5EH9A

Indirect contributions of mutations underlie optimization of new enzyme function
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
253
structure length
253
Chain Sequence
GHMATVKKLYFVPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIETEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords N-acyl homoserine lactonase AiiA
publication title Conformational Tinkering Drives Evolution of a Promiscuous Activity through Indirect Mutational Effects.
pubmed doi rcsb
source organism Bacillus thuringiensis subsp. kurstaki
total genus 81
structure length 253
sequence length 253
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5eh9A01
4B87A 4D1WA 4YSKA 5LMCA 2I7XA 2GFJA 4D1VA 3SW3A 2QDSA 5K4MA 2BFLA 1P9EA 5FQAA 4J5HA 1X8GA 4EYFA 5IQKA 4CHLA 1KO2A 4D1UA 2YNVB 4NQ5A 5AXRA 3P2UA 4EY2A 4KEPA 4DIKA 5HH6A 5K4NA 3KNRA 5KILA 2BG8B 2Y8BA 1QH5A 5EH9A 5EVBA 3WXCA 4F6HA 5ACXA 3VQZA 1JT1A 2BGAA 4C1FA 3DHAA 2P4ZA 2NZEA 5B3RA 5ACPA 1QH3A 4C1HA 2M5CA 1YCGA 3Q6VA 1KR3A 4AWZA 3ZWFA 3ESHA 2Q0JA 4XWTA 4YSBA 1WUOA 3X2YA 5A5ZA 2BFZB 2BC2A 2Q9UA 3PG4A 2QJSA 4BP0A 4D1TA 4P62A 2OHIA 2QINA 1SMLA 4D02A 4TYFA 4Z6XA 4TZFA 5LLDA 5HISA 2BTNA 5A87A 2DOOA 3I11A 3LVZA 3S0ZA 2M5DA 4KEQA 2YNTB 3ZR9A 2YNVA 3FAIA 5EV8A 3BC2A 4GCWA 1WUPA 1WW1A 4NQ4A 2FM6A 4XUKA 5AHOA 2ZZIA 1JJEA 5HH4A 3F9OA 4ZNBA 1L9YA 3AJ3A 3IEMA 3BK1A 3SD9A 4C1EA 3ZQ4A 3AF5A 5AEBA 3JXPA 3RKKA 5HH5A 2FK6A 3G1PA 5FQCA 4AWYB 3MD7A 2WYLA 2WHGA 5KIKA 2FU7A 4EXYA 4BZ3A 4C1DA 5HIPA 2VW8A 3R2UA 2I7VA 4EYBA 1VGNA 4RL2A 5EWAA 2XR1A 5A0VA 1A7TA 2FHXA 3X2ZA 2Q42A 3SPUA 5LSCA 4NQ2A 4PVTA 2DKFA 4EYLA 1BC2A 4YSLA 4C1GA 5LCAA 2YNTA 2GKLA 4V0HA 4AD9A 4HL1A 3IDZA 4EXSA 1BMCA 1M2XA 5AHRA 2H6AA 4C09A 5ACVA 4FR7A 4RBSA 3SFPA 5ACTA 3T3NA 1E5DA 3TP9A 5DPXA 3I14A 3DHCA 4NQ6A 2Y8AA 4F6ZA 2BG2A 4RAMA 3ADRA 4UWOB 2QEDA 5EW0A 2UYXA 2GCUA 2R2DA 2BFKA 5K4KA 5LS3A 3FCZA 4GYUA 5AYAA 3SBLA 4AX1B 3QH8A 2BR6A 4ZEJA 2AZ4A 1A8TA 1XTOA 2BG8A 5HIQA 2BMIA 1ZTCA 3IE1A 4WD6A 5EHTA 2BG6A 4J5FA 4TZ9A 4Z60A 1X8IA 5ACWA 3ZNBA 4DILA 3X2XA 4UWPB 3KNSA 5B15A 3PY6A 1DXKA 4TYTA 2E7YA 4FSBA 3IEKA 3T9MA 3KL7A 2I7TA 5AXOA 2FU8A 4RM5A 1X8HA 1KO3A 3IELA 1HLKA 3A4YA 1Y44A 2ZO4A 2BFZA 3IOFA 3BK2A 4HKYA 4O98A 3SRXA 4Z5YA 1YCHA 4UBQA 2AIOA 2Y87A 2YNUA 1JJTA 4TZBA 2OHJA 4XWWA 4GYQA 5LCHA 3VPEA 2NYPA 4Z67A 3RPCA 2WYMC 4ZO3A 2CBNA 4C1CA 2XF4A 2A7MA 2QDTA 2WYMA 1K07A 1VJNA 4RAWA 5EV6A 5LE1A 1DDKA 1MQOA 4UAMA 5ACSA 4UA4A 3I15A 3RKJA 1ZKPA 1XM8A 2Q0IA 5LCFA 4HL2A 2NXAA 4LE6A 5ACRA 3PY5A 5HIOA 5ACUA 3DHBA 3H3EA 2FU9A 3IE2A 1WRAA 2GFKA 2GMNA 2WRSA 2OHHA 2P97A 1VMEA 3X30A 4AX0B 4RL0A 4UWRB 5K0WA 3I0VA 4U4LA 2YZ3A 2FHXB 3AF6A 1ZNBA 5EVKA 5EVDA 2BG7A 2ZWRA 4EFZA 2HB9A 2P18A 2ZNBA 2P1EA 3IE0A 4PVOA 2FU6A 5FQBA 1DD6A 5LM6A 4TZEA 5A0TA 3I13A 2YNWA 5B1UA 4Z5ZA 4JO0A 1BVTA 3BV6A 1YCFA 3DH8A 4FEKA 3L6NA 3T3OA 5ACQA 2NZFA 4Z7RA 2YCBA 4H0DA 2BIBA 4UWSB 4ZO2A 3IOGA
chains in the Genus database with same CATH superfamily
4B87A 4D1WA 4YSKA 5LMCA 2I7XA 2GFJA 4D1VA 3SW3A 2QDSA 5K4MA 2BFLA 1P9EA 5FQAA 4J5HA 1X8GA 4EYFA 5IQKA 4CHLA 1KO2A 4D1UA 2YNVB 4NQ5A 5AXRA 3P2UA 4EY2A 4KEPA 4DIKA 5HH6A 5K4NA 3KNRA 5KILA 2BG8B 2Y8BA 1QH5A 5EH9A 5EVBA 3WXCA 4F6HA 5ACXA 3VQZA 1JT1A 2BGAA 4C1FA 3DHAA 2P4ZA 2NZEA 5B3RA 5ACPA 1QH3A 4C1HA 2M5CA 1YCGA 3Q6VA 1KR3A 4AWZA 3ZWFA 3ESHA 2Q0JA 4XWTA 4YSBA 1WUOA 3X2YA 5A5ZA 2BFZB 2BC2A 2Q9UA 3PG4A 2QJSA 4BP0A 4D1TA 4P62A 2OHIA 2QINA 1SMLA 4D02A 4TYFA 4Z6XA 4TZFA 5LLDA 5AIJA 5HISA 2BTNA 5A87A 2DOOA 3I11A 3LVZA 3S0ZA 2M5DA 4KEQA 2YNTB 3ZR9A 2YNVA 3FAIA 5EV8A 3BC2A 4GCWA 1WUPA 1WW1A 4NQ4A 2FM6A 4XUKA 5AHOA 2ZZIA 1JJEA 5HH4A 3F9OA 4ZNBA 1L9YA 3AJ3A 3IEMA 3BK1A 3SD9A 4C1EA 3ZQ4A 3AF5A 5AEBA 3JXPA 3RKKA 5HH5A 2FK6A 3G1PA 5FQCA 4AWYB 3MD7A 4AXHA 2WYLA 2WHGA 5KIKA 2FU7A 4EXYA 4BZ3A 4C1DA 5HIPA 2VW8A 3R2UA 2I7VA 4EYBA 1VGNA 4RL2A 5EWAA 2XR1A 5A0VA 1A7TA 2FHXA 3X2ZA 2Q42A 3SPUA 5LSCA 4NQ2A 4PVTA 2DKFA 4EYLA 1BC2A 4YSLA 4C1GA 5LCAA 2YNTA 2GKLA 4V0HA 4AD9A 4HL1A 3IDZA 4EXSA 1BMCA 1M2XA 5AHRA 2H6AA 4C09A 5ACVA 4FR7A 4RBSA 3SFPA 5ACTA 3T3NA 1E5DA 3TP9A 5DPXA 3I14A 3DHCA 4NQ6A 2Y8AA 4F6ZA 2CG3A 2BG2A 4RAMA 3ADRA 4UWOB 2QEDA 5EW0A 2UYXA 2GCUA 2R2DA 2BFKA 5K4KA 5LS3A 3FCZA 4GYUA 5AYAA 3SBLA 4AX1B 3QH8A 2BR6A 4ZEJA 2AZ4A 1A8TA 1XTOA 2BG8A 5HIQA 2BMIA 1ZTCA 3IE1A 4WD6A 5EHTA 2BG6A 4J5FA 4TZ9A 4Z60A 1X8IA 5ACWA 3ZNBA 4DILA 3X2XA 4UWPB 3KNSA 5B15A 3PY6A 1DXKA 4TYTA 2E7YA 4FSBA 3IEKA 3T9MA 3KL7A 2I7TA 5AXOA 2FU8A 4RM5A 1X8HA 1KO3A 3IELA 1HLKA 3A4YA 1Y44A 4NURA 2ZO4A 2BFZA 3IOFA 2CG2A 3BK2A 4HKYA 4O98A 3SRXA 4Z5YA 1YCHA 4UBQA 4AV7A 2AIOA 2Y87A 2YNUA 1JJTA 4TZBA 2OHJA 4XWWA 4GYQA 5LCHA 3VPEA 2CFUA 2NYPA 4Z67A 5AJLA 3RPCA 2WYMC 5A23A 4ZO3A 2CBNA 4C1CA 2XF4A 2A7MA 2QDTA 2WYMA 1K07A 1VJNA 4RAWA 5EV6A 5LE1A 1DDKA 1MQOA 2CFZA 4UAMA 5ACSA 4UA4A 3I15A 3RKJA 1ZKPA 1XM8A 2Q0IA 5LCFA 4HL2A 2NXAA 4LE6A 5ACRA 3PY5A 5HIOA 5ACUA 3DHBA 3H3EA 2FU9A 3IE2A 1WRAA 2GFKA 2GMNA 2WRSA 2OHHA 2P97A 1VMEA 3X30A 4PDXA 4AX0B 2YHEA 4RL0A 4UWRB 5K0WA 3I0VA 4U4LA 2YZ3A 2FHXB 3AF6A 1ZNBA 5EVKA 5EVDA 2BG7A 2ZWRA 4EFZA 2HB9A 2P18A 2ZNBA 2P1EA 3IE0A 4PVOA 2FU6A 5FQBA 1DD6A 5LM6A 4TZEA 5A0TA 3I13A 2YNWA 5B1UA 4Z5ZA 4JO0A 1BVTA 3BV6A 1YCFA 3DH8A 4FEKA 3L6NA 3T3OA 5ACQA 2NZFA 4Z7RA 2YCBA 4H0DA 2BIBA 4UWSB 4ZO2A 3IOGA
chains in the Genus database with same CATH topology
4B87A 4D1WA 4YSKA 5LMCA 2I7XA 2GFJA 4D1VA 3SW3A 2QDSA 5K4MA 2BFLA 1P9EA 5FQAA 4J5HA 1X8GA 4EYFA 5IQKA 4CHLA 1KO2A 4D1UA 2YNVB 4NQ5A 5AXRA 3P2UA 4EY2A 4KEPA 4DIKA 5HH6A 5K4NA 3KNRA 5KILA 2BG8B 2Y8BA 1QH5A 5EH9A 5EVBA 3WXCA 4F6HA 5ACXA 3VQZA 1JT1A 2BGAA 4C1FA 3DHAA 2P4ZA 2NZEA 5B3RA 5ACPA 1QH3A 4C1HA 2M5CA 1YCGA 3Q6VA 1KR3A 4AWZA 3ZWFA 3ESHA 2Q0JA 4XWTA 4YSBA 1WUOA 3X2YA 5A5ZA 2BFZB 2BC2A 2Q9UA 3PG4A 2QJSA 4BP0A 4D1TA 4P62A 2OHIA 2QINA 1SMLA 4D02A 4TYFA 4Z6XA 4TZFA 5LLDA 5HISA 2BTNA 5A87A 2DOOA 3I11A 3LVZA 3S0ZA 2M5DA 4KEQA 2YNTB 3ZR9A 2YNVA 3FAIA 5EV8A 3BC2A 4GCWA 1WUPA 1WW1A 4NQ4A 2FM6A 4XUKA 5AHOA 2ZZIA 1JJEA 5HH4A 3F9OA 4ZNBA 1L9YA 3AJ3A 3IEMA 3BK1A 3SD9A 4C1EA 3ZQ4A 3AF5A 5AEBA 3JXPA 3RKKA 5HH5A 2FK6A 3G1PA 5FQCA 4AWYB 3MD7A 2WYLA 2WHGA 5KIKA 2FU7A 4EXYA 4BZ3A 4C1DA 5HIPA 2VW8A 3R2UA 2I7VA 4EYBA 1VGNA 4RL2A 5EWAA 2XR1A 5A0VA 1A7TA 2FHXA 3X2ZA 2Q42A 3SPUA 5LSCA 4NQ2A 4PVTA 2DKFA 4EYLA 1BC2A 4YSLA 4C1GA 5LCAA 2YNTA 2GKLA 4V0HA 4AD9A 4HL1A 3IDZA 4EXSA 1BMCA 1M2XA 5AHRA 2H6AA 4C09A 5ACVA 4FR7A 4RBSA 3SFPA 5ACTA 3T3NA 1E5DA 3TP9A 5DPXA 3I14A 3DHCA 4NQ6A 2Y8AA 4F6ZA 2BG2A 4RAMA 3ADRA 4UWOB 2QEDA 5EW0A 2UYXA 2GCUA 2R2DA 2BFKA 5K4KA 5LS3A 3FCZA 4GYUA 5AYAA 3SBLA 4AX1B 3QH8A 2BR6A 4ZEJA 2AZ4A 1A8TA 1XTOA 2BG8A 5HIQA 2BMIA 1ZTCA 3IE1A 4WD6A 5EHTA 2BG6A 4J5FA 4TZ9A 4Z60A 1X8IA 5ACWA 3ZNBA 4DILA 3X2XA 4UWPB 3KNSA 5B15A 3PY6A 1DXKA 4TYTA 2E7YA 4FSBA 3IEKA 3T9MA 3KL7A 2I7TA 5AXOA 2FU8A 4RM5A 1X8HA 1KO3A 3IELA 1HLKA 3A4YA 1Y44A 2ZO4A 2BFZA 3IOFA 3BK2A 4HKYA 4O98A 3SRXA 4Z5YA 1YCHA 4UBQA 2AIOA 2Y87A 2YNUA 1JJTA 4TZBA 2OHJA 4XWWA 4GYQA 5LCHA 3VPEA 2NYPA 4Z67A 3RPCA 2WYMC 4ZO3A 2CBNA 4C1CA 2XF4A 2A7MA 2QDTA 2WYMA 1K07A 1VJNA 4RAWA 5EV6A 5LE1A 1DDKA 1MQOA 4UAMA 5ACSA 4UA4A 3I15A 3RKJA 1ZKPA 1XM8A 2Q0IA 5LCFA 4HL2A 2NXAA 4LE6A 5ACRA 3PY5A 5HIOA 5ACUA 3DHBA 3H3EA 2FU9A 3IE2A 1WRAA 2GFKA 2GMNA 2WRSA 2OHHA 2P97A 1VMEA 3X30A 4AX0B 4RL0A 4UWRB 5K0WA 3I0VA 4U4LA 2YZ3A 2FHXB 3AF6A 1ZNBA 5EVKA 5EVDA 2BG7A 2ZWRA 4EFZA 2HB9A 2P18A 2ZNBA 2P1EA 3IE0A 4PVOA 2FU6A 5FQBA 1DD6A 5LM6A 4TZEA 5A0TA 3I13A 2YNWA 5B1UA 4Z5ZA 4JO0A 1BVTA 3BV6A 1YCFA 3DH8A 4FEKA 3L6NA 3T3OA 5ACQA 2NZFA 4Z7RA 2YCBA 4H0DA 2BIBA 4UWSB 4ZO2A 3IOGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B87 A;  4D1W A;  4YSK A;  5LMC A;  2I7X A;  2GFJ A;  4D1V A;  3SW3 A;  2QDS A;  5K4M A;  2BFL A;  1P9E A;  5FQA A;  4J5H A;  1X8G A;  4EYF A;  5IQK A;  4CHL A;  1KO2 A;  4D1U A;  2YNV B;  4NQ5 A;  5AXR A;  3P2U A;  4EY2 A;  4KEP A;  4DIK A;  5HH6 A;  5K4N A;  3KNR A;  5KIL A;  2BG8 B;  2Y8B A;  1QH5 A;  5EH9 A;  5EVB A;  3WXC A;  4F6H A;  5ACX A;  3VQZ A;  1JT1 A;  2BGA A;  4C1F A;  3DHA A;  2P4Z A;  2NZE A;  5B3R A;  5ACP A;  1QH3 A;  4C1H A;  2M5C A;  1YCG A;  3Q6V A;  1KR3 A;  4AWZ A;  3ZWF A;  3ESH A;  2Q0J A;  4XWT A;  4YSB A;  1WUO A;  3X2Y A;  5A5Z A;  2BFZ B;  2BC2 A;  2Q9U A;  3PG4 A;  2QJS A;  4BP0 A;  4D1T A;  4P62 A;  2OHI A;  2QIN A;  1SML A;  4D02 A;  4TYF A;  4Z6X A;  4TZF A;  5LLD A;  5HIS A;  2BTN A;  5A87 A;  2DOO A;  3I11 A;  3LVZ A;  3S0Z A;  2M5D A;  4KEQ A;  2YNT B;  3ZR9 A;  2YNV A;  3FAI A;  5EV8 A;  3BC2 A;  4GCW A;  1WUP A;  1WW1 A;  4NQ4 A;  2FM6 A;  4XUK A;  5AHO A;  2ZZI A;  1JJE A;  5HH4 A;  3F9O A;  4ZNB A;  1L9Y A;  3AJ3 A;  3IEM A;  3BK1 A;  3SD9 A;  4C1E A;  3ZQ4 A;  3AF5 A;  5AEB A;  3JXP A;  3RKK A;  5HH5 A;  2FK6 A;  3G1P A;  5FQC A;  4AWY B;  3MD7 A;  2WYL A;  2WHG A;  5KIK A;  2FU7 A;  4EXY A;  4BZ3 A;  4C1D A;  5HIP A;  2VW8 A;  3R2U A;  2I7V A;  4EYB A;  1VGN A;  4RL2 A;  5EWA A;  2XR1 A;  5A0V A;  1A7T A;  2FHX A;  3X2Z A;  2Q42 A;  3SPU A;  5LSC A;  4NQ2 A;  4PVT A;  2DKF A;  4EYL A;  1BC2 A;  4YSL A;  4C1G A;  5LCA A;  2YNT A;  2GKL A;  4V0H A;  4AD9 A;  4HL1 A;  3IDZ A;  4EXS A;  1BMC A;  1M2X A;  5AHR A;  2H6A A;  4C09 A;  5ACV A;  4FR7 A;  4RBS A;  3SFP A;  5ACT A;  3T3N A;  1E5D A;  3TP9 A;  5DPX A;  3I14 A;  3DHC A;  4NQ6 A;  2Y8A A;  4F6Z A;  2BG2 A;  4RAM A;  3ADR A;  4UWO B;  2QED A;  5EW0 A;  2UYX A;  2GCU A;  2R2D A;  2BFK A;  5K4K A;  5LS3 A;  3FCZ A;  4GYU A;  5AYA A;  3SBL A;  4AX1 B;  3QH8 A;  2BR6 A;  4ZEJ A;  2AZ4 A;  1A8T A;  1XTO A;  2BG8 A;  5HIQ A;  2BMI A;  1ZTC A;  3IE1 A;  4WD6 A;  5EHT A;  2BG6 A;  4J5F A;  4TZ9 A;  4Z60 A;  1X8I A;  5ACW A;  3ZNB A;  4DIL A;  3X2X A;  4UWP B;  3KNS A;  5B15 A;  3PY6 A;  1DXK A;  4TYT A;  2E7Y A;  4FSB A;  3IEK A;  3T9M A;  3KL7 A;  2I7T A;  5AXO A;  2FU8 A;  4RM5 A;  1X8H A;  1KO3 A;  3IEL A;  1HLK A;  3A4Y A;  1Y44 A;  2ZO4 A;  2BFZ A;  3IOF A;  3BK2 A;  4HKY A;  4O98 A;  3SRX A;  4Z5Y A;  1YCH A;  4UBQ A;  2AIO A;  2Y87 A;  2YNU A;  1JJT A;  4TZB A;  2OHJ A;  4XWW A;  4GYQ A;  5LCH A;  3VPE A;  2NYP A;  4Z67 A;  3RPC A;  2WYM C;  4ZO3 A;  2CBN A;  4C1C A;  2XF4 A;  2A7M A;  2QDT A;  2WYM A;  1K07 A;  1VJN A;  4RAW A;  5EV6 A;  5LE1 A;  1DDK A;  1MQO A;  4UAM A;  5ACS A;  4UA4 A;  3I15 A;  3RKJ A;  1ZKP A;  1XM8 A;  2Q0I A;  5LCF A;  4HL2 A;  2NXA A;  4LE6 A;  5ACR A;  3PY5 A;  5HIO A;  5ACU A;  3DHB A;  3H3E A;  2FU9 A;  3IE2 A;  1WRA A;  2GFK A;  2GMN A;  2WRS A;  2OHH A;  2P97 A;  1VME A;  3X30 A;  4AX0 B;  4RL0 A;  4UWR B;  5K0W A;  3I0V A;  4U4L A;  2YZ3 A;  2FHX B;  3AF6 A;  1ZNB A;  5EVK A;  5EVD A;  2BG7 A;  2ZWR A;  4EFZ A;  2HB9 A;  2P18 A;  2ZNB A;  2P1E A;  3IE0 A;  4PVO A;  2FU6 A;  5FQB A;  1DD6 A;  5LM6 A;  4TZE A;  5A0T A;  3I13 A;  2YNW A;  5B1U A;  4Z5Z A;  4JO0 A;  1BVT A;  3BV6 A;  1YCF A;  3DH8 A;  4FEK A;  3L6N A;  3T3O A;  5ACQ A;  2NZF A;  4Z7R A;  2YCB A;  4H0D A;  2BIB A;  4UWS B;  4ZO2 A;  3IOG A; 
#chains in the Genus database with same CATH topology
 4B87 A;  4D1W A;  4YSK A;  5LMC A;  2I7X A;  2GFJ A;  4D1V A;  3SW3 A;  2QDS A;  5K4M A;  2BFL A;  1P9E A;  5FQA A;  4J5H A;  1X8G A;  4EYF A;  5IQK A;  4CHL A;  1KO2 A;  4D1U A;  2YNV B;  4NQ5 A;  5AXR A;  3P2U A;  4EY2 A;  4KEP A;  4DIK A;  5HH6 A;  5K4N A;  3KNR A;  5KIL A;  2BG8 B;  2Y8B A;  1QH5 A;  5EH9 A;  5EVB A;  3WXC A;  4F6H A;  5ACX A;  3VQZ A;  1JT1 A;  2BGA A;  4C1F A;  3DHA A;  2P4Z A;  2NZE A;  5B3R A;  5ACP A;  1QH3 A;  4C1H A;  2M5C A;  1YCG A;  3Q6V A;  1KR3 A;  4AWZ A;  3ZWF A;  3ESH A;  2Q0J A;  4XWT A;  4YSB A;  1WUO A;  3X2Y A;  5A5Z A;  2BFZ B;  2BC2 A;  2Q9U A;  3PG4 A;  2QJS A;  4BP0 A;  4D1T A;  4P62 A;  2OHI A;  2QIN A;  1SML A;  4D02 A;  4TYF A;  4Z6X A;  4TZF A;  5LLD A;  5AIJ A;  5HIS A;  2BTN A;  5A87 A;  2DOO A;  3I11 A;  3LVZ A;  3S0Z A;  2M5D A;  4KEQ A;  2YNT B;  3ZR9 A;  2YNV A;  3FAI A;  5EV8 A;  3BC2 A;  4GCW A;  1WUP A;  1WW1 A;  4NQ4 A;  2FM6 A;  4XUK A;  5AHO A;  2ZZI A;  1JJE A;  5HH4 A;  3F9O A;  4ZNB A;  1L9Y A;  3AJ3 A;  3IEM A;  3BK1 A;  3SD9 A;  4C1E A;  3ZQ4 A;  3AF5 A;  5AEB A;  3JXP A;  3RKK A;  5HH5 A;  2FK6 A;  3G1P A;  5FQC A;  4AWY B;  3MD7 A;  4AXH A;  2WYL A;  2WHG A;  5KIK A;  2FU7 A;  4EXY A;  4BZ3 A;  4C1D A;  5HIP A;  2VW8 A;  3R2U A;  2I7V A;  4EYB A;  1VGN A;  4RL2 A;  5EWA A;  2XR1 A;  5A0V A;  1A7T A;  2FHX A;  3X2Z A;  2Q42 A;  3SPU A;  5LSC A;  4NQ2 A;  4PVT A;  2DKF A;  4EYL A;  1BC2 A;  4YSL A;  4C1G A;  5LCA A;  2YNT A;  2GKL A;  4V0H A;  4AD9 A;  4HL1 A;  3IDZ A;  4EXS A;  1BMC A;  1M2X A;  5AHR A;  2H6A A;  4C09 A;  5ACV A;  4FR7 A;  4RBS A;  3SFP A;  5ACT A;  3T3N A;  1E5D A;  3TP9 A;  5DPX A;  3I14 A;  3DHC A;  4NQ6 A;  2Y8A A;  4F6Z A;  2CG3 A;  2BG2 A;  4RAM A;  3ADR A;  4UWO B;  2QED A;  5EW0 A;  2UYX A;  2GCU A;  2R2D A;  2BFK A;  5K4K A;  5LS3 A;  3FCZ A;  4GYU A;  5AYA A;  3SBL A;  4AX1 B;  3QH8 A;  2BR6 A;  4ZEJ A;  2AZ4 A;  1A8T A;  1XTO A;  2BG8 A;  5HIQ A;  2BMI A;  1ZTC A;  3IE1 A;  4WD6 A;  5EHT A;  2BG6 A;  4J5F A;  4TZ9 A;  4Z60 A;  1X8I A;  5ACW A;  3ZNB A;  4DIL A;  3X2X A;  4UWP B;  3KNS A;  5B15 A;  3PY6 A;  1DXK A;  4TYT A;  2E7Y A;  4FSB A;  3IEK A;  3T9M A;  3KL7 A;  2I7T A;  5AXO A;  2FU8 A;  4RM5 A;  1X8H A;  1KO3 A;  3IEL A;  1HLK A;  3A4Y A;  1Y44 A;  4NUR A;  2ZO4 A;  2BFZ A;  3IOF A;  2CG2 A;  3BK2 A;  4HKY A;  4O98 A;  3SRX A;  4Z5Y A;  1YCH A;  4UBQ A;  4AV7 A;  2AIO A;  2Y87 A;  2YNU A;  1JJT A;  4TZB A;  2OHJ A;  4XWW A;  4GYQ A;  5LCH A;  3VPE A;  2CFU A;  2NYP A;  4Z67 A;  5AJL A;  3RPC A;  2WYM C;  5A23 A;  4ZO3 A;  2CBN A;  4C1C A;  2XF4 A;  2A7M A;  2QDT A;  2WYM A;  1K07 A;  1VJN A;  4RAW A;  5EV6 A;  5LE1 A;  1DDK A;  1MQO A;  2CFZ A;  4UAM A;  5ACS A;  4UA4 A;  3I15 A;  3RKJ A;  1ZKP A;  1XM8 A;  2Q0I A;  5LCF A;  4HL2 A;  2NXA A;  4LE6 A;  5ACR A;  3PY5 A;  5HIO A;  5ACU A;  3DHB A;  3H3E A;  2FU9 A;  3IE2 A;  1WRA A;  2GFK A;  2GMN A;  2WRS A;  2OHH A;  2P97 A;  1VME A;  3X30 A;  4PDX A;  4AX0 B;  2YHE A;  4RL0 A;  4UWR B;  5K0W A;  3I0V A;  4U4L A;  2YZ3 A;  2FHX B;  3AF6 A;  1ZNB A;  5EVK A;  5EVD A;  2BG7 A;  2ZWR A;  4EFZ A;  2HB9 A;  2P18 A;  2ZNB A;  2P1E A;  3IE0 A;  4PVO A;  2FU6 A;  5FQB A;  1DD6 A;  5LM6 A;  4TZE A;  5A0T A;  3I13 A;  2YNW A;  5B1U A;  4Z5Z A;  4JO0 A;  1BVT A;  3BV6 A;  1YCF A;  3DH8 A;  4FEK A;  3L6N A;  3T3O A;  5ACQ A;  2NZF A;  4Z7R A;  2YCB A;  4H0D A;  2BIB A;  4UWS B;  4ZO2 A;  3IOG A; 
#chains in the Genus database with same CATH homology
 4B87 A;  4D1W A;  4YSK A;  5LMC A;  2I7X A;  2GFJ A;  4D1V A;  3SW3 A;  2QDS A;  5K4M A;  2BFL A;  1P9E A;  5FQA A;  4J5H A;  1X8G A;  4EYF A;  5IQK A;  4CHL A;  1KO2 A;  4D1U A;  2YNV B;  4NQ5 A;  5AXR A;  3P2U A;  4EY2 A;  4KEP A;  4DIK A;  5HH6 A;  5K4N A;  3KNR A;  5KIL A;  2BG8 B;  2Y8B A;  1QH5 A;  5EH9 A;  5EVB A;  3WXC A;  4F6H A;  5ACX A;  3VQZ A;  1JT1 A;  2BGA A;  4C1F A;  3DHA A;  2P4Z A;  2NZE A;  5B3R A;  5ACP A;  1QH3 A;  4C1H A;  2M5C A;  1YCG A;  3Q6V A;  1KR3 A;  4AWZ A;  3ZWF A;  3ESH A;  2Q0J A;  4XWT A;  4YSB A;  1WUO A;  3X2Y A;  5A5Z A;  2BFZ B;  2BC2 A;  2Q9U A;  3PG4 A;  2QJS A;  4BP0 A;  4D1T A;  4P62 A;  2OHI A;  2QIN A;  1SML A;  4D02 A;  4TYF A;  4Z6X A;  4TZF A;  5LLD A;  5HIS A;  2BTN A;  5A87 A;  2DOO A;  3I11 A;  3LVZ A;  3S0Z A;  2M5D A;  4KEQ A;  2YNT B;  3ZR9 A;  2YNV A;  3FAI A;  5EV8 A;  3BC2 A;  4GCW A;  1WUP A;  1WW1 A;  4NQ4 A;  2FM6 A;  4XUK A;  5AHO A;  2ZZI A;  1JJE A;  5HH4 A;  3F9O A;  4ZNB A;  1L9Y A;  3AJ3 A;  3IEM A;  3BK1 A;  3SD9 A;  4C1E A;  3ZQ4 A;  3AF5 A;  5AEB A;  3JXP A;  3RKK A;  5HH5 A;  2FK6 A;  3G1P A;  5FQC A;  4AWY B;  3MD7 A;  2WYL A;  2WHG A;  5KIK A;  2FU7 A;  4EXY A;  4BZ3 A;  4C1D A;  5HIP A;  2VW8 A;  3R2U A;  2I7V A;  4EYB A;  1VGN A;  4RL2 A;  5EWA A;  2XR1 A;  5A0V A;  1A7T A;  2FHX A;  3X2Z A;  2Q42 A;  3SPU A;  5LSC A;  4NQ2 A;  4PVT A;  2DKF A;  4EYL A;  1BC2 A;  4YSL A;  4C1G A;  5LCA A;  2YNT A;  2GKL A;  4V0H A;  4AD9 A;  4HL1 A;  3IDZ A;  4EXS A;  1BMC A;  1M2X A;  5AHR A;  2H6A A;  4C09 A;  5ACV A;  4FR7 A;  4RBS A;  3SFP A;  5ACT A;  3T3N A;  1E5D A;  3TP9 A;  5DPX A;  3I14 A;  3DHC A;  4NQ6 A;  2Y8A A;  4F6Z A;  2BG2 A;  4RAM A;  3ADR A;  4UWO B;  2QED A;  5EW0 A;  2UYX A;  2GCU A;  2R2D A;  2BFK A;  5K4K A;  5LS3 A;  3FCZ A;  4GYU A;  5AYA A;  3SBL A;  4AX1 B;  3QH8 A;  2BR6 A;  4ZEJ A;  2AZ4 A;  1A8T A;  1XTO A;  2BG8 A;  5HIQ A;  2BMI A;  1ZTC A;  3IE1 A;  4WD6 A;  5EHT A;  2BG6 A;  4J5F A;  4TZ9 A;  4Z60 A;  1X8I A;  5ACW A;  3ZNB A;  4DIL A;  3X2X A;  4UWP B;  3KNS A;  5B15 A;  3PY6 A;  1DXK A;  4TYT A;  2E7Y A;  4FSB A;  3IEK A;  3T9M A;  3KL7 A;  2I7T A;  5AXO A;  2FU8 A;  4RM5 A;  1X8H A;  1KO3 A;  3IEL A;  1HLK A;  3A4Y A;  1Y44 A;  2ZO4 A;  2BFZ A;  3IOF A;  3BK2 A;  4HKY A;  4O98 A;  3SRX A;  4Z5Y A;  1YCH A;  4UBQ A;  2AIO A;  2Y87 A;  2YNU A;  1JJT A;  4TZB A;  2OHJ A;  4XWW A;  4GYQ A;  5LCH A;  3VPE A;  2NYP A;  4Z67 A;  3RPC A;  2WYM C;  4ZO3 A;  2CBN A;  4C1C A;  2XF4 A;  2A7M A;  2QDT A;  2WYM A;  1K07 A;  1VJN A;  4RAW A;  5EV6 A;  5LE1 A;  1DDK A;  1MQO A;  4UAM A;  5ACS A;  4UA4 A;  3I15 A;  3RKJ A;  1ZKP A;  1XM8 A;  2Q0I A;  5LCF A;  4HL2 A;  2NXA A;  4LE6 A;  5ACR A;  3PY5 A;  5HIO A;  5ACU A;  3DHB A;  3H3E A;  2FU9 A;  3IE2 A;  1WRA A;  2GFK A;  2GMN A;  2WRS A;  2OHH A;  2P97 A;  1VME A;  3X30 A;  4AX0 B;  4RL0 A;  4UWR B;  5K0W A;  3I0V A;  4U4L A;  2YZ3 A;  2FHX B;  3AF6 A;  1ZNB A;  5EVK A;  5EVD A;  2BG7 A;  2ZWR A;  4EFZ A;  2HB9 A;  2P18 A;  2ZNB A;  2P1E A;  3IE0 A;  4PVO A;  2FU6 A;  5FQB A;  1DD6 A;  5LM6 A;  4TZE A;  5A0T A;  3I13 A;  2YNW A;  5B1U A;  4Z5Z A;  4JO0 A;  1BVT A;  3BV6 A;  1YCF A;  3DH8 A;  4FEK A;  3L6N A;  3T3O A;  5ACQ A;  2NZF A;  4Z7R A;  2YCB A;  4H0D A;  2BIB A;  4UWS B;  4ZO2 A;  3IOG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...