5EH9A

Indirect contributions of mutations underlie optimization of new enzyme function
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
253
structure length
253
Chain Sequence
GHMATVKKLYFVPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIETEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Tinkering Drives Evolution of a Promiscuous Activity through Indirect Mutational Effects.
pubmed doi rcsb
source organism Bacillus thuringiensis subsp. kurstaki
molecule tags Hydrolase
molecule keywords N-acyl homoserine lactonase AiiA
total genus 81
structure length 253
sequence length 253
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5eh9A01
3VPEA 5EH9A 4UWOB 5LLDA 4HL2A 2GFJA 1A7TA 5EVDA 1QH5A 2YNUA 3IEKA 2BMIA 2I7XA 1JJEA 2M5DA 5AHOA 4TZEA 5HIQA 4RM5A 4RBSA 4UWPB 3IOFA 2AIOA 2FU9A 3AF6A 4AWYB 4ZO3A 2BG2A 2NZEA 3BV6A 4U4LA 3IE1A 4D1WA 3I11A 3SFPA 4J5HA 4KEPA 2BFZB 3MD7A 4BP0A 5EV6A 3T3OA 4RL2A 2P4ZA 4GCWA 2BIBA 2Q42A 2WYMA 1A8TA 5HH6A 4YSBA 2Q0JA 2Y87A 1BVTA 4DIKA 5AYAA 5EV8A 2NXAA 4TZBA 3AF5A 2YZ3A 3WXCA 2Q0IA 2QINA 1SMLA 4UA4A 2H6AA 5ACXA 4XWTA 2YNVB 4FR7A 3A4YA 2GFKA 3DHAA 3F9OA 1DD6A 3X2YA 2NYPA 2YNTA 4KEQA 2YNTB 3SW3A 1P9EA 5ACQA 1DXKA 4ZEJA 4J5FA 4TZFA 1ZTCA 4UAMA 4NQ5A 2OHHA 5DPXA 3FCZA 5EVKA 5B1UA 2FU6A 2R2DA 2CBNA 3IOGA 1VMEA 4LE6A 5ACWA 3ZQ4A 4C09A 2M5CA 4CHLA 3RKKA 3P2UA 1ZNBA 4DILA 1WUOA 1L9YA 5HIOA 2QDSA 3RKJA 3SBLA 2BG7A 4Z5ZA 4EXYA 2WYLA 4Z67A 4WD6A 2BFKA 1E5DA 5EW0A 5LSCA 4RL0A 5A5ZA 4AX1B 2YNVA 3PY5A 4AD9A 1JJTA 1BMCA 3I15A 4TYTA 4NQ2A 2QEDA 4H0DA 5B3RA 1DDKA 3X2XA 2BG6A 2DKFA 3PY6A 3IDZA 3ZNBA 5LCFA 4D02A 4C1DA 4RAWA 2FU8A 1JT1A 2BTNA 1YCHA 3SPUA 2ZO4A 3KL7A 5AXRA 4C1GA 3QH8A 4C1FA 2AZ4A 3I13A 5K4NA 5EHTA 4PVOA 3SRXA 5ACVA 4UBQA 4EYFA 5FQCA 5HIPA 3G1PA 3BK1A 1YCGA 5LE1A 4EYBA 4EYLA 2FHXA 2NZFA 3X30A 4UWRB 1YCFA 2OHJA 1ZKPA 4EFZA 2Y8AA 5EWAA 2WHGA 3ESHA 2DOOA 5HISA 1VJNA 5K4KA 3AJ3A 4F6HA 4D1UA 2P1EA 2BG8B 1KR3A 3ADRA 4O98A 5LMCA 2Q9UA 2QJSA 4B87A 2GKLA 5ACPA 5LM6A 4P62A 5ACSA 2XF4A 1BC2A 4TYFA 4C1HA 3IE0A 5FQAA 4C1CA 3BC2A 5IQKA 4AX0B 2XR1A 4FSBA 1Y44A 3IE2A 1X8IA 4UWSB 3BK2A 4GYUA 5LCHA 5AXOA 5HH4A 2P97A 1WRAA 3SD9A 3VQZA 3ZWFA 3JXPA 3DH8A 5EVBA 4JO0A 4EY2A 1X8HA 5AHRA 4EXSA 4YSKA 4D1TA 2BC2A 4F6ZA 3IELA 5A0TA 2QDTA 4C1EA 5A87A 4XWWA 3KNRA 4XUKA 2VW8A 5AEBA 2FHXB 4PVTA 2A7MA 2OHIA 5KILA 2BR6A 1M2XA 1QH3A 3TP9A 1WW1A 1X8GA 3FAIA 1XM8A 3T3NA 3DHCA 3DHBA 5ACUA 2E7YA 3R2UA 3Q6VA 4D1VA 1MQOA 2BG8A 4Z7RA 4AWZA 2BGAA 1XTOA 2BFZA 3LVZA 4ZO2A 4Z60A 4Z5YA 5B15A 1K07A 2YCBA 3ZR9A 4BZ3A 4GYQA 2I7VA 5ACTA 2Y8BA 2HB9A 4Z6XA 2BFLA 3I0VA 1KO3A 2I7TA 4YSLA 2UYXA 5K4MA 4RAMA 4ZNBA 2FM6A 1KO2A 5LCAA 5K0WA 2ZZIA 2ZWRA 5FQBA 3X2ZA 3H3EA 4NQ4A 2FU7A 2ZNBA 2GMNA 4NQ6A 2WYMC 4HL1A 1WUPA 5ACRA 2WRSA 4FEKA 4TZ9A 2GCUA 4HKYA 5KIKA 3S0ZA 3L6NA 2P18A 1VGNA 5A0VA 3PG4A 5HH5A 2FK6A 5LS3A 2YNWA 4V0HA 3T9MA 1HLKA 3IEMA 3KNSA 3RPCA 3I14A
chains in the Genus database with same CATH superfamily
3VPEA 5EH9A 4UWOB 5LLDA 4HL2A 2GFJA 1A7TA 5EVDA 1QH5A 2YNUA 3IEKA 2BMIA 2I7XA 1JJEA 2M5DA 5AHOA 4TZEA 5HIQA 4RM5A 4RBSA 4UWPB 3IOFA 2AIOA 2FU9A 3AF6A 4AWYB 4ZO3A 2BG2A 2NZEA 3BV6A 4U4LA 3IE1A 4D1WA 3I11A 3SFPA 4J5HA 4KEPA 2BFZB 3MD7A 4BP0A 5EV6A 3T3OA 4PDXA 4RL2A 2P4ZA 2CFUA 4GCWA 2BIBA 2Q42A 2WYMA 1A8TA 5A23A 5HH6A 4YSBA 2Q0JA 2Y87A 1BVTA 4DIKA 5AYAA 5EV8A 2NXAA 4TZBA 3AF5A 2YZ3A 3WXCA 2Q0IA 2QINA 1SMLA 4UA4A 2H6AA 5ACXA 2CG3A 4XWTA 2YNVB 4FR7A 3A4YA 2GFKA 4AXHA 3DHAA 3F9OA 1DD6A 3X2YA 2NYPA 2YNTA 4KEQA 2YNTB 3SW3A 1P9EA 5ACQA 1DXKA 4ZEJA 4J5FA 4TZFA 1ZTCA 4UAMA 4NQ5A 2OHHA 5DPXA 3FCZA 5EVKA 5B1UA 2FU6A 2R2DA 2CBNA 3IOGA 1VMEA 4LE6A 5ACWA 3ZQ4A 4C09A 2M5CA 4CHLA 3RKKA 2YHEA 3P2UA 1ZNBA 4DILA 1WUOA 1L9YA 5HIOA 2QDSA 3RKJA 3SBLA 2BG7A 4Z5ZA 4EXYA 2WYLA 4Z67A 4WD6A 2BFKA 1E5DA 5EW0A 5LSCA 5AIJA 4RL0A 5A5ZA 4AX1B 2YNVA 3PY5A 4AD9A 1JJTA 1BMCA 3I15A 4NURA 4TYTA 4NQ2A 2QEDA 4H0DA 5B3RA 1DDKA 3X2XA 2BG6A 2DKFA 3PY6A 3IDZA 3ZNBA 5LCFA 4D02A 4C1DA 4RAWA 2FU8A 1JT1A 2BTNA 1YCHA 3SPUA 2ZO4A 3KL7A 5AXRA 4C1GA 3QH8A 4C1FA 2AZ4A 3I13A 5K4NA 5EHTA 4PVOA 3SRXA 5ACVA 4UBQA 4EYFA 5FQCA 5HIPA 3G1PA 3BK1A 1YCGA 5LE1A 4EYBA 4EYLA 2FHXA 2NZFA 3X30A 4UWRB 1YCFA 2OHJA 1ZKPA 4AV7A 4EFZA 2Y8AA 5EWAA 2WHGA 3ESHA 2DOOA 5HISA 1VJNA 5K4KA 3AJ3A 4F6HA 4D1UA 2P1EA 2BG8B 1KR3A 3ADRA 4O98A 5LMCA 2Q9UA 2QJSA 4B87A 2GKLA 5ACPA 5LM6A 4P62A 5ACSA 2XF4A 1BC2A 4TYFA 4C1HA 3IE0A 5FQAA 4C1CA 3BC2A 5IQKA 4AX0B 2XR1A 4FSBA 1Y44A 3IE2A 1X8IA 4UWSB 3BK2A 4GYUA 5LCHA 5AXOA 5HH4A 2P97A 1WRAA 3SD9A 3VQZA 3ZWFA 3JXPA 3DH8A 5EVBA 4JO0A 4EY2A 1X8HA 5AHRA 4EXSA 4YSKA 4D1TA 2BC2A 4F6ZA 3IELA 5A0TA 2QDTA 4C1EA 5A87A 4XWWA 3KNRA 4XUKA 2VW8A 5AEBA 2FHXB 4PVTA 2A7MA 2OHIA 5KILA 2BR6A 1M2XA 1QH3A 3TP9A 1WW1A 1X8GA 3FAIA 1XM8A 3T3NA 3DHCA 3DHBA 5ACUA 2E7YA 3R2UA 3Q6VA 4D1VA 1MQOA 2BG8A 5AJLA 4Z7RA 4AWZA 2BGAA 1XTOA 2BFZA 3LVZA 4ZO2A 4Z60A 2CFZA 4Z5YA 5B15A 1K07A 2YCBA 3ZR9A 4BZ3A 4GYQA 2I7VA 5ACTA 2Y8BA 2HB9A 4Z6XA 2BFLA 3I0VA 1KO3A 2I7TA 4YSLA 2UYXA 5K4MA 4RAMA 4ZNBA 2FM6A 1KO2A 5LCAA 5K0WA 2ZZIA 2ZWRA 5FQBA 3X2ZA 3H3EA 4NQ4A 2FU7A 2ZNBA 2GMNA 4NQ6A 2WYMC 4HL1A 1WUPA 5ACRA 2WRSA 4FEKA 4TZ9A 2GCUA 4HKYA 5KIKA 3S0ZA 3L6NA 2P18A 1VGNA 2CG2A 5A0VA 3PG4A 5HH5A 2FK6A 5LS3A 2YNWA 4V0HA 3T9MA 1HLKA 3IEMA 3KNSA 3RPCA 3I14A
chains in the Genus database with same CATH topology
3VPEA 5EH9A 4UWOB 5LLDA 4HL2A 2GFJA 1A7TA 5EVDA 1QH5A 2YNUA 3IEKA 2BMIA 2I7XA 1JJEA 2M5DA 5AHOA 4TZEA 5HIQA 4RM5A 4RBSA 4UWPB 3IOFA 2AIOA 2FU9A 3AF6A 4AWYB 4ZO3A 2BG2A 2NZEA 3BV6A 4U4LA 3IE1A 4D1WA 3I11A 3SFPA 4J5HA 4KEPA 2BFZB 3MD7A 4BP0A 5EV6A 3T3OA 4RL2A 2P4ZA 4GCWA 2BIBA 2Q42A 2WYMA 1A8TA 5HH6A 4YSBA 2Q0JA 2Y87A 1BVTA 4DIKA 5AYAA 5EV8A 2NXAA 4TZBA 3AF5A 2YZ3A 3WXCA 2Q0IA 2QINA 1SMLA 4UA4A 2H6AA 5ACXA 4XWTA 2YNVB 4FR7A 3A4YA 2GFKA 3DHAA 3F9OA 1DD6A 3X2YA 2NYPA 2YNTA 4KEQA 2YNTB 3SW3A 1P9EA 5ACQA 1DXKA 4ZEJA 4J5FA 4TZFA 1ZTCA 4UAMA 4NQ5A 2OHHA 5DPXA 3FCZA 5EVKA 5B1UA 2FU6A 2R2DA 2CBNA 3IOGA 1VMEA 4LE6A 5ACWA 3ZQ4A 4C09A 2M5CA 4CHLA 3RKKA 3P2UA 1ZNBA 4DILA 1WUOA 1L9YA 5HIOA 2QDSA 3RKJA 3SBLA 2BG7A 4Z5ZA 4EXYA 2WYLA 4Z67A 4WD6A 2BFKA 1E5DA 5EW0A 5LSCA 4RL0A 5A5ZA 4AX1B 2YNVA 3PY5A 4AD9A 1JJTA 1BMCA 3I15A 4TYTA 4NQ2A 2QEDA 4H0DA 5B3RA 1DDKA 3X2XA 2BG6A 2DKFA 3PY6A 3IDZA 3ZNBA 5LCFA 4D02A 4C1DA 4RAWA 2FU8A 1JT1A 2BTNA 1YCHA 3SPUA 2ZO4A 3KL7A 5AXRA 4C1GA 3QH8A 4C1FA 2AZ4A 3I13A 5K4NA 5EHTA 4PVOA 3SRXA 5ACVA 4UBQA 4EYFA 5FQCA 5HIPA 3G1PA 3BK1A 1YCGA 5LE1A 4EYBA 4EYLA 2FHXA 2NZFA 3X30A 4UWRB 1YCFA 2OHJA 1ZKPA 4EFZA 2Y8AA 5EWAA 2WHGA 3ESHA 2DOOA 5HISA 1VJNA 5K4KA 3AJ3A 4F6HA 4D1UA 2P1EA 2BG8B 1KR3A 3ADRA 4O98A 5LMCA 2Q9UA 2QJSA 4B87A 2GKLA 5ACPA 5LM6A 4P62A 5ACSA 2XF4A 1BC2A 4TYFA 4C1HA 3IE0A 5FQAA 4C1CA 3BC2A 5IQKA 4AX0B 2XR1A 4FSBA 1Y44A 3IE2A 1X8IA 4UWSB 3BK2A 4GYUA 5LCHA 5AXOA 5HH4A 2P97A 1WRAA 3SD9A 3VQZA 3ZWFA 3JXPA 3DH8A 5EVBA 4JO0A 4EY2A 1X8HA 5AHRA 4EXSA 4YSKA 4D1TA 2BC2A 4F6ZA 3IELA 5A0TA 2QDTA 4C1EA 5A87A 4XWWA 3KNRA 4XUKA 2VW8A 5AEBA 2FHXB 4PVTA 2A7MA 2OHIA 5KILA 2BR6A 1M2XA 1QH3A 3TP9A 1WW1A 1X8GA 3FAIA 1XM8A 3T3NA 3DHCA 3DHBA 5ACUA 2E7YA 3R2UA 3Q6VA 4D1VA 1MQOA 2BG8A 4Z7RA 4AWZA 2BGAA 1XTOA 2BFZA 3LVZA 4ZO2A 4Z60A 4Z5YA 5B15A 1K07A 2YCBA 3ZR9A 4BZ3A 4GYQA 2I7VA 5ACTA 2Y8BA 2HB9A 4Z6XA 2BFLA 3I0VA 1KO3A 2I7TA 4YSLA 2UYXA 5K4MA 4RAMA 4ZNBA 2FM6A 1KO2A 5LCAA 5K0WA 2ZZIA 2ZWRA 5FQBA 3X2ZA 3H3EA 4NQ4A 2FU7A 2ZNBA 2GMNA 4NQ6A 2WYMC 4HL1A 1WUPA 5ACRA 2WRSA 4FEKA 4TZ9A 2GCUA 4HKYA 5KIKA 3S0ZA 3L6NA 2P18A 1VGNA 5A0VA 3PG4A 5HH5A 2FK6A 5LS3A 2YNWA 4V0HA 3T9MA 1HLKA 3IEMA 3KNSA 3RPCA 3I14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VPE A;  5EH9 A;  4UWO B;  5LLD A;  4HL2 A;  2GFJ A;  1A7T A;  5EVD A;  1QH5 A;  2YNU A;  3IEK A;  2BMI A;  2I7X A;  1JJE A;  2M5D A;  5AHO A;  4TZE A;  5HIQ A;  4RM5 A;  4RBS A;  4UWP B;  3IOF A;  2AIO A;  2FU9 A;  3AF6 A;  4AWY B;  4ZO3 A;  2BG2 A;  2NZE A;  3BV6 A;  4U4L A;  3IE1 A;  4D1W A;  3I11 A;  3SFP A;  4J5H A;  4KEP A;  2BFZ B;  3MD7 A;  4BP0 A;  5EV6 A;  3T3O A;  4RL2 A;  2P4Z A;  4GCW A;  2BIB A;  2Q42 A;  2WYM A;  1A8T A;  5HH6 A;  4YSB A;  2Q0J A;  2Y87 A;  1BVT A;  4DIK A;  5AYA A;  5EV8 A;  2NXA A;  4TZB A;  3AF5 A;  2YZ3 A;  3WXC A;  2Q0I A;  2QIN A;  1SML A;  4UA4 A;  2H6A A;  5ACX A;  4XWT A;  2YNV B;  4FR7 A;  3A4Y A;  2GFK A;  3DHA A;  3F9O A;  1DD6 A;  3X2Y A;  2NYP A;  2YNT A;  4KEQ A;  2YNT B;  3SW3 A;  1P9E A;  5ACQ A;  1DXK A;  4ZEJ A;  4J5F A;  4TZF A;  1ZTC A;  4UAM A;  4NQ5 A;  2OHH A;  5DPX A;  3FCZ A;  5EVK A;  5B1U A;  2FU6 A;  2R2D A;  2CBN A;  3IOG A;  1VME A;  4LE6 A;  5ACW A;  3ZQ4 A;  4C09 A;  2M5C A;  4CHL A;  3RKK A;  3P2U A;  1ZNB A;  4DIL A;  1WUO A;  1L9Y A;  5HIO A;  2QDS A;  3RKJ A;  3SBL A;  2BG7 A;  4Z5Z A;  4EXY A;  2WYL A;  4Z67 A;  4WD6 A;  2BFK A;  1E5D A;  5EW0 A;  5LSC A;  4RL0 A;  5A5Z A;  4AX1 B;  2YNV A;  3PY5 A;  4AD9 A;  1JJT A;  1BMC A;  3I15 A;  4TYT A;  4NQ2 A;  2QED A;  4H0D A;  5B3R A;  1DDK A;  3X2X A;  2BG6 A;  2DKF A;  3PY6 A;  3IDZ A;  3ZNB A;  5LCF A;  4D02 A;  4C1D A;  4RAW A;  2FU8 A;  1JT1 A;  2BTN A;  1YCH A;  3SPU A;  2ZO4 A;  3KL7 A;  5AXR A;  4C1G A;  3QH8 A;  4C1F A;  2AZ4 A;  3I13 A;  5K4N A;  5EHT A;  4PVO A;  3SRX A;  5ACV A;  4UBQ A;  4EYF A;  5FQC A;  5HIP A;  3G1P A;  3BK1 A;  1YCG A;  5LE1 A;  4EYB A;  4EYL A;  2FHX A;  2NZF A;  3X30 A;  4UWR B;  1YCF A;  2OHJ A;  1ZKP A;  4EFZ A;  2Y8A A;  5EWA A;  2WHG A;  3ESH A;  2DOO A;  5HIS A;  1VJN A;  5K4K A;  3AJ3 A;  4F6H A;  4D1U A;  2P1E A;  2BG8 B;  1KR3 A;  3ADR A;  4O98 A;  5LMC A;  2Q9U A;  2QJS A;  4B87 A;  2GKL A;  5ACP A;  5LM6 A;  4P62 A;  5ACS A;  2XF4 A;  1BC2 A;  4TYF A;  4C1H A;  3IE0 A;  5FQA A;  4C1C A;  3BC2 A;  5IQK A;  4AX0 B;  2XR1 A;  4FSB A;  1Y44 A;  3IE2 A;  1X8I A;  4UWS B;  3BK2 A;  4GYU A;  5LCH A;  5AXO A;  5HH4 A;  2P97 A;  1WRA A;  3SD9 A;  3VQZ A;  3ZWF A;  3JXP A;  3DH8 A;  5EVB A;  4JO0 A;  4EY2 A;  1X8H A;  5AHR A;  4EXS A;  4YSK A;  4D1T A;  2BC2 A;  4F6Z A;  3IEL A;  5A0T A;  2QDT A;  4C1E A;  5A87 A;  4XWW A;  3KNR A;  4XUK A;  2VW8 A;  5AEB A;  2FHX B;  4PVT A;  2A7M A;  2OHI A;  5KIL A;  2BR6 A;  1M2X A;  1QH3 A;  3TP9 A;  1WW1 A;  1X8G A;  3FAI A;  1XM8 A;  3T3N A;  3DHC A;  3DHB A;  5ACU A;  2E7Y A;  3R2U A;  3Q6V A;  4D1V A;  1MQO A;  2BG8 A;  4Z7R A;  4AWZ A;  2BGA A;  1XTO A;  2BFZ A;  3LVZ A;  4ZO2 A;  4Z60 A;  4Z5Y A;  5B15 A;  1K07 A;  2YCB A;  3ZR9 A;  4BZ3 A;  4GYQ A;  2I7V A;  5ACT A;  2Y8B A;  2HB9 A;  4Z6X A;  2BFL A;  3I0V A;  1KO3 A;  2I7T A;  4YSL A;  2UYX A;  5K4M A;  4RAM A;  4ZNB A;  2FM6 A;  1KO2 A;  5LCA A;  5K0W A;  2ZZI A;  2ZWR A;  5FQB A;  3X2Z A;  3H3E A;  4NQ4 A;  2FU7 A;  2ZNB A;  2GMN A;  4NQ6 A;  2WYM C;  4HL1 A;  1WUP A;  5ACR A;  2WRS A;  4FEK A;  4TZ9 A;  2GCU A;  4HKY A;  5KIK A;  3S0Z A;  3L6N A;  2P18 A;  1VGN A;  5A0V A;  3PG4 A;  5HH5 A;  2FK6 A;  5LS3 A;  2YNW A;  4V0H A;  3T9M A;  1HLK A;  3IEM A;  3KNS A;  3RPC A;  3I14 A; 
#chains in the Genus database with same CATH topology
 3VPE A;  5EH9 A;  4UWO B;  5LLD A;  4HL2 A;  2GFJ A;  1A7T A;  5EVD A;  1QH5 A;  2YNU A;  3IEK A;  2BMI A;  2I7X A;  1JJE A;  2M5D A;  5AHO A;  4TZE A;  5HIQ A;  4RM5 A;  4RBS A;  4UWP B;  3IOF A;  2AIO A;  2FU9 A;  3AF6 A;  4AWY B;  4ZO3 A;  2BG2 A;  2NZE A;  3BV6 A;  4U4L A;  3IE1 A;  4D1W A;  3I11 A;  3SFP A;  4J5H A;  4KEP A;  2BFZ B;  3MD7 A;  4BP0 A;  5EV6 A;  3T3O A;  4PDX A;  4RL2 A;  2P4Z A;  2CFU A;  4GCW A;  2BIB A;  2Q42 A;  2WYM A;  1A8T A;  5A23 A;  5HH6 A;  4YSB A;  2Q0J A;  2Y87 A;  1BVT A;  4DIK A;  5AYA A;  5EV8 A;  2NXA A;  4TZB A;  3AF5 A;  2YZ3 A;  3WXC A;  2Q0I A;  2QIN A;  1SML A;  4UA4 A;  2H6A A;  5ACX A;  2CG3 A;  4XWT A;  2YNV B;  4FR7 A;  3A4Y A;  2GFK A;  4AXH A;  3DHA A;  3F9O A;  1DD6 A;  3X2Y A;  2NYP A;  2YNT A;  4KEQ A;  2YNT B;  3SW3 A;  1P9E A;  5ACQ A;  1DXK A;  4ZEJ A;  4J5F A;  4TZF A;  1ZTC A;  4UAM A;  4NQ5 A;  2OHH A;  5DPX A;  3FCZ A;  5EVK A;  5B1U A;  2FU6 A;  2R2D A;  2CBN A;  3IOG A;  1VME A;  4LE6 A;  5ACW A;  3ZQ4 A;  4C09 A;  2M5C A;  4CHL A;  3RKK A;  2YHE A;  3P2U A;  1ZNB A;  4DIL A;  1WUO A;  1L9Y A;  5HIO A;  2QDS A;  3RKJ A;  3SBL A;  2BG7 A;  4Z5Z A;  4EXY A;  2WYL A;  4Z67 A;  4WD6 A;  2BFK A;  1E5D A;  5EW0 A;  5LSC A;  5AIJ A;  4RL0 A;  5A5Z A;  4AX1 B;  2YNV A;  3PY5 A;  4AD9 A;  1JJT A;  1BMC A;  3I15 A;  4NUR A;  4TYT A;  4NQ2 A;  2QED A;  4H0D A;  5B3R A;  1DDK A;  3X2X A;  2BG6 A;  2DKF A;  3PY6 A;  3IDZ A;  3ZNB A;  5LCF A;  4D02 A;  4C1D A;  4RAW A;  2FU8 A;  1JT1 A;  2BTN A;  1YCH A;  3SPU A;  2ZO4 A;  3KL7 A;  5AXR A;  4C1G A;  3QH8 A;  4C1F A;  2AZ4 A;  3I13 A;  5K4N A;  5EHT A;  4PVO A;  3SRX A;  5ACV A;  4UBQ A;  4EYF A;  5FQC A;  5HIP A;  3G1P A;  3BK1 A;  1YCG A;  5LE1 A;  4EYB A;  4EYL A;  2FHX A;  2NZF A;  3X30 A;  4UWR B;  1YCF A;  2OHJ A;  1ZKP A;  4AV7 A;  4EFZ A;  2Y8A A;  5EWA A;  2WHG A;  3ESH A;  2DOO A;  5HIS A;  1VJN A;  5K4K A;  3AJ3 A;  4F6H A;  4D1U A;  2P1E A;  2BG8 B;  1KR3 A;  3ADR A;  4O98 A;  5LMC A;  2Q9U A;  2QJS A;  4B87 A;  2GKL A;  5ACP A;  5LM6 A;  4P62 A;  5ACS A;  2XF4 A;  1BC2 A;  4TYF A;  4C1H A;  3IE0 A;  5FQA A;  4C1C A;  3BC2 A;  5IQK A;  4AX0 B;  2XR1 A;  4FSB A;  1Y44 A;  3IE2 A;  1X8I A;  4UWS B;  3BK2 A;  4GYU A;  5LCH A;  5AXO A;  5HH4 A;  2P97 A;  1WRA A;  3SD9 A;  3VQZ A;  3ZWF A;  3JXP A;  3DH8 A;  5EVB A;  4JO0 A;  4EY2 A;  1X8H A;  5AHR A;  4EXS A;  4YSK A;  4D1T A;  2BC2 A;  4F6Z A;  3IEL A;  5A0T A;  2QDT A;  4C1E A;  5A87 A;  4XWW A;  3KNR A;  4XUK A;  2VW8 A;  5AEB A;  2FHX B;  4PVT A;  2A7M A;  2OHI A;  5KIL A;  2BR6 A;  1M2X A;  1QH3 A;  3TP9 A;  1WW1 A;  1X8G A;  3FAI A;  1XM8 A;  3T3N A;  3DHC A;  3DHB A;  5ACU A;  2E7Y A;  3R2U A;  3Q6V A;  4D1V A;  1MQO A;  2BG8 A;  5AJL A;  4Z7R A;  4AWZ A;  2BGA A;  1XTO A;  2BFZ A;  3LVZ A;  4ZO2 A;  4Z60 A;  2CFZ A;  4Z5Y A;  5B15 A;  1K07 A;  2YCB A;  3ZR9 A;  4BZ3 A;  4GYQ A;  2I7V A;  5ACT A;  2Y8B A;  2HB9 A;  4Z6X A;  2BFL A;  3I0V A;  1KO3 A;  2I7T A;  4YSL A;  2UYX A;  5K4M A;  4RAM A;  4ZNB A;  2FM6 A;  1KO2 A;  5LCA A;  5K0W A;  2ZZI A;  2ZWR A;  5FQB A;  3X2Z A;  3H3E A;  4NQ4 A;  2FU7 A;  2ZNB A;  2GMN A;  4NQ6 A;  2WYM C;  4HL1 A;  1WUP A;  5ACR A;  2WRS A;  4FEK A;  4TZ9 A;  2GCU A;  4HKY A;  5KIK A;  3S0Z A;  3L6N A;  2P18 A;  1VGN A;  2CG2 A;  5A0V A;  3PG4 A;  5HH5 A;  2FK6 A;  5LS3 A;  2YNW A;  4V0H A;  3T9M A;  1HLK A;  3IEM A;  3KNS A;  3RPC A;  3I14 A; 
#chains in the Genus database with same CATH homology
 3VPE A;  5EH9 A;  4UWO B;  5LLD A;  4HL2 A;  2GFJ A;  1A7T A;  5EVD A;  1QH5 A;  2YNU A;  3IEK A;  2BMI A;  2I7X A;  1JJE A;  2M5D A;  5AHO A;  4TZE A;  5HIQ A;  4RM5 A;  4RBS A;  4UWP B;  3IOF A;  2AIO A;  2FU9 A;  3AF6 A;  4AWY B;  4ZO3 A;  2BG2 A;  2NZE A;  3BV6 A;  4U4L A;  3IE1 A;  4D1W A;  3I11 A;  3SFP A;  4J5H A;  4KEP A;  2BFZ B;  3MD7 A;  4BP0 A;  5EV6 A;  3T3O A;  4RL2 A;  2P4Z A;  4GCW A;  2BIB A;  2Q42 A;  2WYM A;  1A8T A;  5HH6 A;  4YSB A;  2Q0J A;  2Y87 A;  1BVT A;  4DIK A;  5AYA A;  5EV8 A;  2NXA A;  4TZB A;  3AF5 A;  2YZ3 A;  3WXC A;  2Q0I A;  2QIN A;  1SML A;  4UA4 A;  2H6A A;  5ACX A;  4XWT A;  2YNV B;  4FR7 A;  3A4Y A;  2GFK A;  3DHA A;  3F9O A;  1DD6 A;  3X2Y A;  2NYP A;  2YNT A;  4KEQ A;  2YNT B;  3SW3 A;  1P9E A;  5ACQ A;  1DXK A;  4ZEJ A;  4J5F A;  4TZF A;  1ZTC A;  4UAM A;  4NQ5 A;  2OHH A;  5DPX A;  3FCZ A;  5EVK A;  5B1U A;  2FU6 A;  2R2D A;  2CBN A;  3IOG A;  1VME A;  4LE6 A;  5ACW A;  3ZQ4 A;  4C09 A;  2M5C A;  4CHL A;  3RKK A;  3P2U A;  1ZNB A;  4DIL A;  1WUO A;  1L9Y A;  5HIO A;  2QDS A;  3RKJ A;  3SBL A;  2BG7 A;  4Z5Z A;  4EXY A;  2WYL A;  4Z67 A;  4WD6 A;  2BFK A;  1E5D A;  5EW0 A;  5LSC A;  4RL0 A;  5A5Z A;  4AX1 B;  2YNV A;  3PY5 A;  4AD9 A;  1JJT A;  1BMC A;  3I15 A;  4TYT A;  4NQ2 A;  2QED A;  4H0D A;  5B3R A;  1DDK A;  3X2X A;  2BG6 A;  2DKF A;  3PY6 A;  3IDZ A;  3ZNB A;  5LCF A;  4D02 A;  4C1D A;  4RAW A;  2FU8 A;  1JT1 A;  2BTN A;  1YCH A;  3SPU A;  2ZO4 A;  3KL7 A;  5AXR A;  4C1G A;  3QH8 A;  4C1F A;  2AZ4 A;  3I13 A;  5K4N A;  5EHT A;  4PVO A;  3SRX A;  5ACV A;  4UBQ A;  4EYF A;  5FQC A;  5HIP A;  3G1P A;  3BK1 A;  1YCG A;  5LE1 A;  4EYB A;  4EYL A;  2FHX A;  2NZF A;  3X30 A;  4UWR B;  1YCF A;  2OHJ A;  1ZKP A;  4EFZ A;  2Y8A A;  5EWA A;  2WHG A;  3ESH A;  2DOO A;  5HIS A;  1VJN A;  5K4K A;  3AJ3 A;  4F6H A;  4D1U A;  2P1E A;  2BG8 B;  1KR3 A;  3ADR A;  4O98 A;  5LMC A;  2Q9U A;  2QJS A;  4B87 A;  2GKL A;  5ACP A;  5LM6 A;  4P62 A;  5ACS A;  2XF4 A;  1BC2 A;  4TYF A;  4C1H A;  3IE0 A;  5FQA A;  4C1C A;  3BC2 A;  5IQK A;  4AX0 B;  2XR1 A;  4FSB A;  1Y44 A;  3IE2 A;  1X8I A;  4UWS B;  3BK2 A;  4GYU A;  5LCH A;  5AXO A;  5HH4 A;  2P97 A;  1WRA A;  3SD9 A;  3VQZ A;  3ZWF A;  3JXP A;  3DH8 A;  5EVB A;  4JO0 A;  4EY2 A;  1X8H A;  5AHR A;  4EXS A;  4YSK A;  4D1T A;  2BC2 A;  4F6Z A;  3IEL A;  5A0T A;  2QDT A;  4C1E A;  5A87 A;  4XWW A;  3KNR A;  4XUK A;  2VW8 A;  5AEB A;  2FHX B;  4PVT A;  2A7M A;  2OHI A;  5KIL A;  2BR6 A;  1M2X A;  1QH3 A;  3TP9 A;  1WW1 A;  1X8G A;  3FAI A;  1XM8 A;  3T3N A;  3DHC A;  3DHB A;  5ACU A;  2E7Y A;  3R2U A;  3Q6V A;  4D1V A;  1MQO A;  2BG8 A;  4Z7R A;  4AWZ A;  2BGA A;  1XTO A;  2BFZ A;  3LVZ A;  4ZO2 A;  4Z60 A;  4Z5Y A;  5B15 A;  1K07 A;  2YCB A;  3ZR9 A;  4BZ3 A;  4GYQ A;  2I7V A;  5ACT A;  2Y8B A;  2HB9 A;  4Z6X A;  2BFL A;  3I0V A;  1KO3 A;  2I7T A;  4YSL A;  2UYX A;  5K4M A;  4RAM A;  4ZNB A;  2FM6 A;  1KO2 A;  5LCA A;  5K0W A;  2ZZI A;  2ZWR A;  5FQB A;  3X2Z A;  3H3E A;  4NQ4 A;  2FU7 A;  2ZNB A;  2GMN A;  4NQ6 A;  2WYM C;  4HL1 A;  1WUP A;  5ACR A;  2WRS A;  4FEK A;  4TZ9 A;  2GCU A;  4HKY A;  5KIK A;  3S0Z A;  3L6N A;  2P18 A;  1VGN A;  5A0V A;  3PG4 A;  5HH5 A;  2FK6 A;  5LS3 A;  2YNW A;  4V0H A;  3T9M A;  1HLK A;  3IEM A;  3KNS A;  3RPC A;  3I14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...