1YCHA

X-ray crystal structures of moorella thermoacetica fpra. novel diiron site structure and mechanistic insights into a scavenging nitric oxide reductase
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
398
structure length
398
Chain Sequence
SQPVAITDGIYWVGAVDWNIRYFHGPAFSTHRGTTYNAYLIVDDKTALVDTVYEPFKEELIAKLKQIKDPVKLDYLVVNHTESDHAGAFPAIMELCPDAHVLCTQRAFDSLKAHYSHIDFNYTIVKTGTSVSLGKRSLTFIEAPMLHWPDSMFTYVPEEALLLPNDAFGQHIATSVRFDDQVDAGLIMDEAAKYYANILMPFSNLITKKLDEIQKINLAIKTIAPSHGIIWRKDPGRIIEAYARWAEGQGKAKAVIAYDTMWLSTEKMAHALMDGLVAGGCEVKLFKLSVSDRNDVIKEILDARAVLVGSPTINNDILPVVSPLLDDLVGLRPKNKVGLAFGAYGWGGGAQKILEERLKAAKIELIAEPGPTVQWVPRGEDLQRCYELGRKIAARIAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nitric oxide reductase
publication title X-ray crystal structures of Moorella thermoacetica FprA. Novel diiron site structure and mechanistic insights into a scavenging nitric oxide reductase.
pubmed doi rcsb
source organism Moorella thermoacetica
molecule tags Oxidoreductase
total genus 131
structure length 398
sequence length 398
chains with identical sequence B, C, D
ec nomenclature ec 1.-.-.-:
pdb deposition date 2004-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ychA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1ychA01
1AKVA 2HNAA 5EHTA 5ACPA 3SPUA 2BC2A 1RLJA 4EXSA 2BTNA 5F51A 5FUQA 2BF4A 1QBGA 1X8HA 5AHRA 5LMCA 1FLVA 4UA4A 2A5LA 1DX9A 4RAWA 2AMJA 2MT9A 1WSWA 2BG2A 2HNBA 3R2UA 1SQSA 4C1GA 5B3LA 1BMCA 1YCHA 5EMNA 2OHIA 5ACTA 3AF6A 3OX3A 3U7RA 5LM6A 1ZWKA 5K4KA 2GCUA 2YNTA 4ZNBA 1RTTA 1WSBA 5HIPA 1YOBA 2HB9A 2BZSA 4FGLA 5EAIA 3AJ3A 3W78A 3BK1A 2FVXA 4RL2A 3PG4A 4C1EA 1QR2A 3OWXA 5LCFA 3B6KA 2CBNA 2P18A 4Y7CA 2FU9A 1QRDA 3TEMA 2Q0JA 1OFVA 1QH5A 5HH4A 1KBOA 4AWYB 4PU0A 1MQOA 4GYUA 3ZHOA 3F6RA 4TYFA 4Z5YA 5LJLA 4S24A 4XWTA 4YAOA 1D03A 1BVTA 3ADRA 3DHBA 3RPCA 1A8TA 3F6SA 3GFSA 5F4BA 2VW8A 3KEGA 1ZX1A 1XI2A 2BFKA 2BG6A 1CZKA 2QX9A 1GG5A 3KNRA 3B6JA 4YAUA 3NLLA 1QHEA 2FU6A 3GAMA 3ESHA 1JJTA 3PY6A 4YQEA 1DXKA 4N82A 3NHUA 4XUKA 2GSWA 3PY5A 1D4AA 4D02A 4ESEA 5A4KA 1BVYF 3OWHA 2BPOA 4ZO3A 2Z9DA 2Q42A 3TE7A 4UBQA 1H66A 2AZ4A 2QINA 3JXPA 3AF5A 3FNIA 5BUCA 4J5FA 4NQ2A 4C14A 3B6MA 3QFCA 3HA2A 3JSXA 2M6RA 4M0CA 1V4BA 2QWXA 4LAFA 2ZNBA 1E5DA 2Y8BA 3IEKA 4Y9RA 1AMOA 3SBLA 3N3BC 3BV6A 4KEQA 4HL1A 3X2XA 3KLBA 3LCMA 4FGKA 5B3RA 3L9WA 3I14A 1T5BA 2QX8A 5A0TA 1CZOA 2B3DA 1XM8A 2QMZA 5LS3A 2YNVB 4C09A 5ACUA 4UWOB 2P4ZA 2NYPA 6NULA 4LA4A 1M2XA 5HH6A 5EV8A 3OJWA 3GFRA 4YAFA 2FM6A 2QMYA 2FAXA 4FR7A 5EW0A 2D5IA 5LJIA 4PTZA 3TP9A 2V5UA 3NHLA 4D1TA 4DY4A 2NZEA 3FCZA 4N65A 1X77A 4YSKA 5AXRA 4RM5A 3A4YA 2Q62A 4OXXA 1H69A 4TZ9A 1BU5A 1X8GA 3ZR9A 5B1UA 4UAMA 2QDSA 3DHAA 1DDKA 5ACSA 1RCFA 4F8YA 1AG9A 2Z98A 1AKWA 2AIOA 4UWSB 2FDXA 3T9MA 1FLDA 2QX4A 5HH5A 4H0DA 3ESZA 4HKYA 5LVAA 2I7XA 1RLIA 3RKJA 5EVDA 1B1CA 1QH3A 4EY2A 4C1HA 3OVMA 1JA0A 1ZTCA 2V5VA 4GR9A 5FQAA 4YSBA 4GI5A 3ZWFA 4U7HA 4NQ6A 2BG8A 1I1OA 3IOFA 5HIOA 3FW1A 1AKUA 2P1EA 2UYXA 1D04A 1FVXA 1P9EA 4FX2A 1TLLA 4XDHA 3G1PA 1FTGA 1J9EA 3KAPA 5K4NA 3DH8A 4ZVKA 2I7VA 1FUEA 4P62A 3SRXA 1J9ZA 3KAQA 4Y9UA 3L6NA 3NFRA 5KIKA 3R6WA 3O73A 4Z67A 5IQKA 5JROA 3FJOA 1K07A 5EV6A 1CZUA 4NQ5A 1KR3A 5ACRA 2BFZA 4NULA 4AWZA 4H2DA 3OX1A 2YNVA 2W5UA 1XTOA 4LTDA 2FHXB 4EFZA 4WD6A 3LVZA 4ICIA 1C7EA 2Z9CA 3UXEA 5ACXA 4N9QA 3WXCA 1DXOA 2FZ5A 3P0RA 3SFPA 2NXAA 4PVOA 1WRAA 5K4MA 1VMEA 2R97A 3N3AC 2GFKA 3KNSA 2BR6A 4EYFA 2KQUA 4YALA 5K0WA 4ZVNA 5LCAA 3NHFA 2I7TA 4TZEA 3IE1A 3N39C 3X2ZA 3EYWA 1ZKPA 3GFQA 3W77A 4C76A 4D1UA 5AEBA 3F90A 2BMVA 2BFLA 5KILA 3K1YA 3O2NA 3NHRA 1C7FA 2Q9UA 3S0ZA 5LBTA 2ZZIA 4B87A 3ESYA 3SW3A 1DD6A 4ZO2A 5HISA 4C1FA 5EVKA 5EA2A 1JJEA 5FQBA 2YNTB 3W79A 3G5MA 3UXHA 3NHSA 3IDZA 1KBQA 1AKQA 2M5CA 2QJSA 4FEKA 5A5ZA 1ZWLA 2FLVA 5LLDA 4U7FA 2ZO4A 2QR2A 1CZNA 1AZLA 4Z7RA 1CZHA 2X2PA 5LBUA 2WYLA 4JO0A 3QE2A 2KLBA 3IEMA 3BC2A 2Y8AA 4EYLA 1AHNA 3IOGA 3T3OA 4KEPA 2DOOA 3OX2A 3D7NA 1T0IA 4RL0A 5FX2A 1J8QA 3IELA 1VJNA 4C1CA 5EWAA 1YCGA 2ZWRA 5AYAA 3I15A 3IE0A 2FOXA 2HPVA 3LT5A 4FGJA 1HLKA 1XYYA 4LTNA 2XR1A 4F6ZA 3VQZA 2QEDA 2Q0IA 1KO2A 1YRHA 2N1MA 1BC2A 4GCWA 3HLYA 2XF4A 5EH9A 3SVLA 2FK6A 3OJXA 1SG0A 1TIKA 3W7AA 3K20A 3ESXA 2YNUA 2FX2A 2FZVA 3FVWA 4Z5ZA 4YAWA 3X30A 4BP0A 3NHJA 4XDGA 2OHHA 1FLAA 4ZVLA 1YDGA 4BMOB 4NQ4A 5LSCA 3HR4A 4QOGA 2XOEA 2BN4A 4C0WA 4F6HA 2WC1A 4C1DA 4D1WA 2FCRA 4NLLA 1CZLA 5B15A 4PTYA 4LTMA 4EYBA 5TGZA 3NHWA 2GKLA 2WHGA 1OBVA 3I11A 4Z60A 1JT1A 5HIQA 2GMNA 3S2YA 4QOJA 2M6SA 3B6IA 4O98A 4TYTA 4D1VA 1Y44A 3NHPA 5AHOA 3RPEA 1CZRA 5ACQA 4U4LA 4AX1B 2E7YA 4HS4A 4AX0B 2FU8A 5F12A 5A0VA 3T3NA 2ZKIA 3FX2A 5AXOA 4GQIA 1VGNA 2BG7A 1XYVA 4QODA 4AD9A 5DPXA 3H3EA 4CETA 3ZQ4A 4CF6A 3I0VA 4UWPB 2A7MA 2MTBA 4EXYA 1AKRA 5ACWA 1YCFA 2M5DA 5LE1A 2BGAA 2BMIA 4FSBA 2V9CA 2DKFA 2YCBA 2GFJA 4BZ3A 4DIKA 4J5HA 4U7GA 3U7IA 4CHLA 1X8IA 4YSLA 4J8PA 4ZEJA 1FX1A 1F4PA 4QOIA 3KL7A 2R2DA 5B3KA 3SD9A 4H6PA 4GYQA 1YKGA 5NLLA 3QH8A 4ZVMA 4RBSA 2QX6A 3RKKA 4QOFA 2FU7A 3QFRA 2BG8B 5EVBA 1NNI1 1AKTA 2RG1A 3EDOA 4HEQA 1J9GA 2Y87A 2X2OA 5FQCA 3TZBA 4XWWA 1JA1A 4DILA 1FLNA 2R96A 1ZNBA 2F1OA 1WUPA 4HL2A 3L9XA 3F2VA 1L9YA 1WUOA 4TZFA 3X2YA 5A87A 4QOEA 1XT6A 1DXQA 1SMLA 5ULLA 2Z9BA 3NHYA 2QDTA 1A7TA 2WYMA 4UWRB 2BIBA 5LCHA 3ZNBA 5FA6A 3ES9A 2YNWA 1KO3A 2NZFA 4Z6XA 3P2UA 2BFZB 2ARKA 2MOKA 4TZBA 4RAMA 2WYMC 2OYSA 4PVTA 3I13A 3F9OA 3IE2A 2MWMA 3NHKA 4LE6A 3BK2A 3Q6VA 3DHCA 2WRSA 4C0XA 2YZ3A 5ACVA 4QOHA 3VPEA 4V0HA 2XODA 1OBOA 4R81A 1WW1A 2FHXA 2H6AA 2P97A 5NULA 3MD7A 4BMPB 3FAIA 2OHJA
chains in the Genus database with same CATH superfamily
4G84A 1U6KA 1DUVG 2C88A 2A30A 1NBMD 3K6RA 3P5SA 2MINA 4RNDB 4F46A 3W6ZA 2A84A 2DMRA 2M1XA 3WSVA 5J2TB 1S1MA 3IA2A 2R5WA 4P82A 3IBFA 1C30A 1QG6A 3GGDA 3C6KA 5AK6A 2RHGB 3SZLA 4EXSA 3DBLB 3ICVA 2INGX 1KS9A 1P0CA 3ND6A 2NVOA 1FLVA 1W5EA 2M6KA 3VZSA 1QQTA 2BRUA 3WG9A 1P1BA 4E4YA 1UBHS 2WOOA 3BMCB 3CLRC 4X8OA 5FBHA 5L7WA 3ACCA 1ZOIA 3JQDA 5FBZA 4LZNA 1RAHA 2CZCA 2YJNA 4LMBA 4QPPA 2WHXA 2XIQA 1KYVA 3MC1A 4DGQA 2YWEA 4CF7A 4DDWA 1JR3A 2YWFA 3A1VA 4MVJH 3ROXA 1WZ2A 3A27A 3KJHA 2ZUVA 1VHLA 4ZANA 3M9WA 4AIIA 4TTAA 1C1XA 4XX1A 1TYDE 3K0SA 3G9XA 4YDSA 2GYVA 5IT4A 1U63A 3JQAD 3V8VA 4MMZB 4CMJA 2OAEA 3WK9A 1FMCA 3GXOA 1A5ZA 3K32A 1KRXA 1N2GA 2QU8A 3EMDA 3HHEA 5DTEA 2BFCA 5I7UA 4ZI7A 3OAAA 5BQ5A 1N5DA 2GNAA 2VOEA 1W30A 4CE6A 4E5PA 1XCPA 1KIAA 3CUWA 4EB6A 4C1EA 3PG4A 1Z0UA 4JI7B 1UBKS 1M8PA 2CL0X 1DDGA 1YRLA 3OF2A 4X3CA 5LLTA 3RYIB 2GN0A 2I3DA 4S3MA 3C8MA 3CO5A 3CURA 1G6OA 2AUNA 1IY9A 1E5LA 1U0FA 2JGLA 2JB9A 3NJRA 3QUTA 4GRIA 4TMYA 4YRGA 1RC8A 2JIZD 3U4MA 2X9GA 2AF4C 4YAOA 1Z26A 2G71A 5JAHA 2ZVQX 3AW8A 2GN8A 1PEKE 1S6YA 3CR3C 1A9OA 5B1SA 3FSRA 3V1MA 2V0NA 1AOXA 3SEQA 3VHQA 3A8TA 3F6EX 3GPIA 1BXRA 4CM8B 3QEAZ 3DOCA 3FR7A 4H18A 1MR3F 3QWIA 2YFHA 4K9MA 4HSEA 4I9GA 1EGMB 1WDKA 3EZ7A 4HNVA 5KTMA 1LRKA 4FT4A 1KMQA 2O05A 1JN0A 1V9LA 2QORA 3VSDA 2G1PA 1SCJA 4Q3DA 2ZYDA 3DBHB 1ULHA 3UXMA 3NLLA 1JZTA 4V0LA 3CWZA 2J3DA 2O6HA 5E9WA 1ICEA 3JZDA 1JJTA 4R84A 2IXGA 4BMCA 4I4NA 1MVLA 3LHSA 4Y9DA 5AW5A 4K6CA 3K8YA 4JBIA 1I36A 3WJ1A 5CH8A 1JQLB 4BNYA 3QG5A 1F9AA 2C9BA 1NF8A 2NUPB 5THQA 2POQX 4LRTB 3SNKA 3KZNA 4PZZA 5B55A 5LR6A 4M1YA 1XN4A 3Q6NA 3D1VA 2RKBA 2HMYB 3PNYA 4F9FA 1E3SA 1SD5A 4X1IA 1LZKA 2OOKA 3NM5A 2ZULA 1GKKA 2FN9A 4OJQA 3RTAA 3CUVA 5AIBA 1KEVA 1V4BA 4FWTA 5KDOA 1PNTA 1JJAA 2FTKE 4UU0A 3UG7A 3OLXA 1GP2A 2XH8A 2VDUE 3H4TA 3KSZO 4MUXA 4MI6A 4LMRA 4JKYA 3VX3A 5K6AC 4HPXB 4QL3A 1N3BA 2X9LA 3ZHUA 4Q3KA 3C3PA 4LVNA 1GQ2A 2PVCA 3LMKA 4KMMA 1BXGA 2OY0A 2YV1A 4P7KA 4FGKA 1TJNA 5DEIA 2CLDX 4BNMA 1PQUA 4QGSA 4FOTA 2QLTA 1NXSA 2RK3A 4WIAA 4Q9AA 2B25A 4LGCA 3ZDCA 1GR1A 1X7YB 1XEAA 2GDZA 5BPFA 5BXQC 1XR3A 3RBAA 3DTTA 1J24A 2GN1A 4MKHA 4QXPA 2QP3A 2P7HA 3DEHA 3HYCA 3ZGVA 1QQ6A 4UCWA 1H2HA 2DGDA 1E2PA 2HKIA 3EXFB 4JUCA 4UUMA 2PUBA 3C3YA 3DF7A 4J1SA 4J9VA 4BFYA 3LZDA 5E38A 4ZI2A 2EVWX 3LPLA 2AWOA 1L5GB 3VGPA 1QE5A 3N0TA 1EFRD 2V7PA 2IYAA 5GJVC 1NMSA 4V03A 3O31A 1J90A 1RE0A 2HA3A 2C84A 2QZJA 1HA3A 3E9MA 2H63A 2OBXA 4BNKA 3TW0A 4NPCA 2WB4A 1GUBA 3C5EA 2Q50A 3RIHA 2JRLA 3H5NA 1W93A 1MRZA 1Y89A 3IKVA 3OQHA 3FGNA 4B44A 1VSTA 3BSYA 4DBZA 4KDEA 4WZAB 4QUHA 5KQGA 2P41A 1Q3KA 2XBUA 3NT2A 4JJ4A 4ZV9A 1P1CA 3NANA 2R6DA 3RASA 1L6RA 1YJXA 2JZNA 3GVXA 4YRAA 2WIBA 1ZNXA 3OUTA 1H5QA 4GP7A 4AO8A 1XQWA 1PQWA 4MW1A 4KACA 1SIUA 2O3TA 2XNSA 4WXRA 5IKEA 1FLDA 2WHRA 3TEJA 4MUNA 3INTA 2XT0A 1N5KA 2GBCA 4RKEA 1L8AA 1RLIA 2D06A 1JG3A 2QV0A 1S2DA 3H2JA 3FBGA 5K6RA 2W6ZA 4GRDA 4HMPA 4U0JA 3ZHRA 3K2BA 4BVFA 1IM8A 3AHJA 3EUWA 5T3YA 4F3TA 5JUWA 1NJSA 3JQ8B 1PJ3A 3ROQA 3UCEA 4JUIA 4RELA 3O1IC 3YASA 2ZM5A 5H3CA 1FEZA 1YB2A 1K9SA 1PDVA 4JK3A 4RIFA 1GN9A 4RIIA 3WISA 2XBLA 4D74A 1GPMA 4OATA 1UQUA 4LX0A 5K0EA 4K40A 5DYNA 3IMCA 1MCZA 3BWVA 4TS4A 3VKWA 4ABYA 2I67A 1I0IA 1CJBA 1KJNA 1TLLA 5DDIP 3B7PA 3BOSA 3C3JA 5ES3A 4MS4A 4E5UA 4FMCB 5K4NA 2XB2A 1SCQA 4OK5A 4C7BA 3L1HA 3THWA 4I4LA 3DGEC 3FMPB 5T4EA 1R7RA 2MU1A 2WSSA 2VHWA 3L8HA 1ITZA 5ERYA 1P0IA 4YUVA 3TDKA 3TQQA 2ZTSA 2O50A 2ILVA 3R7LA 4XRRA 1UBSB 3L5KA 3ZLUA 1KMIY 2O1WA 3GLGA 1J1IA 4QTXA 2P9BA 2R6R1 2BKEA 4A8JC 1UAYA 2BHSA 1A8QA 3CBGA 2RAFA 3W8DA 4BQOA 1UODA 2X9QA 2J87A 4X8MA 5AOAA 1RC0A 2O2XA 3FRJA 4QDUA 3X1ZA 2YNVA 4FNGA 3NI2A 3F98A 3P20A 4Q9LA 5A2QA 3KB8A 1XNRB 5KNBH 3BL8A 3RVKA 4BUCA 3I6YA 3JALA 3JW8A 2APJA 4ISBA 4DCNA 5LUBA 3K4QA 4LRWA 5TV2A 5U1PA 3G2PA 2PBZA 4XIGS 5L3QA 4D8UA 1ZK3A 4EPVA 5JATA 2GARA 2I1LA 3MJEA 1BFDA 1RI1A 4PQRA 3ROFA 4XVRA 3GLGE 3PU6A 2R97A 3Q11A 3IFSA 1JQEA 4RPGA 1A72A 3RANA 3N28A 4IQ8A 4EYFA 3GYBA 5LIRA 3CKMA 3AUAA 3GV0A 4ZO6A 2D1FA 5B7GA 5LCAA 4MRPA 3B6EA 4P9NA 3RD5A 1A88A 2OGTA 2MDTA 3ID6C 5C4MA 1RBZA 1DV1A 2JD2A 3GFQA 5K3CA 5HKBA 4C76A 3RGGA 2A9RA 3N9IA 4EJ2A 3ZHXA 3P9PA 4RZXA 3I1YA 2HCBA 1U8TA 2WE8A 2GO7A 3DF9A 5LD2C 1BEUB 4R3UC 3ESYA 1IQ0A 4TXMA 2Z6UA 1M2JA 3SIWA 2XA2A 3ICEA 1R6TA 4RF5A 4FHDA 1SCNE 5B58T 3S0JA 1J8DA 3PWSA 3UWSA 3LP8A 1JJEA 3KTAB 3HMKA 5DGIA 1N4AA 4FMCF 4Z7NB 2OD9A 1TRKA 3DPSA 1Q2UA 3KP1A 4ER7A 3X2YA 2VO1A 2CF6A 3OZBA 4HB0A 3KOYA 1B8PA 5JU6A 1CUHA 1RADA 1JWAB 2QR2A 1ZSYA 5KMGB 4RK6A 3LUKA 2VDQB 2IX3A 4IILA 1CV2A 1NNEA 1EBUA 3F9CA 1CE8B 1CUWA 4B73A 1T9AA 3EQ7A 4O59O 1RYDA 3FY4A 2ATCA 3JQCA 1WAMA 1HPLA 4L74A 3KJXA 4NONA 1LVHA 2OCPA 3HU5A 2X76A 3BF7A 4FMDF 1NJ1A 4TYWA 4KQJA 121PA 1BMDA 4NV0A 3CLTD 1R4MB 3BAFA 2EXXA 3BQ9A 3GIWA 4LYHA 3VU8A 2ZDQA 4BV3A 5EHZA 1EZ4A 3CTPA 3PYMA 1T4GA 2ZIGA 1UOEA 1CIPA 1DUIA 3PEUA 2IE0A 4RSHA 2WMYA 4KYVA 4HDRB 5D5QA 4ZAWA 4AJLA 2DOOA 3WLHA 1YA8A 1K4KA 3LL7A 4NCXA 4WKBA 1XRQA 2IIVA 2O2JA 3LX5A 1G18A 5EE5B 3ZXXA 1RZVA 3H5WA 4DIEA 4MAMA 4BMVA 4JI2B 5F21A 2RHMA 3ZWQA 4WOJA 2HPVA 3TE6A 3A05A 3ZNOA 1JYSA 3SEAA 4EARA 2MSCB 4FKMA 4M7OA 1GZ5A 4KV7A 4MMXB 4QHSA 4RK1A 1T35A 5C4GB 3GBSA 3OQMA 2XCOA 2J0EA 3WSWA 1GPBA 1ADJA 3AQ4A 4J0KA 1Y8CA 3HLYA 3P9IA 3HY6A 1GN8A 2KHZA 4UU8A 1XLVA 2O8BB 2VYND 3TQTA 4BGVA 2FK6A 1J2RA 5F5NA 1RQNA 5EYPB 3LQRA 4HAVA 1RZ3A 2X0DA 1X9IA 4Q82A 4TXJA 1V4VA 4MVJP 1VPVA 4XX0B 1Q16A 4O2BB 3X30A 1UMKA 3SJCA 4Y8VA 2A1UB 1E2HA 2CK3A 1Q1GA 4M54A 3AOGA 3NORA 1KSFX 3RWMB 2RBGA 4EG6A 1XNJA 4BP0A 5E4FA 3GRCA 3PS9A 5CDYA 4BVAA 3RSFA 1FSPA 1I32A 4L9AA 2H6EA 1B6RA 3NDPA 3OEWA 4HDQB 1KMNA 2FB9A 1UM9A 2XOEA 3PP8A 4BL5A 4Q4AB 5ELLA 4UTNA 5AKKA 2C2KA 3M81A 3VVBA 1GGHA 1CP2A 2UUPA 3H5VA 4I14A 1M5RA 2JVIA 3QW2A 1A97A 3R8XA 3AF0A 5TGZA 4DQUA 1H85A 1W9MA 3AB8A 3OPYB 2ZJ2A 3STHA 1EFVA 1UBMS 5ALSA 4ZAXA 3SXPA 4CMKA 5EUBA 3U1BA 4K03A 2HJSA 3I11A 3JQFA 1U7UA 2HJGA 1QO9A 3GJ5A 2QG6A 3HKDA 4HNSA 4JA2A 4JYZA 2ZI4A 1QPBA 1ZCAA 4LQDA 3G8AA 1FVFA 1PHPA 3DKVA 3AJEA 2E21A 1Y44A 1L8OA 1X8XA 1GQQA 3STYA 1K5PA 3MTIA 4RHCA 2VHEA 1BHO1 1PSZA 3G89A 3TKAA 1W36B 4AX1B 3NT4A 1PJTA 1EAYA 1B42A 1QWSA 3TRDA 3LDFA 4U2DA 5DK6A 3DOUA 1T5DX 5MGBA 1ZNQO 3ZS9A 5LLSA 2NZWA 4QDKA 1E9AA 1OW3B 5H3HA 1W46A 1VBFA 2QLJA 3VNSA 1H1TA 3BSWA 2H2HA 1QS0A 1DTEA 1WXQA 4OFZA 2CHVA 3KJGA 4NBSA 1AKRA 2YCLA 2AT1A 3LXMA 3TH5A 4BAUA 4F93B 2IYVA 2DJIA 3GAAA 1GG2A 2FW7A 3JTMA 5EVCA 2BYTA 2OQIA 2QQGA 3I28A 1BGWA 3KZCA 5DI9A 2DT8A 3N5KA 3WRVA 1KAQA 2JG3A 4BPBA 1FFDA 5M3BA 1HQDA 2TECE 4WACA 2FPIB 4UEJA 2ST1A 4Y67A 4O2BF 3PQEA 5HZMA 3MZ0A 4MWSA 1GQFA 1NX6A 3DKRA 3GK3A 5EE3A 4ZAFA 3W04A 3VH1A 4P7JA 3R74A 1X80A 4B4WA 5EQDA 3U9TA 2VC2B 4GXTA 2W2VA 2I1QA 5L3SA 2FU7A 4IOMA 4RACA 3T5AA 5SY6A 2D6FA 4EG4A 1O4VA 4AG3A 4BWVA 4KQIA 2HZBA 1JHAA 1EFKA 1ZRMA 3WWCA 3KWFA 2CWDA 2OCDA 1EFDN 1NVKA 3KELA 1BE8A 5IUKC 4B4KA 2CHUA 3MNFA 4EB6B 7AT1A 4NYJR 4QARA 2ON6A 2J31A 5GINE 4N1AA 3WBKA 3NBYC 4MKFA 4YIKA 5T4FA 4EMUA 1KEKA 4PYNA 3IVCA 2GK4A 1WCYA 1RMTA 2AYYA 2Q6KA 2AQKA 2FSPA 3FF4A 2WMDA 3FFTA 3LDGA 3QITA 4KODA 5HILA 3V4PB 3COZA 4DCVA 5K0JA 1SMLA 5KSPA 2OYRA 3AL0C 4FWBA 4EI9A 4YMVA 5I7HA 1QDLB 1VMKA 1XQ9A 2CXRA 2G70A 3JYNA 5EIAA 1V7QA 5FWNA 2H4HA 3CNQS 4Q37A 1ZN8A 2NU9A 1A7UA 2Z43A 4OLJA 5PGMA 4CCAA 4CUJA 3PFBA 2BW0A 3TSYA 4BLSA 6Q21A 1OI3A 1Z7EA 1EK5A 3E23A 1ZN9A 4Q1FA 3O8BA 1QP7A 3F9OA 5D5HA 3DXZA 2ZYTX 5KWEA 3BK2A 1G1MA 2VJKA 4WZBB 4LF7B 1V26A 3CT4A 2XDYA 3CUTA 3F6BX 3J7AC 4D56A 1ZXBA 4FFWA 2IXEA 3FZGA 1Q21A 2H4FA 3IEXA 3QYJA 4HH1A 3ZWKA 1XWIA 4RQAA 1Y9AA 4Z99A 3AUJB 5FPTA 1IL0A 4OHWA 5NULA 4S1TA 3KXIA 4KR3A 3UV7A 1MX1A 1ZXXA 5KEIA 4LFCB 2Z3WA 3D43A 5ACPA 2V0CA 3KKPA 3Q7TA 1ONOA 2RHCA 1Z4PX 3O4RA 2GK6A 3PUVA 2Q6LA 2RH9B 5TVGA 1HI9A 5MN5A 1A4UA 3QWHA 4HRAA 5F51A 3UOAB 4CTKA 5FUQA 5JS8A 5E8RA 3EH2A 5IUNC 2AG5A 3A9WA 1TU4A 5CRIA 3LBYA 2QMHA 3G8BA 3U60B 4KCGA 3PXAA 3TW4A 2HLNA 2J9YB 1KFBB 3L7YA 1KS2A 5JNUA 4WLNA 2GFIA 5C5IA 2VJYA 2C2XA 2DFLA 5JZBA 1EK6A 2I4NA 3L18A 3MWEB 3OF3A 3PDHA 3T3MB 2XNKA 5HTOA 4Z2AA 3DBIA 1IOVA 1BKDR 2V7WA 4GE3A 3DEKA 3QE0A 1VCMA 4IXDA 3OTWA 4N3GA 5AXBA 3CHYA 2ZBQA 2R11A 4UDYX 4MV6A 2BSQA 5I7OA 4QQRA 1XZAA 1G59A 3K0CA 1W2WB 4US2R 3JQ9A 4KXVA 5IT0A 2HJRA 2O3RA 3GCGA 3PXBA 4RY0A 1RNLA 2IPOA 2WT9A 3RB8A 4B6FA 3SAJA 5BNIA 3FGPA 4E3WA 1WPGA 1QR2A 5CVTA 4FHZA 4IV0A 1PL0A 1XRLA 3BYZA 4QJ3A 1AF7A 1ZMBA 3LSYA 3OETA 3ZOKA 1U98A 4Q4HB 4FKBA 3ZGOA 3SS9X 1ZD8A 2OBNA 3PHBE 1TPYA 1UWCA 2HSGA 3IVRA 4R51A 2AJ8A 4OFWA 1NUPA 2PR2A 4AMVA 5DTQA 1BC5A 1D2EA 3KX2A 2IIQA 1ACMA 3OKFA 5ELMA 4B4DA 4BMDA 2FEPA 4NEHB 2WHPB 1GRRA 2Z2YA 3AI3A 3BREA 1SXJC 2XCLA 3LYHA 5EGNA 5I9NA 3KJNA 3THXB 2NP7A 1N1GA 4MKIA 2IW3A 2WA2A 4B47A 5JCJD 2FH5B 3FVRA 1JEAA 1GR0A 4XWGA 1AMNA 3AY6A 2BEWA 1J09A 1Z36A 4Z51A 1IM5A 4YAUA 2W6ID 1PVOA 1XROA 5J23A 2FU6A 3V1KA 4YCJA 1G8SA 3I01A 3P0EA 3DOOA 4Y2HA 2XITA 3HV2A 5FI3A 2IWHA 1PZGA 4DEXA 3D1LA 3IR5A 5I9TA 4D02A 4ESEA 1QAOA 5AVSA 5K6TA 5IC4A 3DDNA 2AXEA 3MWKA 1JI3A 4IXMA 4Q9JA 4KN9S 1NVUQ 1YDEA 4BN4A 2GCOB 1VLQA 4HQ0A 5JAZA 1R74A 3U16A 2C20A 5LQCA 4PYJA 3WMFA 2BV3A 4F91B 1FFEA 2DBQA 1FBNA 4XXHA 5EJ9A 3VJRA 2CJYA 3BK7A 1PFVA 1Z5NA 4TT3D 4F1JA 1DC5A 2O2GA 2PA3A 5AJVB 1E5DA 1BHJA 4M9CA 1LS6A 2Z04A 4ZT2A 3TLYA 2P6PA 3NYWA 4KFRA 2LZ0A 1FNSA 2VF5X 4M0EA 3T15A 2QVXX 1SA0B 4B8ZA 5BW8A 5DN6D 2GEUA 2ERXA 3R9IA 821PA 4Z3OA 5EE0A 4JSRA 1B41A 2C95A 3L46A 3PXDA 4J0GA 4M9ZA 4HQNA 3OLYA 3AUFA 3HCDA 2PX6A 4DJFC 3TQIA 2V8OA 2A59A 1ADYA 2V7TA 3KJQA 2QD3A 3AVWA 3OOSA 1O97D 1M6YA 1QLHA 1U8UA 4YBZA 5EJFA 4F7DA 4F86A 3WQQA 5B64A 3AV0B 2NQ8A 3FSEA 4EUEA 1W88A 4GG1A 1XUOA 3ILXA 4E46A 5E7MA 3S7ZA 1XL1A 2YNVB 2E4ZA 3R9WA 1MNAA 1NXOA 2EWVA 5ALIA 1PR4A 1COWD 3BGWA 4I5FA 6NULA 2GD2A 3QPUA 3TIFA 2W2NA 1KOGA 5BQOA 3BMOA 1Z35A 3SFTA 4ECAA 2BD0A 2FMFA 1R8XA 1H3EA 2AB0A 2D5IA 1V25A 1GQSA 4UEWA 1N5MA 1VLMA 1WP9A 1TZCA 3IP8A 3UK6A 5EJ5A 1POXA 4NYIR 3QTLA 5AHWA 2VDNB 2VSFA 4ROSA 5FBWB 1YRBA 3PE4A 1C9KA 1OHHD 2J33A 4WGGA 3IP3A 2YXNA 3KC2A 5TPZA 3FSGD 3JAMA 3M9LA 2RGNC 3TR5A 3JSAA 5KYXB 3K6SA 2ZRCA 4COOA 2UKDA 1MF7A 3UNXA 3ZCQA 4B7AA 5ALUA 4IIEA 1OB2A 5A1TA 1KERA 4HDNB 5KO2A 3R20A 2P6UA 1JBEA 2OKGA 4JBXA 2ZAGA 1T5OA 1FS5A 1ODFA 1P3DA 1RIFA 3AVXA 1BMTA 5FWYB 3FPFA 2JJ1A 2IYEA 3AEQA 4V0NA 4FYKA 4NE7A 4WNIA 4UHDA 3QX3A 4D8YA 1MO5A 2GYYA 1JH8A 3NOVA 5I9SA 4C30A 2V5VA 3MK31 2GVZC 2QUAA 4OHKA 4LBWA 4P08A 3UXYA 1ABFA 4P2GA 3WQHA 2KMLA 1IH8A 2H5IA 3MMNA 1KVUA 1JDPA 4Y1FA 1RPTA 3X2FA 2FSVC 4WX2B 4IPTA 4CMGA 4MS3A 1VSVA 5TR9A 4W9RA 1P9EA 3TUIC 3FZYA 1OH5A 3ESRA 3K8QA 2ISCA 5AW1A 1N0IA 4OGGA 4M0MA 4MP8A 4JI4B 1J0AA 1P91A 1ZD4A 2GFHA 2VUUA 3CG0A 3H9EO 4WEOA 3WZ2A 3F5SA 1JR6A 1J9ZA 4KXFB 2RBEA 4L51A 5AKJA 4OOFA 5E0KB 4ALKA 2FWMX 4N7RA 5KIKA 2ABWA 4F1KA 3G68A 3GJ0A 1RZRA 4B6SA 2OWEA 3LHKA 4XCQA 5JY6A 3DKPA 2PMBA 1IB0A 3GNQA 1VIMA 3FJOA 2PM8A 2VAXA 2HSEA 3JR7A 1GPUA 5BV0A 5AVZA 2EJWA 5CJJA 1ZQ9A 4M0LA 2HX1A 1P7VA 2I8LA 3OPXA 2PGNA 4JC0A 5K0BA 2FHXB 1YJAA 3LVZA 1TAQA 5FFFA 5C32A 3KUUA 3T06B 1C7EA 1VGQA 3NJ8A 1GQRA 3WBFA 3DQPA 1I7DA 1ZI8A 4R2IA 4CKBA 4D4KA 3OFJA 5BQXA 3KWMA 1EJ0A 3SDBA 3ZCTA 1PJZA 3C8UA 2W2KB 4RV9A 1RJWA 4O3MA 3ETLA 4RE5A 2KW5A 4KQCA 4OIMA 1I7QB 2XJ4A 1H4QA 4JLAA 3HADA 4MRMA 3USCS 3GRKA 3UFXB 2Q8PA 1GPDG 5FBVB 2HK7A 3B78A 3DE2X 1DQZA 1MC8A 3ECSA 3O7WA 3FPLA 2CFSA 4LW8A 4XYGA 4EO9A 1X1DA 2H29A 3VSCA 1TECE 3WWEA 2XYQA 3QBTA 3K8OE 4R54A 5H81A 2WZCA 5KILA 4FNMA 4KGXA 3ZHVA 4G26A 2XKJE 1CNFA 4QBGB 2Q9UA 2YTZA 4MKGA 3AVPA 4OBEA 4EZEA 1VMIA 3KU1A 4IRUB 1KC1A 2Y71A 2ROQA 4BZWA 3IDSA 3TTUA 5A4AA 2OL4A 3GF4A 4LSGA 5IJ9A 4DNFA 5BSKA 1XFAA 3HKDB 3Q7IA 2JHFA 3NGMA 3DYBA 2JBAA 3OURA 3NHSA 3E2MA 1IY2A 3IDOA 4UTRA 3B82A 4JGGA 1KQPA 2QQEA 2PUCA 2EOAA 1X3LA 5AKZA 2WTNA 2PRSA 4J1TA 1YO6A 4OP1A 4ZA2A 5F23A 4JVSB 2PH7A 2VJAA 2AVNA 1JBQA 1MO2A 2GZAA 2VWHA 4NYMQ 3IO5A 4HNAA 3D6TB 1OBHA 3UB3A 1KR2A 3KQHA 4JO0A 1JQ5A 4DWOA 3NEYA 4I55A 4ZOQI 1NR1A 2C0CA 4I46A 2P5SA 3WSTA 5HCIA 1E6CA 1NVAA 3D7KA 4E6EA 3DE0X 1RHJA 4NURA 1KTIA 3KCQA 1N2OA 2OBFA 4J2HA 4QHYA 4YAEA 2WUFA 1Y4DE 4UE2A 5M2QA 2P9HA 1REQA 3H2ZA 1TTPB 3AEUB 3ZQUA 3N8HA 4PONA 1V1MB 4CCYB 4HX2A 5KUTA 1ZM4A 5CTAA 1XHFA 1ZMTA 3JZMA 3Q7RA 1WB4A 4FHCA 1GADO 5EWJB 3P1JA 2EV9A 3OZSA 1P72A 2G9VA 1ABEA 2WF9A 4OQLA 5F2OA 2ZBUA 3VH4A 2QD5A 5DXJA 3S6JA 2ZWOA 5DNYB 3K0HA 4K6HA 1KWKA 3BE6A 1QG4A 4G1VA 2CXPA 3GZ4A 4EHHA 4UBNA 2J59A 4OHZA 1HLKA 2D2XA 3DDSA 5EZSA 2G1KA 1W87A 2JAOA 1NLUA 1XTJA 4KPUB 4LF5B 3VQZA 4M21A 1BXZA 1PIWA 1KO2A 4NMMA 1P0QA 4ETIA 2FXIA 2F3RA 4JR2A 4RJKA 3CF4A 3FB1A 1Y48E 4XPIA 4DCSA 2BSXA 4JBYA 4AUMA 2QVZX 4WKNA 1UT5A 1PYOA 3TQOA 3S40A 4LDZA 2OHOA 1AQNA 2ZFUA 5TJ9A 1NY6A 4XGQA 3GEBA 3KVOA 5CM9C 5CFZA 2KBFA 3KR2A 1KC3A 3IUNA 1DZIA 3C5WP 3D3KA 4I5IA 4JJ6A 3ZXYA 2VYVD 3R24A 4IO0A 4DLWA 3NVKI 3ZJTA 1NL3A 2ZWPA 2NYRA 1ZMRA 2DPMA 3DBRB 4RFVA 3BWCA 1MEJA 4RZ2A 1G19A 1VMAA 1X1RA 4TVSA 1BJRE 3ASZA 5F9MA 4D1WA 1Z9BA 3ZX5A 5B15A 3T5PA 1D4ZA 4RAQA 1CUIA 4D2IA 3C7DB 9LDTA 1Z4KA 2Z1DA 5JPDA 3GRYA 4LHVA 1V5WA 2O1SA 1BVUA 5CD9A 3DHEA 3PBKA 4Z60A 2J5BA 2YDXA 3EC2A 3IR7A 2R8YA 1G16A 4WBNA 4UFPA 2B4TO 3S2YA 2HU2A 1UBEA 4Y0VA 1P4HA 1DQRA 1LTQA 4IIDA 5KSOA 4HB3A 4O98A 3NC0C 5CUQA 2RK6A 1E92A 3WGTA 1CZRA 1LNSA 5LQMA 2R86A 1CS4C 3MGGA 4MX8A 3W2TA 3ZU2A 1L5SA 4UVGA 4IJ6A 4ZDIA 3AV3A 1E2MA 4A5SA 5KWJA 3PKIA 4D3ZA 4E88A 1MQAA 4TMWA 3B3QA 4NICA 4MR9B 1HF3A 1Z73A 2RG7A 4M3NA 4HTFB 4WOKA 5FUVA 1P3Y1 2YN2A 1FMTA 3GJ6A 3RUPA 3G8CA 3V42A 4HHEA 4EVQA 4ZOBA 2ISSD 3W7BA 2IBMA 3PG5A 1HYBA 3H3EA 1KKMA 3I04A 4KGDA 2H1CA 4QNRA 5A6SA 3BXGA 1GTVA 2P6RA 4UWPB 2XDQB 4EXYA 3OEHA 1T4DA 1BU8A 1QANA 3MM4A 3QOFA 3G0BA 1KK3A 2OXCA 2PHZA 5ENVA 1K6JA 1QRUA 2EL9A 1EWKA 1JMVA 1GUAA 1I4WA 2TS1A 1Z29A 1KYYA 2F4NA 2OOSA 2J6BA 1G4HA 4YPVA 1HOTA 1R64A 2AJTA 2J9ZB 4NAHA 1AK1A 4PSKA 3U80A 3UWPA 4AW9A 3JVVA 4LJLA 3FPCA 1P2GA 2PH5A 2XCIA 3LOQA 4Q7JB 1X7GA 3FKSA 3C98A 4UVIA 1RWWA 2YJTD 3U7QA 4JXXA 2FQXA 5BSEA 4NCBA 2E1RA 3MCUA 1Z13A 1FX0A 1E5QA 4HD8A 5KYTA 1G20E 1S1CA 1U4OA 4F12A 1J0EA 2JA2A 4ZYZA 1N57A 2D0DA 3GLVA 4MVXA 1HE1C 2NVUA 2RHLA 3NX4A 1PLKA 5NLLA 2IDKA 3PDCA 4PQYA 2DLNA 4ZK6A 3SJAA 4B80A 5I9MA 1P44A 5CD1A 3O4FA 3M4XA 4UM9B 2Q3HA 1HQCA 1GPH1 2RG1A 5F76A 1ZBQA 2I65A 2I03A 3CPHA 2J7PD 3H0EA 1EFAA 2ZLBA 5ALLA 1P60A 3EMBA 3HDYA 3R9XB 1NN5A 3IPAA 4I1OA 2C7RA 4R98A 2B8WA 4AS2A 3TF5A 3AR3A 3DE6X 3P94A 1XVLA 2HQBA 4FU0A 5KWVA 2GBIA 1K8XB 2IF2A 1OFUA 2PT7A 2QJFA 2Z8XA 5KOJB 1E3LA 5LOVA 2P2CA 3PFNA 1L9YA 5TQ2A 2ZRMA 5A87A 1NRIA 2AOWA 3MLAA 4L0MA 1OROA 3L7NA 4L6IA 1L4KA 2GPSA 4QOEA 5T8KA 3TB6A 2UYOA 5ICEA 1HK7A 3LA6A 3A1CA 2CLIB 3EHEA 1X86B 3IERA 1QX3A 3NHYA 4FP9A 1XU4A 3HJHA 2I3ZA 1ODSA 1U28A 1EE9A 1B6SA 2IYFA 2Q49A 3I5MA 4RFSB 5FR1A 4IDGA 4RULA 1VI2A 3EEOA 1ONBA 2CCGA 2ENUA 3LGSA 3ZW7A 1HORA 3STXA 4EVSA 1XP8A 4OB7A 4EFMA 3TX2A 1XMOB 2WBLC 2ATXA 4QICA 4V38A 3MT9A 5DYIA 2WMOB 2B4KA 1IAVA 3DV9A 3ZXUB 4Z6KA 3HZZA 5TQ0A 2O2CA 4PAOA 3IPRA 2G9UA 2G80A 2PLAA 1T9CA 4Q1CA 2VHUA 3F71A 4ZQHA 3KFLA 1EE2A 4Y1RA 1YQXA 2FP4B 4NQRA 2FE1A 2X5XA 4RL6A 5FQOA 1G38A 1MH9A 1O96B 3NUGA 2XQIA 2GCNA 1I2AA 3DZGA 5KTPA 3A4LA 4AUKA 3FAZA 3QU7A 2N9UA 1JJFA 2BGJA 1IULA 3VKHA 4QFBA 4D8WA 3PFWO 3HJNA 4JR1A 3RNOA 2OGUA 3BGOS 3OZVA 2BUBA 1AUQA 2W0SA 1QB7A 4JS0A 3U56A 2VPXA 4LZPA 5DW3A 4B8YA 1CJMA 221PA 6GPBA 3WHIA 4KLZA 2NPOA 3Q1LA 1J0DA 1AUXA 1FUYB 4NJEB 3SN6A 3P2YA 1ZH8A 2P3OA 4DHEA 1KGSA 3ELDA 4HZUA 4MI1A 3ZCUA 1QRSA 4HBZA 1ZXLA 4OVKA 1Y1KE 4YRNA 3MRSA 1GQYA 4NK5A 3VVCA 3GA5A 3ICPA 2PQMA 1JHUA 2UVPA 3ECCA 3K1ZA 1DEOA 2ZJYA 1O6GA 3QI2A 2Z2JA 1RP1A 1KMHA 1O9GA 2X58A 4OX9B 5D00A 5HOQA 2GPTA 1VJ1A 1XDZA 3EULA 2ZAOA 4KLRA 1FRVA 1F8YA 1DKQA 4HLUA 4JVMA 1SQSA 2ODTX 5DMXA 5KNBD 1UBLS 4C1GA 1T91A 2EBHX 3HVKA 1CUZA 3CF2A 4MQUA 1R0CA 3RV4A 5EMNA 2IHTA 2Y1GA 1BN7A 2QN1A 1UFKA 4U5XA 5A4FS 2PSSA 5EIOA 1TIPA 2XE8A 4K05A 3KSDO 4NBTA 2UXCB 2IZ1A 1JYFA 3GEMA 5DYYA 4IKOA 2R4TA 5GAJA 4EFDA 1Y7IA 2JFUA 2OC9A 1XZCA 3PZRA 3R41A 521PA 1TPZA 1YR8A 1X1BA 1EEXB 3WIBA 1E6WA 1T1GA 1Z45A 3F8TA 4AJIA 4OUDB 4MVCA 1BEZA 5G02A 2XYRA 3TEMA 3OJEA 1F2VA 1DIBA 4TKVB 8OHMA 3CEMA 1FTQA 1JMKC 2WT8A 3H42B 4PU0A 4ETWA 3DDZX 4ZGBA 3DNMA 4RD0A 1GUFA 1XJ0A 1OAAA 3LX8A 2BFDA 3F4KA 4BFWA 1JPVA 2REOA 1ZC3A 2P75A 5C4IA 2A0KA 4DMGA 2DVMA 2Q3LA 1ZZEA 1G7SA 3UJCA 2QDKA 4TSFA 3M0EA 1ZGHA 1M34A 5E6RB 2Y9MB 3MS4A 1RI4A 4KI0A 5F4BA 4MW2A 1Y1TA 1D6NA 4P35A 5KQLA 5HQ3B 1NRJB 1XVVA 3G5TA 1HT1E 1M6EX 2Q1XA 4M0PA 1EK1A 2C2WA 5B1HA 4C2BA 3CRW1 3B6JA 5EE1A 4M8NE 1J06A 5ICGA 2LDBA 4L4YA 4BLRA 4ML3A 5C8YA 1E6EA 4H1UA 2G8LA 4G1FA 1VPEA 1TQDA 2ZWVA 3TXYA 3MT7A 2E0IA 2JKZA 3R5TA 1NA5A 2XWJI 3OEED 1M34E 3R2JA 4LRYA 1PGOA 3HH8A 4HWKA 4MVWA 4TN1A 1U0SY 5LA6A 4QVIA 4MLCA 1U11A 1XZJA 5IMBA 1PU2A 3HRHA 4CI9A 2ZXEA 1QDEA 3AFOA 3TNLA 3WB0A 1KDZA 4NQ2A 3MLEA 3B6MA 3JWIA 3VTFA 5IFKA 3I3OA 1AZTA 4FOOA 1XO1A 1H2ZA 5JJKA 1SWWA 3DLTA 3UYLA 3CC8A 1Y7HA 1R15A 1YACA 3TMKA 4QQNA 4F4HA 4RJTA 5B6IA 2XUKA 4QNNA 1UP6A 1XTZA 4GNRA 1G42A 4P3PA 3RRMA 1BQEA 3PUJA 1CQZA 5DKFA 4C6TA 2H4ZA 1HEYA 3LCMA 3SZOA 3AC0A 4RPCA 4AD9A 1VE6A 3AWIA 1DC7A 2C31A 1E9CA 2QJOA 2DPHA 1KHHA 2QY6A 2XCUA 2JI4A 1KZ4A 1LSJA 1UPFA 5LXTA 3CLTC 1PUXA 5HTKA 1MJGA 4UE3S 4PLTA 5DRYA 3BORA 1DP4A 3L0CA 3BH0A 4BGEA 1J2YA 3OLQA 3ZK8A 1RBYA 5A3RA 1S0UA 3BRCA 1QVAA 2AC4A 1T8TA 3WDKA 1HNWB 4AURA 3TRKA 2BHTA 2OCXA 5EW0A 1QIDA 4NATA 2O3JA 4KITB 4H3KB 2QM8A 4YMTA 5IDWA 1T5HX 2QW8A 3LLVA 4KQKA 3UJAA 4CCSA 1RW4A 4N65A 1E2LA 3WL3A 5GY7A 1U1IA 4OFXA 2OXIA 1GCIA 4C7JA 2ZYVX 4NQZA 2O19A 3PJRA 3KAJA 1YB7A 5I7WA 3PQ6A 4HEA6 2CJXA 3LO8A 2Y27A 3QKIA 2E4AA 1HYQA 3IAS1 3KG2A 3CA8A 1I1QB 2XAAA 5ACSA 1XZEA 4HNQA 2ANCA 1JKMA 5DBFA 4Z9BA 1VKJA 3AB3A 4K9QA 5DZSA 3GD7A 4K0RA 5FOXA 4CT4B 1GRCA 3LH5A 1HSOA 5HFJA 4PBSA 4BLOA 3AONB 2FDXA 3UJ9A 5IVKA 4QYIB 4FILA 2OPHA 2H52A 3GRPA 1LTKA 2AR0A 1E7QA 1P1KA 4BFTA 4MKZA 3IP6A 3WRXC 3MMSA 1K0UA 2DC1A 2PGXA 4Q6WA 1X6VA 4DRYA 1JV2B 1ZTCA 2NVBA 1EE1A 4J7XA 4REQB 3DAOA 2YQZA 1QKIA 2D8MA 2WR8A 1Q84A 1YCDA 4JCCA 2LWIA 3VA7A 3GT3A 4N5LA 2GPWA 1TUGA 2Q0SA 4W5TA 3WLNA 4MDYA 3IJRA 2QRHA 3U3DA 2ZYUX 2BEUB 3KAPA 1UMDA 4DLUA 3BN3A 1K3FA 2WKRA 1YBAA 6ADHA 1VB5A 3BCRA 3HN2A 3MT8A 3SPXA 1TAUA 2OZEA 2JFPA 2PD4A 2J48A 4KIUA 2GCPA 4EKIA 4J03A 1TE2A 3VZCA 2GCGA 3HL4A 4G63A 3MTAA 1Q0TA 2AL7A 3X2SA 4Z67A 4KXNA 3NFYA 4C0HA 1ISMA 5JAUA 3OQ6A 5T7BA 3I9KA 4NIMA 5B7PA 1DRWA 1SOAA 1WMFA 2R1TB 3T4XA 4KWHA 4KLCA 3NUQA 2BFZA 4UOZA 3H2YA 1CUSA 3REGA 4G9EA 3PT5A 2IV3A 2H31A 1TF2A 4QC2A 1K3TA 3W2GA 4A36A 1FP1D 2OSBA 1GNTA 3WK7A 5ARCA 3G8YA 2J4FA 2H1OA 5HDBB 2PKEA 3E82A 4DGSA 3KM0A 1WP4A 5MHTA 2H4JA 1DXOA 2GF0A 3AR4A 4EMBA 3FGZA 3JPWA 5C1BA 1OKKA 4J75A 4EIWA 2G3YA 4L4RA 5BVHB 1BGXT 1YNOA 4FJ2A 1OC4A 4HS9A 2ZAYA 2FN3A 3U4IA 4Q1BA 2HXYA 3O47A 2GRJA 4KUHA 4G5YA 4MI9A 1Y34E 1SQ5A 2FN7A 5AI9A 2C00A 2WT4A 4KGZA 2G06A 5E1OA 1GA1A 1WUJS 3D0RA 4R1MA 3RJTA 3ZOZA 4ED9A 4ETMA 5K01A 4EPXA 2YW9A 1UPBA 3HYTA 2PJUA 4G4SP 1YFLA 1RPZA 1FW6A 3PLAE 3AR9A 1Z2CA 1FQKA 1T6XA 3O0TA 4LCBA 3T7KA 4D1UA 1KHTA 2P65A 2V5AA 4ZCRA 4RWZA 3LQYA 3EAFA 3TI9A 2Y77A 2YN0A 3KQMA 4X41A 4ENUA 3KQQA 1Y6FA 4DG8A 1DRUA 2WYHA 3A1EA 2ORYA 3UH0A 2QI9F 3A3YA 1CNEA 1QVWA 1U3VA 2PAFA 3F67A 1XPUA 1I4OA 5EA2A 5DCUA 4I55F 421PA 4IYRA 1XA3A 3WYBA 3ZHBA 1JEDA 3BHNA 1PV4A 3JYPA 4X3OA 1WKBA 1DBRA 3AL2A 1TF5A 2F1JA 3QJ5A 5EUQB 1XVUA 3A25A 1U90A 1PWHA 2O8DB 3JQ6A 1QAQA 4F2DA 1AZLA 3PQ7A 2UYCA 4LGVA 1CZHA 2AC2A 2XNCA 3D8NA 2HIAA 2IOYA 2VZ9A 1ZAKA 1SCDA 2XE4A 2HPZA 5ED0A 5JNVA 1HDRA 3RQIA 1Y8ZA 3SC3A 4DLVA 4DNOA 5CLLA 3GGSA 4QXOA 1G20B 2QMEA 4R1SA 1MZPA 3RS3A 1GNLA 2FNAA 3UATA 2D74A 1YK0A 1SBIA 2QTTA 3V7FA 1T1JA 1K88A 4LZWA 1R4NB 3W8EA 4DIOA 3R3UA 1DWOA 4AMGA 4MUFA 1XMPA 1WHSA 2F48A 3OZXA 4TL7A 2QE6A 2AD1A 2GK3A 3RUHA 1ZI9A 2M1ZA 4CKZA 1A82A 4AV7A 3NHAA 4BNFA 1G5TA 3CW8X 4YJDA 4F9GA 2PGAA 4RA9B 1CF4A 4RTPA 3ZZ0A 1RT9A 4DDHA 4DLPA 3R75A 5LZ2A 1R8QA 1Y4AE 2J9FB 2PYZA 3PJFA 2F9MA 5L8VA 3O74A 1JEYB 4LTNA 1KEUA 1Z63A 1DEHA 4GYWA 4QYWA 4C7XA 4HN4B 4EJSA 4IWNA 3SYMA 2E37A 2ODNA 3CONA 1CHNA 1L7XA 3MQ4A 3NTQA 2GHQA 4I8XA 4RVNA 4ZO9A 4G65A 2DEUA 4P1ZA 2GJ9A 3D7SA 5CXUA 2JCXA 1N7GA 3I5UA 5AJZA 1MV5A 1J25A 1SIOA 4D4LA 2ZAMA 4FVTA 4D5GA 4PXYA 1DBIA 5J47A 4Q3AA 4J1QA 4JXJA 2IYLD 2Z4RA 3VR5H 2NNLD 5ESWA 3P9NA 4CQMD 2CYCA 2OHHA 4JB0A 3NU1A 2HF2A 2RC6A 1OE0A 1K97A 2QB5A 1VKZA 3KOWA 3IUEA 4FI3C 1P2TA 4M9QA 4U7WA 2GF2A 3EVCA 1QE0A 4EL0A 1Z2EA 5TQ2B 1H2BA 4OB8A 4UMDA 1O1YA 4JBHA 4Z0HO 1P62B 3W5IA 2B37A 2XVZA 3F74A 4D3SA 4DJTA 1LRJA 1ZYUA 2KM1A 1L7EA 1YZKA 3Q9NA 2JVJA 2FCRA 3SCZA 2QZZA 5CFLA 4FONA 1PQYA 4YR9A 9GPBA 1PWZA 4EAAA 3L02A 3NNNA 4PFJA 3L0SA 5LZ5A 1IN8A 4GQBA 5K09A 2CDNA 4ZRMA 1C8BA 3OZWA 3RS9A 3OIGA 4XR9A 1TUBB 2PJDA 4BU0A 2FPUA 4Q1VA 1DKPA 1OC2A 4OQQA 2B2XA 2IU4A 4KRYA 2XQGA 3VTAA 2PX8A 1JDZA 2PFGA 3EWNA 1WEHA 4NDAA 3UIEA 3IPYA 4L85A 4QBTA 1U94A 4E2YA 1Z17A 1GPJA 3NMUF 3QE9Y 2LR0A 2H1WA 4FZJA 1M72A 1TYBE 2FSIA 2VT7A 2WWFA 3KEQA 2ONCA 3NETA 3PQCA 5BT8A 1E2IA 1M1NB 1Z5WA 3HRIA 3JASA 3C74A 4A7PA 1L5VA 5DNCA 1G8KA 4PC2A 4U63A 1CEQA 1K2WA 1EX7A 1VE9A 2IYQA 2PBRA 4JJ7A 3DL2A 4M1SA 4Y6PA 5F12A 5FI5A 5HE9A 3RS5A 1DIGA 2RAPA 2AFRA 2Y1WA 3C3KA 1HQYE 2L2QA 3HXTA 4LC1A 2C7QA 1I4LD 4AULA 1N25A 1JQ3A 4WDRA 5AUPB 5C1PA 1SVOA 4N54A 5K0LA 2ZUUA 1KY5A 3HKEB 4BWFB 1LK0A 3VU3A 1RKUA 3D8SA 5J2UA 1FNMA 1Y5IA 4QXQA 1HSZA 4KMSA 4BJ5A 3TX6A 1N8SA 4ARIA 3C3XA 4LNUB 2OV6A 4DA7A 1CR1A 1YJBA 1KMHB 4NEGA 3UEOA 5LZ4A 3TRIA 1S7CA 3HDQA 4L8WB 1KVRA 1OREA 2JFOA 4EHFA 4UEOA 2FQWA 4HRXA 4BCDA 2XUZA 4HDSB 2NU7A 3R09A 3SF8A 3RTCA 2NZ2A 4BFSA 1IUOA 3STUA 5AT1A 3U3MA 4GUDA 1PKEA 1J2JA 1CS0B 4ARVA 4S2EA 1H0HA 2EC5A 4WHMA 3BHJA 2OGWA 4AJHA 1P2FA 3R4CA 3HSKA 5K6AA 3CM0A 4HEQA 5H02A 4JITA 4E5KA 4U8GA 3S1SA 4NECA 4CDRA 2NOAA 4V0QA 5MFZA 2QM3A 4W5OA 2VPPA 1R12A 4MA0A 3R0XA 4URWR 5IAGA 3RCBA 3M1IA 4AX4A 1H2XA 2IZ7A 3QIVA 3FNRA 3GMTA 4IIVA 1O89A 1WDLA 3TTVA 4OHMA 3TKLA 2OLJA 3DEFA 2E89A 3PTLA 2BFEA 4B81A 5EXTA 5LQSA 3PGVA 2PANA 2W00A 1HE4A 2PKCA 4FXPA 4H3HB 4N6OA 3QVXA 4QQFA 3PC8C 1JE1A 2XA9A 1EWYA 4P6VF 5HCUA 4W5NA 3AXTA 1BE1A 3OD5A 2ODWA 3KDPA 4GLBA 2RD2A 1T36B 4C89A 1J39A 2FPPB 1V7CA 1YGYA 3EASA 3OBIA 1KH2A 3LAWA 3DWGA 5JTUA 3CX6A 4RAMA 2YXDA 1W85A 4ZP1A 4LDAA 2FFJA 5IS2A 1FXWF 5EZYB 2O7QA 4BB6A 2Z6AA 5IAJA 2Q5QA 1HDCA 1N6IA 2PX5A 4IEIA 2DWCA 1PR0A 4JD5A 5J5CA 4X65B 2PX3A 4NCHA 3BXEA 4YHBA 1IBKB 4RJJA 3L1VA 3K9LA 4K9SA 3BZUA 4BO6A 1U2PA 4KNWA 5F4ZA 1RMYA 2BZ1A 3MTJA 3DZDA 2NXNA 2CN1A 3D54D 2VQ3A 2AVDA 1QF7A 3DC7A 3ULKA 2NIPA 2ZIWB 2YWHA 3ESDA 4H0FA 5F5XA 5FOUA 2O2IA 4Q15A 2WFAA 1TJPB 5HW0A 2LW7A 1U6JA 3PFIA 4MS1A 2FZWA 1ODLA 2UZAA 4XGNA 3TLJA 5KU1A 3PUIA 3ER9A 3ESAA 3UG6A 1M76A 4LZLA 4EHNA 3U40A 3IBSA 4H6WA 5J5VA 1T8YA 3KKQA 4ND7A 1C80A 1CUGA 3IC5A 3ILYA 3U26A 2IXFA 3RYTC 4UOEA 4ER0A 5KDDA 1M2OB 4JJZA 1DXHA 3DV0B 2Y1DA 3G2QA 4O2AA 1QH1B 4AUEA 5JSZB 5ALDA 1IHPA 2DWUA 4EG3A 5LSAA 1ISHA 4FEAA 2P4EA 4II2A 1OU4A 2VWGA 4Z9FA 1OFGA 2QK4A 3QOWA 3A9VA 2CNBA 3P8ZA 3ZWCA 2YIDA 2XDAA 4EJMA 4DARA 4XRGA 3ZGNA 1FSGA 1QWOA 2JANA 3I92A 4LYFA 4XVUA 4HQFA 4REOA 1J2TA 1L7BA 1PFGA 4TZKA 3GEPA 4NBKA 1K7YA 3FCOA 5IC5A 2J3MA 4EDHA 5A62A 3DCJA 4KOAA 5IWCA 5LM6A 3RRFA 3KQYA 1O95C 4UXJA 4D3DA 5J1SB 1H0KA 1ODJA 5HQTA 1V35A 1L5QA 3WX0A 2AXPA 4XJVA 3ET5A 3WICA 4KR6A 2A86A 1K9VF 1JVSA 1U9IC 1VHTA 1P4AA 1X1TA 2VJLA 3LIPA 4DVGA 1HC7A 2JGJA 3O1LA 3NQ41 1YRAA 4X93A 4YR7A 3WFZA 4WFIA 1UADA 1P75A 1I7LA 4LE2A 2DZDA 2A7QA 1XZGA 1W6UA 3AF4A 2I2CA 3QELB 1GSAA 2IYSA 3W9YA 1YQDA 3ZWVA 2TMYA 5EZYF 3H5OA 4EO7A 1HKUA 2P9QA 4QWMA 5K8LA 4D4IA 1LGYA 4MDHA 4X54A 2E2WA 4RLFA 1UDWA 4KHPB 4S24A 3L8CA 3BMQB 4NCIA 5DNVA 1Z12A 4KI7A 2P40A 1C9DB 1BVTA 4PF1A 1PNOA 3I42A 4A16A 3ADRA 5ITSA 2WJ3A 4MQFB 5CH3A 1HG0A 1KRHA 4FCWA 4FLMA 1XI2A 5F2EA 2RGWA 1A98A 3H5LA 1A9XA 5LA6F 5LB2A 4UBLA 4KQ6A 3GHYA 1VSQA 3NVDA 3AY7A 3D81A 1T5SA 3K5IA 1CUJA 1JDNA 2WJYA 4RTNA 4XE5A 3THYB 2GLXA 3EBPA 3USES 1WW3A 4MP6A 4BQEA 1PV2A 2ORIA 3VAZA 1NJ8A 3LC7O 4GIBA 3GCXA 1IM2A 4ZO3A 3J81A 3EQ9A 3I4FA 1N32B 3T4PA 4ZARA 4H31A 3EC1A 2NU8A 3DE7X 3B20A 5I4BA 1G8YA 1U7XA 4GI1A 5DN9A 1BOOA 1LJUA 4MWCA 2XUAA 1NW6A 5DIZA 1PD1A 1VHDA 3VX4A 4PZDA 3MUNA 5LXTF 1U8CB 2ZITA 3GELA 4ZTZB 3KL2A 4Z8YA 3CVXA 3ZWMA 1YONA 3U61B 1ZA2A 3KQUA 2D4AA 1AGXA 1IK4A 2PCJA 4OXRA 1PVDA 2X8JB 1SC3A 3N3BC 1Z0FA 3U3KA 1CDDA 3UUWA 2PUWA 2VJOA 3JYOA 4YY3B 4DV2B 1T8UA 3X1DA 2DWPA 4TWIA 4QO8A 2EZ8A 4KNYA 2IKQA 2E55A 2GHTA 2PGDA 3JAWA 5EUMA 5AVJA 2PMEA 5INTA 4LX8A 1J20A 3D6VA 2HN9A 1F14A 1Q77A 2UYGA 4P80A 4QBFA 4B6GA 2QAGB 3EAGA 3MINB 1R6UA 4JJEA 3MTEA 1ZN2A 2XYGA 1FDVA 1MC4A 1XIVA 2QTVA 3JQGB 4JEHA 5D3QA 1QKKA 1Y6ZA 3E2IA 5DM2A 2NXCA 3U44B 3TMAA 3HACA 1ONNA 3IVAA 5KKAA 2P4ZA 1QCZA 3B53X 3RFFA 4EGAA 1YFJA 1M2XA 4BQSA 1HR0B 2H08A 4TZTA 4JLUA 3GFRA 2FM6A 4FBGA 4XQ0A 3ZKAA 3FYSA 3ZBUA 5IJAA 3FTDA 4G0NA 5TS3A 4RK5A 1NHGA 4F2WA 1QFXA 1FZTA 1GGEA 1BWSA 4M0KA 2QVGA 1ZL2A 6CHYA 3HBJA 1FMFA 4FYYA 4F7WA 3WJ7A 1L4HA 1U0BB 1JXAA 4C7VA 1N3LA 2Q4RA 4EMSA 1FNBA 3HJUA 1GZUA 1PLJA 2Q5FA 2Z30A 4KC0A 4L2IB 3HVRA 2AMYA 4MVYA 4KPYA 1TB4A 2C9DA 1IXZA 1B8NA 1TYEB 4EQ6B 3KK0A 5B1UA 4Q05A 2QPLA 5A3QA 2P4SA 3E4DA 4DR2B 1FOEB 5HHTA 3ASUA 2EJBA 2H2WA 3BQNB 1D8TA 3P9SA 4F8YA 4HYTA 3VHRA 5HIAA 4I8IA 1VG9B 4DLSA 4P4GA 4CIDA 3C4QA 4ME6A 2J6CA 4DIFA 3N2NA 3CLHA 4BO3A 3E1SA 3U3ZA 2C96A 4WV3A 2C8LA 2GLTA 1SY7A 3OVMA 5B7NA 2XMCA 4TSRA 3GFOA 1PD0A 2PZ8A 5E9AA 1UBUS 1D8AA 4YSBA 4OL0A 3M4JA 1QFJA 2FRXA 1PT7A 1D2HA 5DF1A 3NTOA 3DFZA 4RSRA 4CKCB 3WRWA 4I9HA 4YVFA 2DFNA 1SIBE 3NBKA 2WYOA 2WJPA 1H6BA 1P4RA 1RQGA 1AU9A 3EXIA 4JLDA 4PG6A 5IWAB 4LYEA 4GX0A 1PT9A 1GDDA 1BHQ1 3DVAA 4B3BA 5K3DA 1AE1A 1C2YA 2WPDA 3UJ8A 4BLQA 3G1PA 1EU1A 1YZQA 1XPOA 1NW4A 3RJZA 2FLWA 4X7PA 3DH8A 4ZT7A 4CG0A 3EGXB 1KJIA 3U3RA 3KAQA 4JIGA 3V8RA 3S5UA 2QL5A 1GZ7A 4B35A 2XMRA 4OA5A 3E22A 2YZGA 3MERA 1E1CA 3B3AA 1CDOA 2COKA 3S7TA 5JW6A 5L95A 2IZ6A 4PYMA 5I8ZA 4N03A 3K7EA 5BSRA 5FWXA 2Q9BA 2VP9A 3GMSA 5HJ2A 1M6WA 4ZYVA 5FIUA 1J22A 3MW8A 2GTHA 2VDOB 2CFTA 4YRLA 2Q8QA 5DBOA 2ZI7A 4MV9A 4NG4A 4X24A 4OB6A 3NKLA 2W5UA 5FTMA 3ADOA 1QLWA 4P7FA 2JCYA 3Q98A 3DDWA 1G8MA 2C57A 2YH2A 4EFZA 2ZRFA 4W5QA 2WJHA 3FWPA 3SXUA 5A0FA 3FF1A 2ZB8A 4FS8A 4JLWA 3AY0A 3O8NA 4KGVA 1GEGA 3SYRA 3ABIA 1RFLA 4BMZA 4AKEA 1RZUA 3DMTA 3MWGA 3IKLA 1G5IA 3D0QA 4H7EA 5IKOA 5BOSA 4IRMA 3MSCA 1OLXA 2BR6A 1PR6A 2B9VA 1WE2A 2G4LA 3ANTA 3OKCA 2JK1A 4MHOA 3NEJA 4EK9A 2FXVA 5HOEA 4PVCA 4UEQA 2CZGA 2C5LA 4RQBA 1TMYA 3IAS6 3C3AA 3U3OA 2I7TA 2Y4NA 3H75A 4K9LA 4COKA 2BEJA 4TL8A 4MR8A 5CT6A 3IE1A 4WMLA 2JFZA 3T7JA 1PFYA 1TQHA 2C03A 5FAKA 3RRNA 2BMVA 4V3CA 3FI9A 3GDFA 2DPGA 2NWQA 3GMIA 3L4EA 1VYTA 4N0DA 4UC0A 3WQSB 4P3KA 1IIBA 3QV1A 4EKDA 5FBLB 3ZEAA 3EA5A 5FBQB 3FTNA 3I9LA 2HIGA 2NO1A 4M46A 4OKIA 4J2TA 5FPHA 1YFKA 5HISA 4DA0A 3LL4A 4RHXA 1YR7A 4XYBA 5TNXA 1VE3A 3TD9A 1USIA 1Z2AA 4GKKB 1T1SA 1POWA 4TOIA 3K70D 2Z1MA 3IBTA 1DCTA 1QK4A 2B8NA 3LF2A 5JXGA 4I6GA 2LE0A 5B1DA 2H2DA 1AKMA 4Z7OB 3DVRX 3F7NA 2FLVA 4AKIA 1ND6A 3G5AA 4Y9SA 5KNDD 3OTOB 2EARA 1VSUA 1GL9B 1YR2A 1NM5C 2EF0A 3D4BA 4A91A 1P4GA 2GA9A 3L7DA 4AI6A 3JASB 2VH5R 4QUAA 4Z8XA 4BJ3A 4RGYA 5FJJA 2WYLA 3OM9A 4M99A 4HN9A 1WLYA 2AYZA 2XKBA 5IG2A 2ZSHA 3FDZB 4CMCA 1DAFA 4CMHA 1B74A 3OZGA 1U8XX 2CFRA 3FYUA 3DA8A 1FK8A 3H7IA 4LGMA 4RD3A 4XQEA 4LZOA 2YXBA 5KHOC 3TK1A 1PEAA 1JQBA 2JGEA 2FZLA 1BMFA 3UOWA 3G13A 1NI3A 4OY3A 1M1YA 4EI7A 1VPDA 2Q2NA 3P9ZA 4C1NA 4LBZA 1V7ZA 4NU0A 3I64A 4E11A 2CMDA 3IOGA 3NH9A 5EXPA 4RL0A 3T1VA 1A2KC 1VJNA 3BB3A 3A36A 1WM1A 2DFTA 2F2TA 2GWRA 3RAPR 5IVIA 4RABA 5JV5A 7REQA 1C9YA 2AN1A 1KPGA 1WQ4A 1XYYA 2BF7A 2BLNA 4B6RA 5GJCA 5T5QA 3ANXA 13PKA 3H2SA 1EQ2A 1U2TA 1KK0A 2A3NA 3FDIA 4IM7A 4O8CA 5BVGB 1OXVA 4R2LA 1DJMA 1VSBA 4ND3A 3T5MA 1K1EA 2N1MA 2WSYB 2WNHA 1TKAA 3RFVA 4GH5A 4EEZA 5GJBA 1G55A 3RWBA 3CWCA 1FIUA 1N5JA 2HGZA 4UUPA 1J1UA 2R00C 2NW6A 3T7AA 3I8SA 2Q2WA 3KWJA 5IBRA 4D97A 5SZKB 3CUSA 3EGWA 4MULA 3L4BC 4AF7A 5JC8A 2GPJA 3IMGA 1ECLA 3HY3A 2FRVA 3LVRE 1B0UA 1WO8A 5H5JA 5DOZA 3RSQA 1V5EA 2I71A 3IUMA 3S70A 1Z82A 1SU6A 2HDHA 4M8SA 4OM8A 3T12A 1I7NA 3BICA 4AYXA 4Z4CA 4FK8A 1D1QA 3GOQA 4Q7QA 2AE1A 3L8DA 5FEUA 2Z4SA 3WFIA 1MB9A 5C8XA 1JILA 1Y5NA 3BGDA 2EBWA 1W581 1AK2A 3D3EA 4KRXA 1N1MA 2W6QA 2VJMA 1N5LA 1AM4D 4IS2A 4PGFA 4LV5B 2JJ1D 2ZRQA 3M4ZA 1SCUB 3DZIA 3KQLA 4G0WA 1BKYA 2WHGA 3Q4GA 2X9NA 4TKMA 4JP2A 5ADVA 4X5OA 3K9GA 4X8LA 3RTDA 4Y6OA 3Q7QA 3SQDA 2CXHA 2DUJA 2WWGA 1I6KA 4XIJA 3ZBQA 3ZZUA 2B5OA 2RIPA 4RKQA 2YQ4A 5KX5B 3DW1X 1BWQA 3AB7A 4DV1B 3UHFA 4FIDA 3GUCA 1EDZA 4O5OA 3RPEA 5GZ1A 1Z33A 3GX1A 2GHIA 1W6RA 3ITKA 4HDKA 3LX6A 4QU5A 5BNTA 1NR5A 1OYWA 1ZZGA 4AZ0A 4D9KA 1UK7A 5JBQA 2RHDA 2WLTA 3M89A 4FEYA 4TM7A 2HBZA 3RAJA 1HTTA 4D9NA 5FUXA 2VWQA 3W05A 5BN3A 4JYBA 5KDLA 1OFTA 1SBYA 1H65A 1N4DA 2VH2A 3FX2A 3FUCA 3U39A 5K20A 5KZMB 1SXJA 1H0SA 1EZ1A 2XMBA 3EODA 4DA8A 4V1CI 1FJXA 3DFIA 3GARA 1TYZA 4F45A 1G9TA 1YE8A 2F64A 1B3BA 2GAOA 2PZEA 4QDXA 1H93A 1U1CA 4TQ9A 1Q15A 1I5RA 1ZIYA 4PWZA 3V6MA 2NT4A 4O4JB 1RJ9B 4IHQA 2F1RA 4BFCA 1RSZA 1FYXA 3E4CA 3HVIA 4N7BA 5D1HA 2DFVA 2I76A 3R77A 4NH4A 4ZHQB 1I4EB 1UAGA 2YVLA 2BDUA 3H1TA 4JHXA 3WL4A 3RIGA 1XKLA 4D8VA 3U7IA 4N48A 1F3LA 2F3TA 2HOQA 3AZPA 4BO4A 4Q7EA 4R8KA 5K3BA 4D6XA 1SXJE 5FWDA 4DM3A 4DANA 3K0BA 1F4PA 3LPDA 4MEAA 3PI7A 4ZTBA 3EB9A 4AQYB 3PUYA 3BTUA 1TKRA 1A9RA 1IDN1 3SZUA 4X85A 4MQEB 1OI2A 4I0WB 4LDQA 2GEFA 4UZEA 2BG8B 2G77B 2F17A 3GCDA 4XJXA 1NNI1 2BFFB 3BMNB 3RTBA 1JHMA 2QRQA 3L6OO 5GPBA 4BDSA 3HJFA 4JLPA 5DTMA 4D4GA 1AO0A 3FUXA 3PFCA 3R0ZA 3PX2A 2PXAA 4CIBA 1GNVA 4OJMX 3VKFA 2MCFA 5ELXA 4TXHA 1P6UA 4OV6B 1YJQA 2EWMA 1YZTA 1MT3A 4G5GA 1YVEI 2F1OA 4LKOA 3WTCA 2G5CA 3H9JA 1LNQA 3RUEA 4PLGA 4W5RA 4TZFA 3PD1A 1NLFA 4NS4A 5ALPA 1FC0A 3HI6A 4A8JB 2P2NA 5KX5F 1X0VA 4G1CA 4HSGA 4NCNA 1B3RA 5DNDA 3TGPA 5DFAA 5IJWA 3QF4B 1U2GC 2R7KA 5TDHA 5EXXA 2ONJA 1NVGA 2H7XA 5DP2A 5IRCD 3CJTA 3DT6A 1ZD2P 3SKYA 3P2UA 2BBSA 3GLIA 3H1BA 4CIYA 3QKTA 5DW0A 4RETA 1HE2A 2XWSA 5D1NA 1S02A 3LC0A 5BQPA 5H83A 1A9XB 3EGVA 2YJGA 1XF1A 2ZUDA 5K3FA 3F4LA 1MEEA 4FR5A 4MV5A 4RGBA 4PBTA 3C2QA 2FG7C 4A8HA 2GEDA 5BN3B 5ACVA 1R18A 2AN3A 4N3CA 5KWIA 4GHWA 4OLAA 1TVEA 3BE4A 1T9ZA 3HBNA 2WAMA 1TUIA 3S27A 2JI6A 2RGNA 4IFEA 2AFVA 4LI0A 4YV2A 1XZDA 4HGNA 2XXAA 4L6AA 4XQ9A 3T4UA 1EJBA 4ZOLA 2OB1A 5FOTA 2QMUA 2JLCA 4JQZA 3GLIE 2O07A 4YRMA 2NU8B 5LD2B 4DT1A 4UQLA 3LC1O 1JPNA 3PF9A 2ZK7A 3QVSA 2AOTB 4PSUA 1Y4SA 4U6SA 4A2QA 4IDEA 3A4NA 3NKVA 4V2UA 4LQLA 2O8EB 4RTKA 2O8CA 3V8BA 3DFFA 7REQB 2FMKA 3HWRA 1JECA 1KMMA 2ORWA 2IHJA 5AHRA 1GTRA 3UH1A 2N75A 3LDAA 1IB6A 3G7UA 1H9BA 4ZVQA 3MUOA 2UVDA 2AMJA 4JFAA 5JMOA 3A2LA 2MT9A 1NFQA 1QONA 3BC1A 1KQOA 1NTRA 1VLVA 2FSVA 2ZTUA 2ZBDA 1ZUIA 4KAXA 1NUAA 3MWYW 1ECPA 1RWOA 1Q0PA 3N76A 4F2PA 4MRRA 2HI0A 4RTOA 1ZJZA 4NHOA 3VU9A 1HRKA 1PGQA 3EWSA 2BRUC 3GZNB 5HK9A 2WQ7A 2NSJA 4L8VA 2B8EA 2OHIA 1SVNA 3OX3A 1E9VA 3RLIA 5HSGA 2NP6A 3HEBA 2JLWA 5K4KA 5COBA 5AVTA 1KGDA 3KUXA 2H1RA 2GAIA 2E6UX 4NSNA 3N2IA 1WSBA 2NPIA 4WRRA 5IBQA 1L1QA 2R8EA 2Z95A 3H11B 1CJSA 3ZD9A 4F0JA 2JHPA 2QRJA 1PYDA 2WJJA 2YIVX 4CDGA 4DCPA 1Q7EA 2HSWA 1USGA 1MU0A 1T4MA 4EGJA 2OM2A 4GMKA 4Y7CA 3GLQA 3U1TA 2LPMA 4H1VA 4IHJB 4ZJUA 2ZYGA 3ZWNA 1RXSA 4GYUA 4WLEA 1FPQA 3JS5A 1KVTA 4OKNA 2QUZA 4JYPA 5GQSA 1W0KD 1GA6A 3VDRA 2G07A 4Z5YA 5LJLA 1SBCA 3JAKA 1GTG1 1JWBB 3KDAA 2FPWA 2V65A 2OQRA 4G81A 3TQRA 2YHIA 1LBQA 4RMHA 1LX6A 5FD8A 3CF6R 5I01A 4GYJA 1ULZA 5IKPA 2TMGA 4QT0A 1UFOA 2DUUA 4Q9DA 3HYLA 2R2GA 3WLQA 1RRVA 2HUNA 2QD2A 4I3HA 4L28A 3UK7A 2FPGA 2OP1A 1T2NA 4WK0B 5FF9A 3T3EA 3M3PA 1KZHA 5GOZA 3OMLA 4BCCA 2OA0A 2YQ5A 4DUPA 4B0PA 2HWXA 5J1TB 3V4SA 4EGCB 1APBA 2RHOA 2Z8YM 3ESHA 4JI8B 4BTLA 2GXSA 5D01A 2R8BA 1FTWA 3NHUA 4Y2TA 2YZ2A 1LFDB 2NG1A 2DQKA 3WXBA 4UHBA 3ZGYA 1BVYF 3TGLA 3ZCXA 4XYEA 1A9QA 2HSZA 2BBWA 4HAUA 2BPOA 4K9OA 4D3XA 1LV7A 2NU6B 3WK8A 5EC8A 1CY7A 2DF8A 3C8HA 1DBPA 1L5HA 4N3BA 4D25A 5LQUA 2XZLA 5C46F 2QN3A 3HC7A 1RYNA 1IBMB 4MKRA 2GM9A 1RRMA 1SXHA 3IUBA 3SR3A 2AG0A 5IAAA 1PGJA 3LE8A 4JUFA 4CLXA 2VTBB 4JMLA 3U31A 2QT0A 3FKSD 3KV1A 1U7HA 2C5AA 4TVOA 1PNQA 3GEHA 3R4VA 4G4IA 1RRKA 3LFHA 4DV7B 1KJYA 3AR7A 2H92A 2OO3A 2WF8A 3V1NA 1ACJA 3E9DA 1U0EA 3DB2A 3KTDA 5B3RA 4ZMSA 4HXEB 3BFKA 3G6KA 1XRNA 3MGAA 1NPTO 5CX1A 4EPWA 1YC2A 2A7XA 2Z6VA 2I1WA 4PC6A 5CFRA 4G23A 2W6JD 2ZIFA 4POAA 2FEKA 4IHJF 4G97A 5EL0A 3W2EA 5DSXA 2E6KA 3QNUA 1IUPA 3VR5D 4JUBA 2XGGA 4C4AA 4YWHA 3LXXA 4GOMD 4M55A 4C09A 1GNRA 4E7PA 4DABA 3LBAA 2VNIA 2R25B 5JZMA 3OM0A 3KSAC 4RA6A 5FBRB 1C7JA 1UK8A 3FPEA 2X0FA 5MDHA 1K06A 4PW0A 5GONB 5JYEA 2PTHA 5K03A 3B3GA 5LJIA 1PG2A 4C4TA 2A1TS 2C29D 3VR4A 2WAAA 4YAGA 3HDHA 1RAGA 1LPBB 2C07A 3H9UA 3SHQA 1NBMA 4MJ7A 1GGMA 1U3WA 4O1HA 3NCTA 2TYSB 4CLOB 2WU3A 3ZR9A 4FYIA 3WY9A 1QJ4A 4DAOA 4INJA 3TLGB 1LCIA 1M0WA 2B8JA 3AKDA 3UB2A 2WHQA 3EZ6A 1HLPA 4J0CA 4MVJM 3R7WA 4PZCA 2OHVA 2P2DA 3UMGA 4A23A 1T3TA 4BU1A 3T9MA 2P9EA 1DC4A 3HKCB 3E70C 1RXVA 3ITDA 2PLWA 4J29A 3OCUA 3ORRA 1QH3A 4BZXA 4GLLA 3ELWA 6ABPA 1YVUA 3JQAA 4BASA 4YRSA 4MGHA 1M7BA 3TQHA 4FSHA 5F3DA 4W7IA 2LIVA 3TNDA 4GR9A 4IIXA 5BYAA 4NAVA 4FEEA 3VR0A 3ZWFA 1N2JA 2ZB4A 3QEBZ 4QFDA 4UAGA 1F0PA 1LY1A 4G0YA 1PW7A 2L69A 2YHSA 3DMYA 5EKDA 3BSFA 4L4SA 1E7SA 5IJ0B 2ZR8A 4N39A 5CIYA 4L02A 4C0BA 1NIJA 3RSLA 4CEIA 3GGJA 1YVRA 1TM2A 3KYDB 4JP1A 1Y3AA 1GO2A 4CLDA 5AK5A 1XRPA 5F1KA 4XI9A 4RYLA 3FXAA 1LBSA 3HVUA 2WJAA 4EZBA 2L17A 2P78A 1U2SA 3U4QA 1DAMA 5BV2P 4E1BA 2WV9A 3A7DA 2W22A 3FWNA 4NV3A 2JIZA 1ZGGA 1NI4A 3P2MA 3ZE6A 1TYCA 3U7EB 5C8DA 2CJPA 4FS3A 4QAJA 3FMOB 1ZKMA 1HH4A 1S2OA 2JGMA 2HCFA 2MSDB 3IOCA 4F60A 1GTSA 2PV7A 2C4TA 3ADDA 5JSKA 3RS2A 1E79D 1A7KA 2FWJA 4GDFA 2A9FA 1SOVA 2ZSFA 4IJ5A 4L15A 3RHZA 1CZUA 3UV6A 4CEJB 2V45A 4JCOA 2QRNA 3ROKA 3L6CA 1UDCA 2XUGA 5BQFA 1XTQA 1B26A 3GYGA 3QJGA 4GZ6A 2AQ8A 3SMVA 4DLXA 4KNVA 4L6CA 5FYDA 1DJNA 2ZIUB 3MBIA 1C1DB 1UBOS 2WP8J 4BE9A 5C1OA 1KXJA 4WD6A 4TGLA 2D0PB 2W2PA 2Z9CA 3GEDA 3ETDA 4LWPA 4HNUA 3IJEB 1DTWA 3CX3A 1ZJ6A 2IPMA 3ZD8A 5EPUA 5L7YA 5G4LA 3KB6A 4QRHA 2HA4A 2K87A 3N3AC 1IOLA 4R0VA 4N76A 1E89A 3O8OB 1NQVA 5IARA 1ABBA 4KXLA 1ODTC 2A4KA 5EQJB 2AFIA 4P3XA 2W11A 1YZVA 3TM5A 1GZSA 2QTMA 1GRQA 1XXLA 1QRTA 1FDTA 1EA5A 2Z5LA 3A1TA 3BJIC 1ZGCA 3DB1A 4YJHB 2IUFA 3RFUA 4BRZA 2V6BA 5A5GA 1XDWA 4NPAA 4MAAA 5D86A 4ACAA 4MR7A 3NUZA 4MCHA 1TD1A 3F90A 4P3YA 1RXUA 1D9XA 1JFVA 1CRZA 3FLMA 3NHRA 1NJ6A 4MLDA 4FFBA 3AETA 4P36A 1HE3A 5SZHB 3HDGA 3TZKA 3PPVA 4FT2A 1XRRA 5HNKA 3ADCA 2EDAA 2AE2A 2DUNA 2HEIA 2PVPA 3GEGA 2G4VA 1ISRA 2AGVA 3KT8A 5FTLA 3IL2A 2CV0A 1J23A 1R0WA 5K0NA 3DKKA 3RHSA 5GM1A 3TRJA 3IEVA 2Z2XA 2AFIE 3Q9UA 4ZKDA 1V9SA 4EVRA 3ET4A 3W79A 1AQIA 1O2DA 2J3EA 2WYUA 4MVJG 3CE6A 4XA8A 4BP9A 1P7YA 2YMLA 3UANA 4M60A 1KYQA 5C31A 4NKRA 3AYXB 1DC8A 4KQ9A 5CLGA 1NN0A 5KYKA 3OU6A 5LDDC 5LQNA 1LC3A 3BCUA 1L7MA 4HDKB 1QZ3A 3AP1A 2P0AA 3NIBA 2C2HA 2QW1A 4JXKA 2D7JA 4U9IS 2XMPA 2EFHB 1EFRA 3HB7A 3A3KA 4XIFA 2WU1A 2P2SA 3FH0A 3T7IA 3NOQA 3QMMA 4MWGA 2GT1A 1SXJB 4YJ2B 1YB5A 1RWBA 2OFXA 2HSJA 2ZS7A 3EWIA 3Q0EA 1EVKA 1OZFA 4JJKA 1TKCA 3S1AA 1H2EA 1YH3A 4UDXX 2IWRA 4JYAB 1NHWA 2H4YA 2XLCA 3PFHA 4R9VA 2GBLC 2P5UA 1C3EA 4IGFA 3UHAA 4EG5A 4AXHA 4TMKA 1F0KA 2X8AA 3MD9A 3H8SA 3RIXA 3DV2A 3IMKA 2G76A 3R3VA 3EH1A 5FNZA 4ER3A 3WIDA 1C41A 2YMQA 1FBTA 2OCKA 1O4WA 4B76A 1QG2A 1SXPA 3JD2A 4YMWA 3KL4A 5T4HA 3RS0A 5D7NA 4B8WA 3GJTA 1PS0A 5CGQB 3TTWA 3EW7A 3IILA 5CBPA 1E3WB 2K4MA 3B85A 4V24A 4IMJB 2YN4A 1PZXA 1YIDA 4WY8A 1YZGA 2R6FA 4YJ3B 3BJRA 1SK8A 3QBJA 3VBCA 4W9MC 3IT3A 1WR8A 5KOIA 3JWJA 1I01A 3H8VA 3WBBA 1IZ8A 2Z56A 3OJFA 3PNSA 3SJZA 4FSXA 4NMXB 2OECA 4BO1A 2RBKA 1IXKA 1U3CA 5EXSA 3TD6A 2GB4A 5DM60 3L7JA 4Q5IA 5DSZA 1XRJA 3A26A 2OO7A 3AUYA 4YPFA 4LF8B 4H4EA 4NQ4A 1OV6A 2HK9A 2JKVA 3KKKA 5E6UB 1TT5A 3SR0A 1UFQA 2HY7A 1ZHOA 1LNZA 1SAYA 4BB0A 4PXSA 1E0JA 4W1QA 1RWKA 2BMDA 2VDWA 3EIUA 1K66A 4OBXA 4G89A 1ZRSA 3A06A 3SHWA 1ECFA 3HJAA 1I3MA 4I9FA 3JYLA 1K8ZB 1TVKA 1KO5A 1NP7A 3FWKA 2BP7B 4RV4A 1UMCA 5IU6A 3RH0A 3NW9A