3VPEA

Crystal structure of metallo-beta-lactamase smb-1
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
259
structure length
259
Chain Sequence
RDWSSPQQPFTIYGNTHYVGTGGISAVLLSSPQGHILVDGTTEKGAQVVAANIRAMGFKLSDVKYILSTHSHEDHAGGISAMQKLTGATVLAGAANVDTLRTGVSPKSDPQFGSLSNFPGSAKVRAVADGELVKLGPLAVKAHATPGHTEGGITWTWQSCEQGKCKDVVFADSLTAVSADSYRFSDHPEVVASLRGSFEAVEKLSCDIAIAAHPEVNDMWTRQQRAAKEGNSAYVDNGACRAIAAAGRKRLETRLASEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Metallo-beta-lactamase
publication title Structural Insights into the Subclass B3 Metallo-beta-Lactamase SMB-1 and the Mode of Inhibition by the Common Metallo- -Lactamase Inhibitor Mercaptoacetate
pubmed doi rcsb
source organism Serratia marcescens
total genus 85
structure length 259
sequence length 259
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3vpeA00
4AWZA 5LMCA 1WUOA 1E5DA 4XWWA 5ACVA 2Y87A 3SD9A 2BIBA 1JT1A 5LCHA 5IQKA 2BMIA 3ADRA 3RPCA 4ZNBA 5LSCA 5ACUA 5AEBA 3ZWFA 4AX1B 4ZO3A 4YSLA 5LCAA 2BFZA 4EY2A 4TYFA 3TP9A 2NYPA 1XM8A 4TYTA 4D1WA 4RL0A 4H0DA 5DPXA 5EH9A 4RAWA 1L9YA 4WD6A 4TZFA 5AYAA 2Q0IA 3ZNBA 5B1UA 1ZNBA 5K4KA 4J5HA 4GYUA 4F6ZA 3G1PA 2QDSA 1QH3A 3RKKA 3F9OA 3X2YA 3DH8A 2BG8B 4TZBA 2Y8BA 2NZEA 4PVTA 1VMEA 4Z5YA 4Z60A 2BG7A 2YNVA 4XUKA 3H3EA 1DD6A 2H6AA 5ACRA 2FU6A 3SW3A 5HH5A 5EW0A 4EYBA 2BFKA 2WYMA 3AF5A 5EV8A 1SMLA 3SBLA 4D02A 2BC2A 2WRSA 1WW1A 4C1CA 3WXCA 1WUPA 3SPUA 3T3NA 4V0HA 3IE2A 5A5ZA 4NQ2A 5FQAA 3BC2A 3RKJA 1XTOA 1VJNA 2WYLA 2A7MA 2OHHA 4ZO2A 4KEPA 3I13A 3IDZA 5HIQA 4U4LA 2FU7A 2WHGA 2YNWA 2NXAA 1DXKA 4UWRB 1KO2A 2Q42A 5EHTA 4D1TA 2FM6A 3IELA 1BC2A 2Q0JA 1A8TA 5EWAA 4UBQA 4HL1A 2P4ZA 2YNVB 1QH5A 2QEDA 4XWTA 3SRXA 5KILA 3X2ZA 3X30A 2QINA 3S0ZA 1BMCA 2DOOA 3SFPA 5A87A 5FQBA 2VW8A 4UWSB 4EXYA 3KNSA 2YNUA 3BK1A 5HISA 5ACSA 3IOGA 4FEKA 1YCHA 3MD7A 3Q6VA 2OHJA 1P9EA 1Y44A 2M5DA 5EVDA 2YCBA 3VPEA 2XR1A 2AIOA 2BTNA 3KNRA 4FR7A 3T9MA 4EYFA 3I14A 4O98A 5EVBA 4NQ5A 5ACPA 2NZFA 4JO0A 2Q9UA 4RL2A 1KR3A 3A4YA 4C1GA 4ZEJA 3DHCA 5AHOA 5KIKA 5ACXA 5K4MA 2R2DA 3R2UA 4EXSA 1YCGA 4C1HA 1K07A 3P2UA 3IE1A 2I7XA 5FQCA 3IEMA 2QDTA 1X8IA 3PY6A 1X8GA 3JXPA 2FHXA 2GKLA 2YZ3A 1HLKA 1MQOA 5LE1A 3IOFA 4AD9A 4LE6A 3X2XA 5ACQA 2FU9A 3BV6A 2ZO4A 2QJSA 3FAIA 3I0VA 5HIOA 2ZWRA 2BGAA 4RBSA 2FU8A 3LVZA 1M2XA 5K0WA 4Z7RA 2E7YA 4YSBA 2P1EA 4HKYA 5LLDA 2YNTB 3VQZA 4GYQA 3T3OA 5A0VA 2HB9A 1VGNA 5A0TA 1WRAA 4D1UA 1ZTCA 4PVOA 4Z67A 2GFJA 4NQ4A 4YSKA 5ACWA 2BFLA 4UWOB 5AXRA 1JJTA 4C1DA 4CHLA 2GCUA 5LCFA 4UA4A 4J5FA 1YCFA 3QH8A 1BVTA 2FHXB 1X8HA 4DIKA 5K4NA 5LS3A 4RM5A 2OHIA 4C1FA 1DDKA 4EYLA 3PG4A 3FCZA 3PY5A 2M5CA 4TZEA 1ZKPA 4UWPB 4AX0B 2YNTA 5HH4A 2CBNA 2WYMC 2BR6A 5EVKA 4HL2A 4F6HA 4AWYB 2GMNA 3I15A 2UYXA 3AJ3A 2I7VA 1JJEA 3I11A 3DHAA 3AF6A 3KL7A 4P62A 3ESHA 5B15A 3ZQ4A 2XF4A 4GCWA 2DKFA 3IEKA 4KEQA 2AZ4A 3L6NA 4FSBA 5ACTA 3ZR9A 4RAMA 2GFKA 5EV6A 5LM6A 3BK2A 4DILA 5B3RA 2P18A 5AHRA 2FK6A 2ZNBA 4UAMA 4TZ9A 2BFZB 2BG6A 4C09A 1KO3A 5HIPA 4B87A 2I7TA 5HH6A 4BP0A 3DHBA 4BZ3A 2Y8AA 4Z5ZA 2ZZIA 5AXOA 2BG2A 4D1VA 1A7TA 2BG8A 4C1EA 2P97A 3IE0A 4EFZA 4Z6XA 4NQ6A
chains in the Genus database with same CATH superfamily
4AWZA 5LMCA 1WUOA 1E5DA 4XWWA 5ACVA 2Y87A 3SD9A 2BIBA 1JT1A 5LCHA 5IQKA 2BMIA 3ADRA 3RPCA 4ZNBA 5LSCA 5ACUA 5AEBA 3ZWFA 4AX1B 4ZO3A 4YSLA 5LCAA 2CFZA 2BFZA 4EY2A 4TYFA 3TP9A 2NYPA 1XM8A 4TYTA 4D1WA 4RL0A 4H0DA 5DPXA 5EH9A 4RAWA 4AXHA 1L9YA 4WD6A 4TZFA 5AYAA 2Q0IA 3ZNBA 5B1UA 1ZNBA 5K4KA 4J5HA 4GYUA 4F6ZA 3G1PA 2QDSA 5AIJA 1QH3A 3RKKA 3F9OA 3X2YA 3DH8A 2BG8B 4TZBA 2Y8BA 2NZEA 4PVTA 1VMEA 4Z5YA 4Z60A 2BG7A 2CG2A 2YNVA 4XUKA 3H3EA 1DD6A 2H6AA 5ACRA 2FU6A 4AV7A 3SW3A 5HH5A 5EW0A 4EYBA 2BFKA 2WYMA 3AF5A 5EV8A 1SMLA 3SBLA 4D02A 2BC2A 2WRSA 1WW1A 4C1CA 3WXCA 1WUPA 2YHEA 3SPUA 5A23A 3T3NA 4V0HA 3IE2A 5A5ZA 4NQ2A 4NURA 5FQAA 3BC2A 3RKJA 1XTOA 1VJNA 2WYLA 2A7MA 2CG3A 2OHHA 4ZO2A 4KEPA 3I13A 3IDZA 5HIQA 4U4LA 2FU7A 2WHGA 2YNWA 2NXAA 1DXKA 4UWRB 1KO2A 2Q42A 5EHTA 4D1TA 2FM6A 3IELA 1BC2A 2Q0JA 1A8TA 5EWAA 4UBQA 4HL1A 2P4ZA 2YNVB 1QH5A 2QEDA 4XWTA 3SRXA 5KILA 3X2ZA 3X30A 2QINA 3S0ZA 1BMCA 2DOOA 3SFPA 5A87A 5FQBA 2VW8A 4UWSB 4EXYA 3KNSA 2YNUA 3BK1A 5HISA 5ACSA 3IOGA 4FEKA 1YCHA 3MD7A 3Q6VA 2OHJA 1P9EA 1Y44A 2M5DA 5EVDA 2YCBA 3VPEA 2XR1A 2AIOA 2BTNA 3KNRA 4FR7A 3T9MA 4EYFA 3I14A 4O98A 5EVBA 4NQ5A 5ACPA 2NZFA 4JO0A 2Q9UA 4RL2A 1KR3A 3A4YA 4C1GA 4ZEJA 3DHCA 5AHOA 5KIKA 5ACXA 5K4MA 2R2DA 3R2UA 4EXSA 1YCGA 4C1HA 1K07A 3P2UA 3IE1A 2I7XA 5FQCA 3IEMA 2QDTA 1X8IA 3PY6A 1X8GA 3JXPA 2FHXA 2GKLA 2YZ3A 1HLKA 1MQOA 5LE1A 3IOFA 4AD9A 4LE6A 3X2XA 5ACQA 2FU9A 3BV6A 2ZO4A 2QJSA 3FAIA 3I0VA 5HIOA 2ZWRA 2BGAA 4RBSA 2FU8A 3LVZA 1M2XA 5K0WA 4Z7RA 2E7YA 4YSBA 2P1EA 4HKYA 5LLDA 2YNTB 3VQZA 4GYQA 3T3OA 5A0VA 2HB9A 1VGNA 5A0TA 1WRAA 4PDXA 4D1UA 1ZTCA 4PVOA 4Z67A 2GFJA 2CFUA 4NQ4A 4YSKA 5ACWA 2BFLA 4UWOB 5AXRA 1JJTA 4C1DA 4CHLA 2GCUA 5LCFA 4UA4A 4J5FA 1YCFA 3QH8A 1BVTA 2FHXB 1X8HA 4DIKA 5K4NA 5LS3A 4RM5A 2OHIA 4C1FA 1DDKA 4EYLA 3PG4A 3FCZA 3PY5A 2M5CA 4TZEA 1ZKPA 4UWPB 4AX0B 2YNTA 5HH4A 2CBNA 2WYMC 5AJLA 2BR6A 5EVKA 4HL2A 4F6HA 4AWYB 2GMNA 3I15A 2UYXA 3AJ3A 2I7VA 1JJEA 3I11A 3DHAA 3AF6A 3KL7A 4P62A 3ESHA 5B15A 3ZQ4A 2XF4A 4GCWA 2DKFA 3IEKA 4KEQA 2AZ4A 3L6NA 4FSBA 5ACTA 3ZR9A 4RAMA 2GFKA 5EV6A 5LM6A 3BK2A 4DILA 5B3RA 2P18A 5AHRA 2FK6A 2ZNBA 4UAMA 4TZ9A 2BFZB 2BG6A 4C09A 1KO3A 5HIPA 4B87A 2I7TA 5HH6A 4BP0A 3DHBA 4BZ3A 2Y8AA 4Z5ZA 2ZZIA 5AXOA 2BG2A 4D1VA 1A7TA 2BG8A 4C1EA 2P97A 3IE0A 4EFZA 4Z6XA 4NQ6A
chains in the Genus database with same CATH topology
4AWZA 5LMCA 1WUOA 1E5DA 4XWWA 5ACVA 2Y87A 3SD9A 2BIBA 1JT1A 5LCHA 5IQKA 2BMIA 3ADRA 3RPCA 4ZNBA 5LSCA 5ACUA 5AEBA 3ZWFA 4AX1B 4ZO3A 4YSLA 5LCAA 2BFZA 4EY2A 4TYFA 3TP9A 2NYPA 1XM8A 4TYTA 4D1WA 4RL0A 4H0DA 5DPXA 5EH9A 4RAWA 1L9YA 4WD6A 4TZFA 5AYAA 2Q0IA 3ZNBA 5B1UA 1ZNBA 5K4KA 4J5HA 4GYUA 4F6ZA 3G1PA 2QDSA 1QH3A 3RKKA 3F9OA 3X2YA 3DH8A 2BG8B 4TZBA 2Y8BA 2NZEA 4PVTA 1VMEA 4Z5YA 4Z60A 2BG7A 2YNVA 4XUKA 3H3EA 1DD6A 2H6AA 5ACRA 2FU6A 3SW3A 5HH5A 5EW0A 4EYBA 2BFKA 2WYMA 3AF5A 5EV8A 1SMLA 3SBLA 4D02A 2BC2A 2WRSA 1WW1A 4C1CA 3WXCA 1WUPA 3SPUA 3T3NA 4V0HA 3IE2A 5A5ZA 4NQ2A 5FQAA 3BC2A 3RKJA 1XTOA 1VJNA 2WYLA 2A7MA 2OHHA 4ZO2A 4KEPA 3I13A 3IDZA 5HIQA 4U4LA 2FU7A 2WHGA 2YNWA 2NXAA 1DXKA 4UWRB 1KO2A 2Q42A 5EHTA 4D1TA 2FM6A 3IELA 1BC2A 2Q0JA 1A8TA 5EWAA 4UBQA 4HL1A 2P4ZA 2YNVB 1QH5A 2QEDA 4XWTA 3SRXA 5KILA 3X2ZA 3X30A 2QINA 3S0ZA 1BMCA 2DOOA 3SFPA 5A87A 5FQBA 2VW8A 4UWSB 4EXYA 3KNSA 2YNUA 3BK1A 5HISA 5ACSA 3IOGA 4FEKA 1YCHA 3MD7A 3Q6VA 2OHJA 1P9EA 1Y44A 2M5DA 5EVDA 2YCBA 3VPEA 2XR1A 2AIOA 2BTNA 3KNRA 4FR7A 3T9MA 4EYFA 3I14A 4O98A 5EVBA 4NQ5A 5ACPA 2NZFA 4JO0A 2Q9UA 4RL2A 1KR3A 3A4YA 4C1GA 4ZEJA 3DHCA 5AHOA 5KIKA 5ACXA 5K4MA 2R2DA 3R2UA 4EXSA 1YCGA 4C1HA 1K07A 3P2UA 3IE1A 2I7XA 5FQCA 3IEMA 2QDTA 1X8IA 3PY6A 1X8GA 3JXPA 2FHXA 2GKLA 2YZ3A 1HLKA 1MQOA 5LE1A 3IOFA 4AD9A 4LE6A 3X2XA 5ACQA 2FU9A 3BV6A 2ZO4A 2QJSA 3FAIA 3I0VA 5HIOA 2ZWRA 2BGAA 4RBSA 2FU8A 3LVZA 1M2XA 5K0WA 4Z7RA 2E7YA 4YSBA 2P1EA 4HKYA 5LLDA 2YNTB 3VQZA 4GYQA 3T3OA 5A0VA 2HB9A 1VGNA 5A0TA 1WRAA 4D1UA 1ZTCA 4PVOA 4Z67A 2GFJA 4NQ4A 4YSKA 5ACWA 2BFLA 4UWOB 5AXRA 1JJTA 4C1DA 4CHLA 2GCUA 5LCFA 4UA4A 4J5FA 1YCFA 3QH8A 1BVTA 2FHXB 1X8HA 4DIKA 5K4NA 5LS3A 4RM5A 2OHIA 4C1FA 1DDKA 4EYLA 3PG4A 3FCZA 3PY5A 2M5CA 4TZEA 1ZKPA 4UWPB 4AX0B 2YNTA 5HH4A 2CBNA 2WYMC 2BR6A 5EVKA 4HL2A 4F6HA 4AWYB 2GMNA 3I15A 2UYXA 3AJ3A 2I7VA 1JJEA 3I11A 3DHAA 3AF6A 3KL7A 4P62A 3ESHA 5B15A 3ZQ4A 2XF4A 4GCWA 2DKFA 3IEKA 4KEQA 2AZ4A 3L6NA 4FSBA 5ACTA 3ZR9A 4RAMA 2GFKA 5EV6A 5LM6A 3BK2A 4DILA 5B3RA 2P18A 5AHRA 2FK6A 2ZNBA 4UAMA 4TZ9A 2BFZB 2BG6A 4C09A 1KO3A 5HIPA 4B87A 2I7TA 5HH6A 4BP0A 3DHBA 4BZ3A 2Y8AA 4Z5ZA 2ZZIA 5AXOA 2BG2A 4D1VA 1A7TA 2BG8A 4C1EA 2P97A 3IE0A 4EFZA 4Z6XA 4NQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AWZ A;  5LMC A;  1WUO A;  1E5D A;  4XWW A;  5ACV A;  2Y87 A;  3SD9 A;  2BIB A;  1JT1 A;  5LCH A;  5IQK A;  2BMI A;  3ADR A;  3RPC A;  4ZNB A;  5LSC A;  5ACU A;  5AEB A;  3ZWF A;  4AX1 B;  4ZO3 A;  4YSL A;  5LCA A;  2BFZ A;  4EY2 A;  4TYF A;  3TP9 A;  2NYP A;  1XM8 A;  4TYT A;  4D1W A;  4RL0 A;  4H0D A;  5DPX A;  5EH9 A;  4RAW A;  1L9Y A;  4WD6 A;  4TZF A;  5AYA A;  2Q0I A;  3ZNB A;  5B1U A;  1ZNB A;  5K4K A;  4J5H A;  4GYU A;  4F6Z A;  3G1P A;  2QDS A;  1QH3 A;  3RKK A;  3F9O A;  3X2Y A;  3DH8 A;  2BG8 B;  4TZB A;  2Y8B A;  2NZE A;  4PVT A;  1VME A;  4Z5Y A;  4Z60 A;  2BG7 A;  2YNV A;  4XUK A;  3H3E A;  1DD6 A;  2H6A A;  5ACR A;  2FU6 A;  3SW3 A;  5HH5 A;  5EW0 A;  4EYB A;  2BFK A;  2WYM A;  3AF5 A;  5EV8 A;  1SML A;  3SBL A;  4D02 A;  2BC2 A;  2WRS A;  1WW1 A;  4C1C A;  3WXC A;  1WUP A;  3SPU A;  3T3N A;  4V0H A;  3IE2 A;  5A5Z A;  4NQ2 A;  5FQA A;  3BC2 A;  3RKJ A;  1XTO A;  1VJN A;  2WYL A;  2A7M A;  2OHH A;  4ZO2 A;  4KEP A;  3I13 A;  3IDZ A;  5HIQ A;  4U4L A;  2FU7 A;  2WHG A;  2YNW A;  2NXA A;  1DXK A;  4UWR B;  1KO2 A;  2Q42 A;  5EHT A;  4D1T A;  2FM6 A;  3IEL A;  1BC2 A;  2Q0J A;  1A8T A;  5EWA A;  4UBQ A;  4HL1 A;  2P4Z A;  2YNV B;  1QH5 A;  2QED A;  4XWT A;  3SRX A;  5KIL A;  3X2Z A;  3X30 A;  2QIN A;  3S0Z A;  1BMC A;  2DOO A;  3SFP A;  5A87 A;  5FQB A;  2VW8 A;  4UWS B;  4EXY A;  3KNS A;  2YNU A;  3BK1 A;  5HIS A;  5ACS A;  3IOG A;  4FEK A;  1YCH A;  3MD7 A;  3Q6V A;  2OHJ A;  1P9E A;  1Y44 A;  2M5D A;  5EVD A;  2YCB A;  3VPE A;  2XR1 A;  2AIO A;  2BTN A;  3KNR A;  4FR7 A;  3T9M A;  4EYF A;  3I14 A;  4O98 A;  5EVB A;  4NQ5 A;  5ACP A;  2NZF A;  4JO0 A;  2Q9U A;  4RL2 A;  1KR3 A;  3A4Y A;  4C1G A;  4ZEJ A;  3DHC A;  5AHO A;  5KIK A;  5ACX A;  5K4M A;  2R2D A;  3R2U A;  4EXS A;  1YCG A;  4C1H A;  1K07 A;  3P2U A;  3IE1 A;  2I7X A;  5FQC A;  3IEM A;  2QDT A;  1X8I A;  3PY6 A;  1X8G A;  3JXP A;  2FHX A;  2GKL A;  2YZ3 A;  1HLK A;  1MQO A;  5LE1 A;  3IOF A;  4AD9 A;  4LE6 A;  3X2X A;  5ACQ A;  2FU9 A;  3BV6 A;  2ZO4 A;  2QJS A;  3FAI A;  3I0V A;  5HIO A;  2ZWR A;  2BGA A;  4RBS A;  2FU8 A;  3LVZ A;  1M2X A;  5K0W A;  4Z7R A;  2E7Y A;  4YSB A;  2P1E A;  4HKY A;  5LLD A;  2YNT B;  3VQZ A;  4GYQ A;  3T3O A;  5A0V A;  2HB9 A;  1VGN A;  5A0T A;  1WRA A;  4D1U A;  1ZTC A;  4PVO A;  4Z67 A;  2GFJ A;  4NQ4 A;  4YSK A;  5ACW A;  2BFL A;  4UWO B;  5AXR A;  1JJT A;  4C1D A;  4CHL A;  2GCU A;  5LCF A;  4UA4 A;  4J5F A;  1YCF A;  3QH8 A;  1BVT A;  2FHX B;  1X8H A;  4DIK A;  5K4N A;  5LS3 A;  4RM5 A;  2OHI A;  4C1F A;  1DDK A;  4EYL A;  3PG4 A;  3FCZ A;  3PY5 A;  2M5C A;  4TZE A;  1ZKP A;  4UWP B;  4AX0 B;  2YNT A;  5HH4 A;  2CBN A;  2WYM C;  2BR6 A;  5EVK A;  4HL2 A;  4F6H A;  4AWY B;  2GMN A;  3I15 A;  2UYX A;  3AJ3 A;  2I7V A;  1JJE A;  3I11 A;  3DHA A;  3AF6 A;  3KL7 A;  4P62 A;  3ESH A;  5B15 A;  3ZQ4 A;  2XF4 A;  4GCW A;  2DKF A;  3IEK A;  4KEQ A;  2AZ4 A;  3L6N A;  4FSB A;  5ACT A;  3ZR9 A;  4RAM A;  2GFK A;  5EV6 A;  5LM6 A;  3BK2 A;  4DIL A;  5B3R A;  2P18 A;  5AHR A;  2FK6 A;  2ZNB A;  4UAM A;  4TZ9 A;  2BFZ B;  2BG6 A;  4C09 A;  1KO3 A;  5HIP A;  4B87 A;  2I7T A;  5HH6 A;  4BP0 A;  3DHB A;  4BZ3 A;  2Y8A A;  4Z5Z A;  2ZZI A;  5AXO A;  2BG2 A;  4D1V A;  1A7T A;  2BG8 A;  4C1E A;  2P97 A;  3IE0 A;  4EFZ A;  4Z6X A;  4NQ6 A; 
#chains in the Genus database with same CATH topology
 4AWZ A;  5LMC A;  1WUO A;  1E5D A;  4XWW A;  5ACV A;  2Y87 A;  3SD9 A;  2BIB A;  1JT1 A;  5LCH A;  5IQK A;  2BMI A;  3ADR A;  3RPC A;  4ZNB A;  5LSC A;  5ACU A;  5AEB A;  3ZWF A;  4AX1 B;  4ZO3 A;  4YSL A;  5LCA A;  2CFZ A;  2BFZ A;  4EY2 A;  4TYF A;  3TP9 A;  2NYP A;  1XM8 A;  4TYT A;  4D1W A;  4RL0 A;  4H0D A;  5DPX A;  5EH9 A;  4RAW A;  4AXH A;  1L9Y A;  4WD6 A;  4TZF A;  5AYA A;  2Q0I A;  3ZNB A;  5B1U A;  1ZNB A;  5K4K A;  4J5H A;  4GYU A;  4F6Z A;  3G1P A;  2QDS A;  5AIJ A;  1QH3 A;  3RKK A;  3F9O A;  3X2Y A;  3DH8 A;  2BG8 B;  4TZB A;  2Y8B A;  2NZE A;  4PVT A;  1VME A;  4Z5Y A;  4Z60 A;  2BG7 A;  2CG2 A;  2YNV A;  4XUK A;  3H3E A;  1DD6 A;  2H6A A;  5ACR A;  2FU6 A;  4AV7 A;  3SW3 A;  5HH5 A;  5EW0 A;  4EYB A;  2BFK A;  2WYM A;  3AF5 A;  5EV8 A;  1SML A;  3SBL A;  4D02 A;  2BC2 A;  2WRS A;  1WW1 A;  4C1C A;  3WXC A;  1WUP A;  2YHE A;  3SPU A;  5A23 A;  3T3N A;  4V0H A;  3IE2 A;  5A5Z A;  4NQ2 A;  4NUR A;  5FQA A;  3BC2 A;  3RKJ A;  1XTO A;  1VJN A;  2WYL A;  2A7M A;  2CG3 A;  2OHH A;  4ZO2 A;  4KEP A;  3I13 A;  3IDZ A;  5HIQ A;  4U4L A;  2FU7 A;  2WHG A;  2YNW A;  2NXA A;  1DXK A;  4UWR B;  1KO2 A;  2Q42 A;  5EHT A;  4D1T A;  2FM6 A;  3IEL A;  1BC2 A;  2Q0J A;  1A8T A;  5EWA A;  4UBQ A;  4HL1 A;  2P4Z A;  2YNV B;  1QH5 A;  2QED A;  4XWT A;  3SRX A;  5KIL A;  3X2Z A;  3X30 A;  2QIN A;  3S0Z A;  1BMC A;  2DOO A;  3SFP A;  5A87 A;  5FQB A;  2VW8 A;  4UWS B;  4EXY A;  3KNS A;  2YNU A;  3BK1 A;  5HIS A;  5ACS A;  3IOG A;  4FEK A;  1YCH A;  3MD7 A;  3Q6V A;  2OHJ A;  1P9E A;  1Y44 A;  2M5D A;  5EVD A;  2YCB A;  3VPE A;  2XR1 A;  2AIO A;  2BTN A;  3KNR A;  4FR7 A;  3T9M A;  4EYF A;  3I14 A;  4O98 A;  5EVB A;  4NQ5 A;  5ACP A;  2NZF A;  4JO0 A;  2Q9U A;  4RL2 A;  1KR3 A;  3A4Y A;  4C1G A;  4ZEJ A;  3DHC A;  5AHO A;  5KIK A;  5ACX A;  5K4M A;  2R2D A;  3R2U A;  4EXS A;  1YCG A;  4C1H A;  1K07 A;  3P2U A;  3IE1 A;  2I7X A;  5FQC A;  3IEM A;  2QDT A;  1X8I A;  3PY6 A;  1X8G A;  3JXP A;  2FHX A;  2GKL A;  2YZ3 A;  1HLK A;  1MQO A;  5LE1 A;  3IOF A;  4AD9 A;  4LE6 A;  3X2X A;  5ACQ A;  2FU9 A;  3BV6 A;  2ZO4 A;  2QJS A;  3FAI A;  3I0V A;  5HIO A;  2ZWR A;  2BGA A;  4RBS A;  2FU8 A;  3LVZ A;  1M2X A;  5K0W A;  4Z7R A;  2E7Y A;  4YSB A;  2P1E A;  4HKY A;  5LLD A;  2YNT B;  3VQZ A;  4GYQ A;  3T3O A;  5A0V A;  2HB9 A;  1VGN A;  5A0T A;  1WRA A;  4PDX A;  4D1U A;  1ZTC A;  4PVO A;  4Z67 A;  2GFJ A;  2CFU A;  4NQ4 A;  4YSK A;  5ACW A;  2BFL A;  4UWO B;  5AXR A;  1JJT A;  4C1D A;  4CHL A;  2GCU A;  5LCF A;  4UA4 A;  4J5F A;  1YCF A;  3QH8 A;  1BVT A;  2FHX B;  1X8H A;  4DIK A;  5K4N A;  5LS3 A;  4RM5 A;  2OHI A;  4C1F A;  1DDK A;  4EYL A;  3PG4 A;  3FCZ A;  3PY5 A;  2M5C A;  4TZE A;  1ZKP A;  4UWP B;  4AX0 B;  2YNT A;  5HH4 A;  2CBN A;  2WYM C;  5AJL A;  2BR6 A;  5EVK A;  4HL2 A;  4F6H A;  4AWY B;  2GMN A;  3I15 A;  2UYX A;  3AJ3 A;  2I7V A;  1JJE A;  3I11 A;  3DHA A;  3AF6 A;  3KL7 A;  4P62 A;  3ESH A;  5B15 A;  3ZQ4 A;  2XF4 A;  4GCW A;  2DKF A;  3IEK A;  4KEQ A;  2AZ4 A;  3L6N A;  4FSB A;  5ACT A;  3ZR9 A;  4RAM A;  2GFK A;  5EV6 A;  5LM6 A;  3BK2 A;  4DIL A;  5B3R A;  2P18 A;  5AHR A;  2FK6 A;  2ZNB A;  4UAM A;  4TZ9 A;  2BFZ B;  2BG6 A;  4C09 A;  1KO3 A;  5HIP A;  4B87 A;  2I7T A;  5HH6 A;  4BP0 A;  3DHB A;  4BZ3 A;  2Y8A A;  4Z5Z A;  2ZZI A;  5AXO A;  2BG2 A;  4D1V A;  1A7T A;  2BG8 A;  4C1E A;  2P97 A;  3IE0 A;  4EFZ A;  4Z6X A;  4NQ6 A; 
#chains in the Genus database with same CATH homology
 4AWZ A;  5LMC A;  1WUO A;  1E5D A;  4XWW A;  5ACV A;  2Y87 A;  3SD9 A;  2BIB A;  1JT1 A;  5LCH A;  5IQK A;  2BMI A;  3ADR A;  3RPC A;  4ZNB A;  5LSC A;  5ACU A;  5AEB A;  3ZWF A;  4AX1 B;  4ZO3 A;  4YSL A;  5LCA A;  2BFZ A;  4EY2 A;  4TYF A;  3TP9 A;  2NYP A;  1XM8 A;  4TYT A;  4D1W A;  4RL0 A;  4H0D A;  5DPX A;  5EH9 A;  4RAW A;  1L9Y A;  4WD6 A;  4TZF A;  5AYA A;  2Q0I A;  3ZNB A;  5B1U A;  1ZNB A;  5K4K A;  4J5H A;  4GYU A;  4F6Z A;  3G1P A;  2QDS A;  1QH3 A;  3RKK A;  3F9O A;  3X2Y A;  3DH8 A;  2BG8 B;  4TZB A;  2Y8B A;  2NZE A;  4PVT A;  1VME A;  4Z5Y A;  4Z60 A;  2BG7 A;  2YNV A;  4XUK A;  3H3E A;  1DD6 A;  2H6A A;  5ACR A;  2FU6 A;  3SW3 A;  5HH5 A;  5EW0 A;  4EYB A;  2BFK A;  2WYM A;  3AF5 A;  5EV8 A;  1SML A;  3SBL A;  4D02 A;  2BC2 A;  2WRS A;  1WW1 A;  4C1C A;  3WXC A;  1WUP A;  3SPU A;  3T3N A;  4V0H A;  3IE2 A;  5A5Z A;  4NQ2 A;  5FQA A;  3BC2 A;  3RKJ A;  1XTO A;  1VJN A;  2WYL A;  2A7M A;  2OHH A;  4ZO2 A;  4KEP A;  3I13 A;  3IDZ A;  5HIQ A;  4U4L A;  2FU7 A;  2WHG A;  2YNW A;  2NXA A;  1DXK A;  4UWR B;  1KO2 A;  2Q42 A;  5EHT A;  4D1T A;  2FM6 A;  3IEL A;  1BC2 A;  2Q0J A;  1A8T A;  5EWA A;  4UBQ A;  4HL1 A;  2P4Z A;  2YNV B;  1QH5 A;  2QED A;  4XWT A;  3SRX A;  5KIL A;  3X2Z A;  3X30 A;  2QIN A;  3S0Z A;  1BMC A;  2DOO A;  3SFP A;  5A87 A;  5FQB A;  2VW8 A;  4UWS B;  4EXY A;  3KNS A;  2YNU A;  3BK1 A;  5HIS A;  5ACS A;  3IOG A;  4FEK A;  1YCH A;  3MD7 A;  3Q6V A;  2OHJ A;  1P9E A;  1Y44 A;  2M5D A;  5EVD A;  2YCB A;  3VPE A;  2XR1 A;  2AIO A;  2BTN A;  3KNR A;  4FR7 A;  3T9M A;  4EYF A;  3I14 A;  4O98 A;  5EVB A;  4NQ5 A;  5ACP A;  2NZF A;  4JO0 A;  2Q9U A;  4RL2 A;  1KR3 A;  3A4Y A;  4C1G A;  4ZEJ A;  3DHC A;  5AHO A;  5KIK A;  5ACX A;  5K4M A;  2R2D A;  3R2U A;  4EXS A;  1YCG A;  4C1H A;  1K07 A;  3P2U A;  3IE1 A;  2I7X A;  5FQC A;  3IEM A;  2QDT A;  1X8I A;  3PY6 A;  1X8G A;  3JXP A;  2FHX A;  2GKL A;  2YZ3 A;  1HLK A;  1MQO A;  5LE1 A;  3IOF A;  4AD9 A;  4LE6 A;  3X2X A;  5ACQ A;  2FU9 A;  3BV6 A;  2ZO4 A;  2QJS A;  3FAI A;  3I0V A;  5HIO A;  2ZWR A;  2BGA A;  4RBS A;  2FU8 A;  3LVZ A;  1M2X A;  5K0W A;  4Z7R A;  2E7Y A;  4YSB A;  2P1E A;  4HKY A;  5LLD A;  2YNT B;  3VQZ A;  4GYQ A;  3T3O A;  5A0V A;  2HB9 A;  1VGN A;  5A0T A;  1WRA A;  4D1U A;  1ZTC A;  4PVO A;  4Z67 A;  2GFJ A;  4NQ4 A;  4YSK A;  5ACW A;  2BFL A;  4UWO B;  5AXR A;  1JJT A;  4C1D A;  4CHL A;  2GCU A;  5LCF A;  4UA4 A;  4J5F A;  1YCF A;  3QH8 A;  1BVT A;  2FHX B;  1X8H A;  4DIK A;  5K4N A;  5LS3 A;  4RM5 A;  2OHI A;  4C1F A;  1DDK A;  4EYL A;  3PG4 A;  3FCZ A;  3PY5 A;  2M5C A;  4TZE A;  1ZKP A;  4UWP B;  4AX0 B;  2YNT A;  5HH4 A;  2CBN A;  2WYM C;  2BR6 A;  5EVK A;  4HL2 A;  4F6H A;  4AWY B;  2GMN A;  3I15 A;  2UYX A;  3AJ3 A;  2I7V A;  1JJE A;  3I11 A;  3DHA A;  3AF6 A;  3KL7 A;  4P62 A;  3ESH A;  5B15 A;  3ZQ4 A;  2XF4 A;  4GCW A;  2DKF A;  3IEK A;  4KEQ A;  2AZ4 A;  3L6N A;  4FSB A;  5ACT A;  3ZR9 A;  4RAM A;  2GFK A;  5EV6 A;  5LM6 A;  3BK2 A;  4DIL A;  5B3R A;  2P18 A;  5AHR A;  2FK6 A;  2ZNB A;  4UAM A;  4TZ9 A;  2BFZ B;  2BG6 A;  4C09 A;  1KO3 A;  5HIP A;  4B87 A;  2I7T A;  5HH6 A;  4BP0 A;  3DHB A;  4BZ3 A;  2Y8A A;  4Z5Z A;  2ZZI A;  5AXO A;  2BG2 A;  4D1V A;  1A7T A;  2BG8 A;  4C1E A;  2P97 A;  3IE0 A;  4EFZ A;  4Z6X A;  4NQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...