 4EF6A 2R6JA 1FK8A 1HEUA 4H4EA 1TF7A 3VAYA 4M1ZA 3WP0A 1CXZA 5GV7A 1F06A 4KP7A 4S35A 4XGNA 3ENNA 1NT4A 5IX8A 1YV9A 2NTJA 1EGQA 3DZJA 4AKIA 3L8HA 3BC2A 2XOKD 3L41A 3OAAD 2XMPA 4HI0E 1IONA 4I8XA 3G2OA 2ZB7A 2WJ3A 1DUSA 1JG3A 3HRHA 1YTLA 4UTXA 5EWMB 1KGDA 2AD1A 2VRWA 2WU1A 2Q5LA 2YVLA 3BTOA 3I0ZA 1VCOA 3PSHA 4Y2GA 2YYAA 3FHCB 4GR9A 3NVKI 1HF3A 4ZT7A 2G4CA 4XAQA 3QYJA 3MJTA 2I71A 2JBAA 3OMWA 4REQB 3T1YB 3ANNA 4AJ9A 3P71T 4YGXB 3HKEB 5HH6A 3TDNA 1EXMA 3AILA 5LWHA 3VBEA 4D45A 3MNFA 1FMLA 5H4GA 4U7PB 3TL2A 3K15A 3AWIA 3RVMA 4GMHA 5IS2A 4YIKA 1SU6A 3LUHA 3QVVA 3JVDA 1BMCA 1PSWA 3UJAA 2V3CC 1OLSB 3CNLA 4FWBA 3MRXA 3WRXA 3BL8A 5EIBD 3I9OA 3DDWA 2WNSA 5ECDA 1GYRA 2OLKA 3RM3A 2WZDA 3LOPA 3CPJB 4A2PA 1PWZA 4J5FA 2OLEA 5ILGA 1WG8A 3V4PB 2J46A 1YZTA 3H9GA 3GJ3A 3PQ2A 3R20A 4DWVA 3WSWA 3F0TA 1IY2A 2WW8A 2XX3A 3FTCA 4TSRA 4ZQFA 1NVWQ 3O73A 2ZI3A 4N6NA 1M2GA 3DFIA 2JVIA 3HCRA 2XWBF 3UKJA 1FMTA 4F4UA 3ZU3A 2CT8A 8MHTA 4UZEA 3K0KA 3AP2A 2JFBA 3OQOA 3LAWA 3CUUA 2A30A 3RJMA 4Z86A 1SUAA 2VNAA 2FU6A 4TKVB 5BVGB 1NXWA 4FCVA 3EXEB 4UVGA 1Q19A 2VH5R 5B1DA 4S12A 1QQ6A 4KQWA 5EKUA 1SHJA 3R5FA 3KVNA 4MVJD 4EW2A 5CB6A 3R5SA 3TTUA 2PHZA 1VHWA 1Y6GA 1XYVA 5H81A 1ST3A 3TD2A 5M2QA 1NBEA 1SB9A 3KQQA 2IOQA 5E9QA 3VHXB 1LWOA 1U3WA 3DLAA 1CVRA 2GTHA 2ZJFA 3QTTA 4GYWA 4C4OA 1Y8QA 3Q1KA 2FWPA 2Q4TA 1I4EB 3OCJA 2AN1A 2I2CA 4LJAA 4P80A