5EH9A

Indirect contributions of mutations underlie optimization of new enzyme function
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
253
structure length
253
Chain Sequence
GHMATVKKLYFVPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIETEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Tinkering Drives Evolution of a Promiscuous Activity through Indirect Mutational Effects.
pubmed doi rcsb
source organism Bacillus thuringiensis subsp. kurstaki
molecule tags Hydrolase
molecule keywords N-acyl homoserine lactonase AiiA
total genus 81
structure length 253
sequence length 253
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5eh9A01
4UWPB 2FHXA 5B1UA 4RM5A 3X2YA 2CBNA 2FU8A 2WYMA 2YZ3A 2NYPA 3IEMA 4Z7RA 4PVOA 5LLDA 1A7TA 4AWYB 5AYAA 3H3EA 3WXCA 5A5ZA 5B15A 4F6ZA 4EYBA 2QEDA 4J5HA 1JJTA 5B3RA 2ZNBA 4ZO2A 5EVKA 3R2UA 3IE0A 1BVTA 5LCHA 4KEQA 4TYFA 2YNVB 4HL2A 3I0VA 3Q6VA 5EH9A 4RL0A 1VJNA 2M5DA 3BK2A 1KO3A 1M2XA 3I14A 1JJEA 5EVBA 5ACTA 4XUKA 2QINA 2M5CA 2OHIA 1WW1A 2BC2A 4H0DA 2Y87A 4ZO3A 3X2ZA 5A87A 4NQ2A 3AJ3A 3PY6A 4TZEA 3ESHA 4GYQA 4RAMA 3P2UA 4YSKA 2NZFA 4GCWA 3I15A 4HL1A 2YNTA 1Y44A 5EHTA 2HB9A 3PG4A 2GFKA 4D1WA 4AWZA 2QDSA 3ZQ4A 3FCZA 3RKJA 2OHHA 5LS3A 3IELA 2Y8AA 3DHAA 3G1PA 1YCHA 3ZNBA 4LE6A 5HH6A 2BTNA 1DXKA 5K4KA 4TZ9A 5ACSA 1BC2A 4TZBA 5HH5A 2VW8A 4ZEJA 4P62A 4ZNBA 2Q0IA 2I7XA 2GKLA 3F9OA 4GYUA 5HISA 5IQKA 3ADRA 3I13A 2Q9UA 1VGNA 3DHBA 5ACXA 1DD6A 2GMNA 4C1FA 3KNSA 1HLKA 2FU9A 3PY5A 2BFZB 1XM8A 2BFKA 4Z5YA 4C1HA 2ZWRA 4D1UA 2I7TA 2ZO4A 5HIOA 4UWSB 2P18A 4KEPA 2NXAA 2Q42A 4XWWA 5KIKA 3SRXA 1XTOA 2BG8A 1YCGA 5FQBA 4EXYA 5KILA 3IE2A 3RPCA 2I7VA 4TZFA 4UBQA 4Z60A 1QH3A 5EW0A 4WD6A 4NQ4A 3L6NA 5FQCA 4UAMA 2NZEA 2WRSA 1BMCA 2YNTB 5EV6A 2UYXA 2WYMC 4C09A 3DHCA 2FK6A 5LM6A 3X2XA 3ZWFA 2YNWA 2Y8BA 2E7YA 3KL7A 2OHJA 2BFLA 2BR6A 3IOGA 5AHOA 2FU7A 1JT1A 3DH8A 5A0VA 3JXPA 5EWAA 3T9MA 2BG6A 4AD9A 3IDZA 3MD7A 2BG8B 4Z5ZA 5K0WA 5K4MA 4B87A 2AIOA 1X8GA 2FM6A 4D02A 4J5FA 5AHRA 2WHGA 4NQ5A 4CHLA 3T3NA 4AX1B 2BMIA 4UWOB 2H6AA 5ACVA 5ACUA 5DPXA 4FR7A 3BV6A 2BFZA 5AEBA 2BG7A 1QH5A 4O98A 3SPUA 4EFZA 4AX0B 2R2DA 5LSCA 1E5DA 3QH8A 3FAIA 4EYFA 4PVTA 3T3OA 2FHXB 5A0TA 2Q0JA 3ZR9A 1X8HA 5AXOA 2GFJA 5LCAA 4DIKA 5HIQA 2WYLA 2ZZIA 3I11A 5LMCA 2P1EA 4V0HA 5ACPA 3SW3A 1SMLA 3AF6A 4JO0A 1ZNBA 4UWRB 4C1DA 4D1VA 3LVZA 2BIBA 4DILA 2FU6A 1WRAA 3TP9A 5ACQA 3AF5A 3BC2A 4RBSA 2P4ZA 3KNRA 4TYTA 2BGAA 2BG2A 3SD9A 1X8IA 2A7MA 4YSBA 3X30A 4C1CA 5ACRA 1A8TA 2GCUA 5HH4A 3VPEA 4U4LA 5EVDA 1KR3A 5LE1A 5ACWA 1MQOA 5EV8A 2DKFA 4BP0A 5AXRA 4F6HA 4BZ3A 4FSBA 4EXSA 3BK1A 2YNVA 3SBLA 3A4YA 4D1TA 4HKYA 1WUOA 4C1GA 4Z67A 2XR1A 2QJSA 2P97A 1KO2A 4C1EA 3IE1A 2QDTA 3IOFA 4NQ6A 2YCBA 2XF4A 4YSLA 1K07A 1ZTCA 2AZ4A 3VQZA 4RAWA 4UA4A 1P9EA 5HIPA 4RL2A 3RKKA 2DOOA 4EY2A 1DDKA 4EYLA 1L9YA 2YNUA 3SFPA 5K4NA 1VMEA 3S0ZA 1ZKPA 5FQAA 4XWTA 3IEKA 1YCFA 4Z6XA 5LCFA 1WUPA 4FEKA
chains in the Genus database with same CATH superfamily
4UWPB 2FHXA 5B1UA 4RM5A 3X2YA 2CBNA 2FU8A 2WYMA 2YZ3A 2NYPA 3IEMA 4Z7RA 4PVOA 5LLDA 1A7TA 4AWYB 5AJLA 5AYAA 3H3EA 3WXCA 5A5ZA 5B15A 4F6ZA 4EYBA 2QEDA 4J5HA 1JJTA 5B3RA 2ZNBA 4ZO2A 5EVKA 3R2UA 3IE0A 1BVTA 5LCHA 4KEQA 4TYFA 2YNVB 4AV7A 4HL2A 3I0VA 3Q6VA 5EH9A 4RL0A 1VJNA 2M5DA 3BK2A 1KO3A 1M2XA 3I14A 1JJEA 5EVBA 5ACTA 4XUKA 2QINA 2M5CA 2OHIA 1WW1A 2BC2A 4H0DA 2Y87A 4ZO3A 3X2ZA 5A87A 4NQ2A 3AJ3A 3PY6A 4TZEA 3ESHA 2CG3A 4GYQA 4RAMA 3P2UA 4YSKA 2NZFA 4GCWA 3I15A 4HL1A 2YNTA 1Y44A 5EHTA 2HB9A 3PG4A 2GFKA 4D1WA 4AWZA 2QDSA 3ZQ4A 3FCZA 3RKJA 2OHHA 5LS3A 3IELA 2Y8AA 3DHAA 3G1PA 1YCHA 3ZNBA 4LE6A 5HH6A 2BTNA 1DXKA 5K4KA 4TZ9A 5ACSA 1BC2A 4TZBA 5HH5A 2VW8A 4ZEJA 4P62A 4ZNBA 2Q0IA 2I7XA 2GKLA 3F9OA 4GYUA 5HISA 5IQKA 3ADRA 3I13A 4PDXA 2Q9UA 1VGNA 3DHBA 5ACXA 1DD6A 2GMNA 4C1FA 3KNSA 1HLKA 2FU9A 3PY5A 2BFZB 1XM8A 2BFKA 4Z5YA 4C1HA 2ZWRA 4D1UA 2I7TA 2ZO4A 5HIOA 4UWSB 2P18A 4KEPA 2NXAA 2Q42A 4XWWA 5KIKA 3SRXA 1XTOA 2BG8A 5A23A 1YCGA 5FQBA 4EXYA 5KILA 3IE2A 3RPCA 2I7VA 4TZFA 4UBQA 4Z60A 1QH3A 5EW0A 4WD6A 4NQ4A 3L6NA 5FQCA 4UAMA 2NZEA 2WRSA 1BMCA 2YNTB 5EV6A 2UYXA 2WYMC 4C09A 3DHCA 2FK6A 5LM6A 3X2XA 3ZWFA 2YNWA 2Y8BA 2E7YA 3KL7A 2OHJA 2BFLA 2BR6A 3IOGA 5AHOA 2FU7A 1JT1A 3DH8A 5A0VA 3JXPA 5EWAA 3T9MA 2BG6A 4AD9A 3IDZA 3MD7A 2BG8B 2CFZA 4Z5ZA 5K0WA 5K4MA 4B87A 2AIOA 1X8GA 2FM6A 4D02A 4J5FA 5AHRA 2WHGA 4NQ5A 4CHLA 3T3NA 4AX1B 2BMIA 4UWOB 2H6AA 5ACVA 5ACUA 5DPXA 4FR7A 3BV6A 2BFZA 5AEBA 2BG7A 1QH5A 4O98A 3SPUA 4EFZA 4AX0B 2R2DA 5LSCA 1E5DA 3QH8A 3FAIA 4EYFA 4PVTA 3T3OA 2FHXB 5A0TA 2Q0JA 3ZR9A 1X8HA 5AXOA 2GFJA 5LCAA 4DIKA 5HIQA 2WYLA 2ZZIA 3I11A 5LMCA 2P1EA 4V0HA 5ACPA 3SW3A 1SMLA 3AF6A 4JO0A 1ZNBA 4UWRB 4C1DA 4D1VA 3LVZA 2BIBA 4DILA 2FU6A 1WRAA 3TP9A 5ACQA 3AF5A 3BC2A 4RBSA 4NURA 2P4ZA 3KNRA 4TYTA 2BGAA 2BG2A 3SD9A 1X8IA 2A7MA 4YSBA 3X30A 4C1CA 5ACRA 1A8TA 2GCUA 5HH4A 3VPEA 4U4LA 5EVDA 1KR3A 5LE1A 2CG2A 2CFUA 5ACWA 1MQOA 5EV8A 2DKFA 4BP0A 5AXRA 4F6HA 4BZ3A 4FSBA 4EXSA 3BK1A 2YNVA 3SBLA 3A4YA 4D1TA 4HKYA 1WUOA 4C1GA 4Z67A 2XR1A 2QJSA 2P97A 1KO2A 4C1EA 3IE1A 2QDTA 3IOFA 4NQ6A 2YCBA 2XF4A 4YSLA 4AXHA 1K07A 1ZTCA 2AZ4A 3VQZA 4RAWA 4UA4A 1P9EA 5HIPA 4RL2A 3RKKA 2DOOA 4EY2A 1DDKA 4EYLA 1L9YA 2YNUA 3SFPA 5K4NA 1VMEA 3S0ZA 2YHEA 1ZKPA 5FQAA 4XWTA 3IEKA 1YCFA 4Z6XA 5AIJA 5LCFA 1WUPA 4FEKA
chains in the Genus database with same CATH topology
4UWPB 2FHXA 5B1UA 4RM5A 3X2YA 2CBNA 2FU8A 2WYMA 2YZ3A 2NYPA 3IEMA 4Z7RA 4PVOA 5LLDA 1A7TA 4AWYB 5AYAA 3H3EA 3WXCA 5A5ZA 5B15A 4F6ZA 4EYBA 2QEDA 4J5HA 1JJTA 5B3RA 2ZNBA 4ZO2A 5EVKA 3R2UA 3IE0A 1BVTA 5LCHA 4KEQA 4TYFA 2YNVB 4HL2A 3I0VA 3Q6VA 5EH9A 4RL0A 1VJNA 2M5DA 3BK2A 1KO3A 1M2XA 3I14A 1JJEA 5EVBA 5ACTA 4XUKA 2QINA 2M5CA 2OHIA 1WW1A 2BC2A 4H0DA 2Y87A 4ZO3A 3X2ZA 5A87A 4NQ2A 3AJ3A 3PY6A 4TZEA 3ESHA 4GYQA 4RAMA 3P2UA 4YSKA 2NZFA 4GCWA 3I15A 4HL1A 2YNTA 1Y44A 5EHTA 2HB9A 3PG4A 2GFKA 4D1WA 4AWZA 2QDSA 3ZQ4A 3FCZA 3RKJA 2OHHA 5LS3A 3IELA 2Y8AA 3DHAA 3G1PA 1YCHA 3ZNBA 4LE6A 5HH6A 2BTNA 1DXKA 5K4KA 4TZ9A 5ACSA 1BC2A 4TZBA 5HH5A 2VW8A 4ZEJA 4P62A 4ZNBA 2Q0IA 2I7XA 2GKLA 3F9OA 4GYUA 5HISA 5IQKA 3ADRA 3I13A 2Q9UA 1VGNA 3DHBA 5ACXA 1DD6A 2GMNA 4C1FA 3KNSA 1HLKA 2FU9A 3PY5A 2BFZB 1XM8A 2BFKA 4Z5YA 4C1HA 2ZWRA 4D1UA 2I7TA 2ZO4A 5HIOA 4UWSB 2P18A 4KEPA 2NXAA 2Q42A 4XWWA 5KIKA 3SRXA 1XTOA 2BG8A 1YCGA 5FQBA 4EXYA 5KILA 3IE2A 3RPCA 2I7VA 4TZFA 4UBQA 4Z60A 1QH3A 5EW0A 4WD6A 4NQ4A 3L6NA 5FQCA 4UAMA 2NZEA 2WRSA 1BMCA 2YNTB 5EV6A 2UYXA 2WYMC 4C09A 3DHCA 2FK6A 5LM6A 3X2XA 3ZWFA 2YNWA 2Y8BA 2E7YA 3KL7A 2OHJA 2BFLA 2BR6A 3IOGA 5AHOA 2FU7A 1JT1A 3DH8A 5A0VA 3JXPA 5EWAA 3T9MA 2BG6A 4AD9A 3IDZA 3MD7A 2BG8B 4Z5ZA 5K0WA 5K4MA 4B87A 2AIOA 1X8GA 2FM6A 4D02A 4J5FA 5AHRA 2WHGA 4NQ5A 4CHLA 3T3NA 4AX1B 2BMIA 4UWOB 2H6AA 5ACVA 5ACUA 5DPXA 4FR7A 3BV6A 2BFZA 5AEBA 2BG7A 1QH5A 4O98A 3SPUA 4EFZA 4AX0B 2R2DA 5LSCA 1E5DA 3QH8A 3FAIA 4EYFA 4PVTA 3T3OA 2FHXB 5A0TA 2Q0JA 3ZR9A 1X8HA 5AXOA 2GFJA 5LCAA 4DIKA 5HIQA 2WYLA 2ZZIA 3I11A 5LMCA 2P1EA 4V0HA 5ACPA 3SW3A 1SMLA 3AF6A 4JO0A 1ZNBA 4UWRB 4C1DA 4D1VA 3LVZA 2BIBA 4DILA 2FU6A 1WRAA 3TP9A 5ACQA 3AF5A 3BC2A 4RBSA 2P4ZA 3KNRA 4TYTA 2BGAA 2BG2A 3SD9A 1X8IA 2A7MA 4YSBA 3X30A 4C1CA 5ACRA 1A8TA 2GCUA 5HH4A 3VPEA 4U4LA 5EVDA 1KR3A 5LE1A 5ACWA 1MQOA 5EV8A 2DKFA 4BP0A 5AXRA 4F6HA 4BZ3A 4FSBA 4EXSA 3BK1A 2YNVA 3SBLA 3A4YA 4D1TA 4HKYA 1WUOA 4C1GA 4Z67A 2XR1A 2QJSA 2P97A 1KO2A 4C1EA 3IE1A 2QDTA 3IOFA 4NQ6A 2YCBA 2XF4A 4YSLA 1K07A 1ZTCA 2AZ4A 3VQZA 4RAWA 4UA4A 1P9EA 5HIPA 4RL2A 3RKKA 2DOOA 4EY2A 1DDKA 4EYLA 1L9YA 2YNUA 3SFPA 5K4NA 1VMEA 3S0ZA 1ZKPA 5FQAA 4XWTA 3IEKA 1YCFA 4Z6XA 5LCFA 1WUPA 4FEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UWP B;  2FHX A;  5B1U A;  4RM5 A;  3X2Y A;  2CBN A;  2FU8 A;  2WYM A;  2YZ3 A;  2NYP A;  3IEM A;  4Z7R A;  4PVO A;  5LLD A;  1A7T A;  4AWY B;  5AYA A;  3H3E A;  3WXC A;  5A5Z A;  5B15 A;  4F6Z A;  4EYB A;  2QED A;  4J5H A;  1JJT A;  5B3R A;  2ZNB A;  4ZO2 A;  5EVK A;  3R2U A;  3IE0 A;  1BVT A;  5LCH A;  4KEQ A;  4TYF A;  2YNV B;  4HL2 A;  3I0V A;  3Q6V A;  5EH9 A;  4RL0 A;  1VJN A;  2M5D A;  3BK2 A;  1KO3 A;  1M2X A;  3I14 A;  1JJE A;  5EVB A;  5ACT A;  4XUK A;  2QIN A;  2M5C A;  2OHI A;  1WW1 A;  2BC2 A;  4H0D A;  2Y87 A;  4ZO3 A;  3X2Z A;  5A87 A;  4NQ2 A;  3AJ3 A;  3PY6 A;  4TZE A;  3ESH A;  4GYQ A;  4RAM A;  3P2U A;  4YSK A;  2NZF A;  4GCW A;  3I15 A;  4HL1 A;  2YNT A;  1Y44 A;  5EHT A;  2HB9 A;  3PG4 A;  2GFK A;  4D1W A;  4AWZ A;  2QDS A;  3ZQ4 A;  3FCZ A;  3RKJ A;  2OHH A;  5LS3 A;  3IEL A;  2Y8A A;  3DHA A;  3G1P A;  1YCH A;  3ZNB A;  4LE6 A;  5HH6 A;  2BTN A;  1DXK A;  5K4K A;  4TZ9 A;  5ACS A;  1BC2 A;  4TZB A;  5HH5 A;  2VW8 A;  4ZEJ A;  4P62 A;  4ZNB A;  2Q0I A;  2I7X A;  2GKL A;  3F9O A;  4GYU A;  5HIS A;  5IQK A;  3ADR A;  3I13 A;  2Q9U A;  1VGN A;  3DHB A;  5ACX A;  1DD6 A;  2GMN A;  4C1F A;  3KNS A;  1HLK A;  2FU9 A;  3PY5 A;  2BFZ B;  1XM8 A;  2BFK A;  4Z5Y A;  4C1H A;  2ZWR A;  4D1U A;  2I7T A;  2ZO4 A;  5HIO A;  4UWS B;  2P18 A;  4KEP A;  2NXA A;  2Q42 A;  4XWW A;  5KIK A;  3SRX A;  1XTO A;  2BG8 A;  1YCG A;  5FQB A;  4EXY A;  5KIL A;  3IE2 A;  3RPC A;  2I7V A;  4TZF A;  4UBQ A;  4Z60 A;  1QH3 A;  5EW0 A;  4WD6 A;  4NQ4 A;  3L6N A;  5FQC A;  4UAM A;  2NZE A;  2WRS A;  1BMC A;  2YNT B;  5EV6 A;  2UYX A;  2WYM C;  4C09 A;  3DHC A;  2FK6 A;  5LM6 A;  3X2X A;  3ZWF A;  2YNW A;  2Y8B A;  2E7Y A;  3KL7 A;  2OHJ A;  2BFL A;  2BR6 A;  3IOG A;  5AHO A;  2FU7 A;  1JT1 A;  3DH8 A;  5A0V A;  3JXP A;  5EWA A;  3T9M A;  2BG6 A;  4AD9 A;  3IDZ A;  3MD7 A;  2BG8 B;  4Z5Z A;  5K0W A;  5K4M A;  4B87 A;  2AIO A;  1X8G A;  2FM6 A;  4D02 A;  4J5F A;  5AHR A;  2WHG A;  4NQ5 A;  4CHL A;  3T3N A;  4AX1 B;  2BMI A;  4UWO B;  2H6A A;  5ACV A;  5ACU A;  5DPX A;  4FR7 A;  3BV6 A;  2BFZ A;  5AEB A;  2BG7 A;  1QH5 A;  4O98 A;  3SPU A;  4EFZ A;  4AX0 B;  2R2D A;  5LSC A;  1E5D A;  3QH8 A;  3FAI A;  4EYF A;  4PVT A;  3T3O A;  2FHX B;  5A0T A;  2Q0J A;  3ZR9 A;  1X8H A;  5AXO A;  2GFJ A;  5LCA A;  4DIK A;  5HIQ A;  2WYL A;  2ZZI A;  3I11 A;  5LMC A;  2P1E A;  4V0H A;  5ACP A;  3SW3 A;  1SML A;  3AF6 A;  4JO0 A;  1ZNB A;  4UWR B;  4C1D A;  4D1V A;  3LVZ A;  2BIB A;  4DIL A;  2FU6 A;  1WRA A;  3TP9 A;  5ACQ A;  3AF5 A;  3BC2 A;  4RBS A;  2P4Z A;  3KNR A;  4TYT A;  2BGA A;  2BG2 A;  3SD9 A;  1X8I A;  2A7M A;  4YSB A;  3X30 A;  4C1C A;  5ACR A;  1A8T A;  2GCU A;  5HH4 A;  3VPE A;  4U4L A;  5EVD A;  1KR3 A;  5LE1 A;  5ACW A;  1MQO A;  5EV8 A;  2DKF A;  4BP0 A;  5AXR A;  4F6H A;  4BZ3 A;  4FSB A;  4EXS A;  3BK1 A;  2YNV A;  3SBL A;  3A4Y A;  4D1T A;  4HKY A;  1WUO A;  4C1G A;  4Z67 A;  2XR1 A;  2QJS A;  2P97 A;  1KO2 A;  4C1E A;  3IE1 A;  2QDT A;  3IOF A;  4NQ6 A;  2YCB A;  2XF4 A;  4YSL A;  1K07 A;  1ZTC A;  2AZ4 A;  3VQZ A;  4RAW A;  4UA4 A;  1P9E A;  5HIP A;  4RL2 A;  3RKK A;  2DOO A;  4EY2 A;  1DDK A;  4EYL A;  1L9Y A;  2YNU A;  3SFP A;  5K4N A;  1VME A;  3S0Z A;  1ZKP A;  5FQA A;  4XWT A;  3IEK A;  1YCF A;  4Z6X A;  5LCF A;  1WUP A;  4FEK A; 
#chains in the Genus database with same CATH topology
 4UWP B;  2FHX A;  5B1U A;  4RM5 A;  3X2Y A;  2CBN A;  2FU8 A;  2WYM A;  2YZ3 A;  2NYP A;  3IEM A;  4Z7R A;  4PVO A;  5LLD A;  1A7T A;  4AWY B;  5AJL A;  5AYA A;  3H3E A;  3WXC A;  5A5Z A;  5B15 A;  4F6Z A;  4EYB A;  2QED A;  4J5H A;  1JJT A;  5B3R A;  2ZNB A;  4ZO2 A;  5EVK A;  3R2U A;  3IE0 A;  1BVT A;  5LCH A;  4KEQ A;  4TYF A;  2YNV B;  4AV7 A;  4HL2 A;  3I0V A;  3Q6V A;  5EH9 A;  4RL0 A;  1VJN A;  2M5D A;  3BK2 A;  1KO3 A;  1M2X A;  3I14 A;  1JJE A;  5EVB A;  5ACT A;  4XUK A;  2QIN A;  2M5C A;  2OHI A;  1WW1 A;  2BC2 A;  4H0D A;  2Y87 A;  4ZO3 A;  3X2Z A;  5A87 A;  4NQ2 A;  3AJ3 A;  3PY6 A;  4TZE A;  3ESH A;  2CG3 A;  4GYQ A;  4RAM A;  3P2U A;  4YSK A;  2NZF A;  4GCW A;  3I15 A;  4HL1 A;  2YNT A;  1Y44 A;  5EHT A;  2HB9 A;  3PG4 A;  2GFK A;  4D1W A;  4AWZ A;  2QDS A;  3ZQ4 A;  3FCZ A;  3RKJ A;  2OHH A;  5LS3 A;  3IEL A;  2Y8A A;  3DHA A;  3G1P A;  1YCH A;  3ZNB A;  4LE6 A;  5HH6 A;  2BTN A;  1DXK A;  5K4K A;  4TZ9 A;  5ACS A;  1BC2 A;  4TZB A;  5HH5 A;  2VW8 A;  4ZEJ A;  4P62 A;  4ZNB A;  2Q0I A;  2I7X A;  2GKL A;  3F9O A;  4GYU A;  5HIS A;  5IQK A;  3ADR A;  3I13 A;  4PDX A;  2Q9U A;  1VGN A;  3DHB A;  5ACX A;  1DD6 A;  2GMN A;  4C1F A;  3KNS A;  1HLK A;  2FU9 A;  3PY5 A;  2BFZ B;  1XM8 A;  2BFK A;  4Z5Y A;  4C1H A;  2ZWR A;  4D1U A;  2I7T A;  2ZO4 A;  5HIO A;  4UWS B;  2P18 A;  4KEP A;  2NXA A;  2Q42 A;  4XWW A;  5KIK A;  3SRX A;  1XTO A;  2BG8 A;  5A23 A;  1YCG A;  5FQB A;  4EXY A;  5KIL A;  3IE2 A;  3RPC A;  2I7V A;  4TZF A;  4UBQ A;  4Z60 A;  1QH3 A;  5EW0 A;  4WD6 A;  4NQ4 A;  3L6N A;  5FQC A;  4UAM A;  2NZE A;  2WRS A;  1BMC A;  2YNT B;  5EV6 A;  2UYX A;  2WYM C;  4C09 A;  3DHC A;  2FK6 A;  5LM6 A;  3X2X A;  3ZWF A;  2YNW A;  2Y8B A;  2E7Y A;  3KL7 A;  2OHJ A;  2BFL A;  2BR6 A;  3IOG A;  5AHO A;  2FU7 A;  1JT1 A;  3DH8 A;  5A0V A;  3JXP A;  5EWA A;  3T9M A;  2BG6 A;  4AD9 A;  3IDZ A;  3MD7 A;  2BG8 B;  2CFZ A;  4Z5Z A;  5K0W A;  5K4M A;  4B87 A;  2AIO A;  1X8G A;  2FM6 A;  4D02 A;  4J5F A;  5AHR A;  2WHG A;  4NQ5 A;  4CHL A;  3T3N A;  4AX1 B;  2BMI A;  4UWO B;  2H6A A;  5ACV A;  5ACU A;  5DPX A;  4FR7 A;  3BV6 A;  2BFZ A;  5AEB A;  2BG7 A;  1QH5 A;  4O98 A;  3SPU A;  4EFZ A;  4AX0 B;  2R2D A;  5LSC A;  1E5D A;  3QH8 A;  3FAI A;  4EYF A;  4PVT A;  3T3O A;  2FHX B;  5A0T A;  2Q0J A;  3ZR9 A;  1X8H A;  5AXO A;  2GFJ A;  5LCA A;  4DIK A;  5HIQ A;  2WYL A;  2ZZI A;  3I11 A;  5LMC A;  2P1E A;  4V0H A;  5ACP A;  3SW3 A;  1SML A;  3AF6 A;  4JO0 A;  1ZNB A;  4UWR B;  4C1D A;  4D1V A;  3LVZ A;  2BIB A;  4DIL A;  2FU6 A;  1WRA A;  3TP9 A;  5ACQ A;  3AF5 A;  3BC2 A;  4RBS A;  4NUR A;  2P4Z A;  3KNR A;  4TYT A;  2BGA A;  2BG2 A;  3SD9 A;  1X8I A;  2A7M A;  4YSB A;  3X30 A;  4C1C A;  5ACR A;  1A8T A;  2GCU A;  5HH4 A;  3VPE A;  4U4L A;  5EVD A;  1KR3 A;  5LE1 A;  2CG2 A;  2CFU A;  5ACW A;  1MQO A;  5EV8 A;  2DKF A;  4BP0 A;  5AXR A;  4F6H A;  4BZ3 A;  4FSB A;  4EXS A;  3BK1 A;  2YNV A;  3SBL A;  3A4Y A;  4D1T A;  4HKY A;  1WUO A;  4C1G A;  4Z67 A;  2XR1 A;  2QJS A;  2P97 A;  1KO2 A;  4C1E A;  3IE1 A;  2QDT A;  3IOF A;  4NQ6 A;  2YCB A;  2XF4 A;  4YSL A;  4AXH A;  1K07 A;  1ZTC A;  2AZ4 A;  3VQZ A;  4RAW A;  4UA4 A;  1P9E A;  5HIP A;  4RL2 A;  3RKK A;  2DOO A;  4EY2 A;  1DDK A;  4EYL A;  1L9Y A;  2YNU A;  3SFP A;  5K4N A;  1VME A;  3S0Z A;  2YHE A;  1ZKP A;  5FQA A;  4XWT A;  3IEK A;  1YCF A;  4Z6X A;  5AIJ A;  5LCF A;  1WUP A;  4FEK A; 
#chains in the Genus database with same CATH homology
 4UWP B;  2FHX A;  5B1U A;  4RM5 A;  3X2Y A;  2CBN A;  2FU8 A;  2WYM A;  2YZ3 A;  2NYP A;  3IEM A;  4Z7R A;  4PVO A;  5LLD A;  1A7T A;  4AWY B;  5AYA A;  3H3E A;  3WXC A;  5A5Z A;  5B15 A;  4F6Z A;  4EYB A;  2QED A;  4J5H A;  1JJT A;  5B3R A;  2ZNB A;  4ZO2 A;  5EVK A;  3R2U A;  3IE0 A;  1BVT A;  5LCH A;  4KEQ A;  4TYF A;  2YNV B;  4HL2 A;  3I0V A;  3Q6V A;  5EH9 A;  4RL0 A;  1VJN A;  2M5D A;  3BK2 A;  1KO3 A;  1M2X A;  3I14 A;  1JJE A;  5EVB A;  5ACT A;  4XUK A;  2QIN A;  2M5C A;  2OHI A;  1WW1 A;  2BC2 A;  4H0D A;  2Y87 A;  4ZO3 A;  3X2Z A;  5A87 A;  4NQ2 A;  3AJ3 A;  3PY6 A;  4TZE A;  3ESH A;  4GYQ A;  4RAM A;  3P2U A;  4YSK A;  2NZF A;  4GCW A;  3I15 A;  4HL1 A;  2YNT A;  1Y44 A;  5EHT A;  2HB9 A;  3PG4 A;  2GFK A;  4D1W A;  4AWZ A;  2QDS A;  3ZQ4 A;  3FCZ A;  3RKJ A;  2OHH A;  5LS3 A;  3IEL A;  2Y8A A;  3DHA A;  3G1P A;  1YCH A;  3ZNB A;  4LE6 A;  5HH6 A;  2BTN A;  1DXK A;  5K4K A;  4TZ9 A;  5ACS A;  1BC2 A;  4TZB A;  5HH5 A;  2VW8 A;  4ZEJ A;  4P62 A;  4ZNB A;  2Q0I A;  2I7X A;  2GKL A;  3F9O A;  4GYU A;  5HIS A;  5IQK A;  3ADR A;  3I13 A;  2Q9U A;  1VGN A;  3DHB A;  5ACX A;  1DD6 A;  2GMN A;  4C1F A;  3KNS A;  1HLK A;  2FU9 A;  3PY5 A;  2BFZ B;  1XM8 A;  2BFK A;  4Z5Y A;  4C1H A;  2ZWR A;  4D1U A;  2I7T A;  2ZO4 A;  5HIO A;  4UWS B;  2P18 A;  4KEP A;  2NXA A;  2Q42 A;  4XWW A;  5KIK A;  3SRX A;  1XTO A;  2BG8 A;  1YCG A;  5FQB A;  4EXY A;  5KIL A;  3IE2 A;  3RPC A;  2I7V A;  4TZF A;  4UBQ A;  4Z60 A;  1QH3 A;  5EW0 A;  4WD6 A;  4NQ4 A;  3L6N A;  5FQC A;  4UAM A;  2NZE A;  2WRS A;  1BMC A;  2YNT B;  5EV6 A;  2UYX A;  2WYM C;  4C09 A;  3DHC A;  2FK6 A;  5LM6 A;  3X2X A;  3ZWF A;  2YNW A;  2Y8B A;  2E7Y A;  3KL7 A;  2OHJ A;  2BFL A;  2BR6 A;  3IOG A;  5AHO A;  2FU7 A;  1JT1 A;  3DH8 A;  5A0V A;  3JXP A;  5EWA A;  3T9M A;  2BG6 A;  4AD9 A;  3IDZ A;  3MD7 A;  2BG8 B;  4Z5Z A;  5K0W A;  5K4M A;  4B87 A;  2AIO A;  1X8G A;  2FM6 A;  4D02 A;  4J5F A;  5AHR A;  2WHG A;  4NQ5 A;  4CHL A;  3T3N A;  4AX1 B;  2BMI A;  4UWO B;  2H6A A;  5ACV A;  5ACU A;  5DPX A;  4FR7 A;  3BV6 A;  2BFZ A;  5AEB A;  2BG7 A;  1QH5 A;  4O98 A;  3SPU A;  4EFZ A;  4AX0 B;  2R2D A;  5LSC A;  1E5D A;  3QH8 A;  3FAI A;  4EYF A;  4PVT A;  3T3O A;  2FHX B;  5A0T A;  2Q0J A;  3ZR9 A;  1X8H A;  5AXO A;  2GFJ A;  5LCA A;  4DIK A;  5HIQ A;  2WYL A;  2ZZI A;  3I11 A;  5LMC A;  2P1E A;  4V0H A;  5ACP A;  3SW3 A;  1SML A;  3AF6 A;  4JO0 A;  1ZNB A;  4UWR B;  4C1D A;  4D1V A;  3LVZ A;  2BIB A;  4DIL A;  2FU6 A;  1WRA A;  3TP9 A;  5ACQ A;  3AF5 A;  3BC2 A;  4RBS A;  2P4Z A;  3KNR A;  4TYT A;  2BGA A;  2BG2 A;  3SD9 A;  1X8I A;  2A7M A;  4YSB A;  3X30 A;  4C1C A;  5ACR A;  1A8T A;  2GCU A;  5HH4 A;  3VPE A;  4U4L A;  5EVD A;  1KR3 A;  5LE1 A;  5ACW A;  1MQO A;  5EV8 A;  2DKF A;  4BP0 A;  5AXR A;  4F6H A;  4BZ3 A;  4FSB A;  4EXS A;  3BK1 A;  2YNV A;  3SBL A;  3A4Y A;  4D1T A;  4HKY A;  1WUO A;  4C1G A;  4Z67 A;  2XR1 A;  2QJS A;  2P97 A;  1KO2 A;  4C1E A;  3IE1 A;  2QDT A;  3IOF A;  4NQ6 A;  2YCB A;  2XF4 A;  4YSL A;  1K07 A;  1ZTC A;  2AZ4 A;  3VQZ A;  4RAW A;  4UA4 A;  1P9E A;  5HIP A;  4RL2 A;  3RKK A;  2DOO A;  4EY2 A;  1DDK A;  4EYL A;  1L9Y A;  2YNU A;  3SFP A;  5K4N A;  1VME A;  3S0Z A;  1ZKP A;  5FQA A;  4XWT A;  3IEK A;  1YCF A;  4Z6X A;  5LCF A;  1WUP A;  4FEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...