3VPEA

Crystal structure of metallo-beta-lactamase smb-1
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
259
structure length
259
Chain Sequence
RDWSSPQQPFTIYGNTHYVGTGGISAVLLSSPQGHILVDGTTEKGAQVVAANIRAMGFKLSDVKYILSTHSHEDHAGGISAMQKLTGATVLAGAANVDTLRTGVSPKSDPQFGSLSNFPGSAKVRAVADGELVKLGPLAVKAHATPGHTEGGITWTWQSCEQGKCKDVVFADSLTAVSADSYRFSDHPEVVASLRGSFEAVEKLSCDIAIAAHPEVNDMWTRQQRAAKEGNSAYVDNGACRAIAAAGRKRLETRLASEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metallo-beta-lactamase
publication title Structural Insights into the Subclass B3 Metallo-beta-Lactamase SMB-1 and the Mode of Inhibition by the Common Metallo- -Lactamase Inhibitor Mercaptoacetate
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Hydrolase
total genus 85
structure length 259
sequence length 259
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3vpeA00
2NXAA 5EW0A 3IELA 2YNVA 5HIOA 3RKKA 4Z67A 3X2ZA 5ACRA 3AF5A 4YSBA 3IE0A 5EV8A 4P62A 1E5DA 4YSKA 5AXRA 3ZR9A 1WUOA 3SW3A 4GCWA 5FQAA 2BG8A 3F9OA 4C09A 3SRXA 4TZBA 1VJNA 2QDTA 1KR3A 1P9EA 2YNVB 3ZWFA 4PVTA 2BFLA 2ZZIA 2DKFA 5ACTA 1BMCA 3KNRA 1YCFA 4GYQA 3X30A 3PY6A 3X2YA 2Y87A 5LM6A 4C1HA 1JJEA 5LS3A 2CBNA 4D02A 2BG8B 4D1WA 3IE2A 2GCUA 4UWOB 4XWWA 1QH5A 3KL7A 3RKJA 2A7MA 2BFKA 4B87A 4EY2A 4RAWA 4Z7RA 3ESHA 4FSBA 4RM5A 4O98A 5KILA 3JXPA 4UWPB 3I0VA 2WHGA 4HL2A 5HIQA 3IOGA 5ACPA 4U4LA 3T3NA 3I15A 4JO0A 2Q0IA 4Z6XA 5LSCA 4D1VA 5LE1A 5HH4A 2UYXA 2BIBA 1QH3A 2Q42A 2P97A 1K07A 2ZO4A 5B1UA 4RL0A 3SD9A 3IE1A 2VW8A 3MD7A 4RL2A 3VPEA 5AHRA 5HIPA 3ADRA 2BR6A 4H0DA 5A87A 1XM8A 2R2DA 2YNTA 4AX0B 4C1CA 3BV6A 2NYPA 2BG7A 4EFZA 2WRSA 4DIKA 1A7TA 2I7VA 3RPCA 1WRAA 4NQ2A 2YNWA 4C1FA 3DHBA 5AEBA 5EHTA 1KO3A 3FCZA 2BG2A 4ZO2A 1A8TA 2YNTB 5AXOA 3P2UA 4LE6A 5A5ZA 1BVTA 5ACVA 4PVOA 1YCGA 2OHJA 3BK1A 2NZEA 2QEDA 3KNSA 2FU6A 5HH5A 2QDSA 4CHLA 4F6ZA 4AX1B 1X8HA 4UBQA 5LCFA 5B3RA 1ZKPA 4RAMA 5ACUA 3LVZA 4Z5YA 4HKYA 2AZ4A 2ZNBA 3ZQ4A 3BC2A 4BZ3A 5K4KA 3SPUA 3VQZA 2YCBA 4EYLA 4HL1A 2GMNA 5EVDA 5EH9A 1X8GA 5EWAA 2BTNA 2GFKA 4AWYB 2WYMC 5A0TA 1SMLA 3PG4A 3T3OA 3ZNBA 4C1GA 5K0WA 2WYMA 5A0VA 4Z60A 3I13A 4C1EA 1Y44A 5ACWA 2I7TA 2P4ZA 4J5HA 5LLDA 4NQ6A 3H3EA 4UA4A 5IQKA 3IEKA 4GYUA 3L6NA 1WW1A 2XR1A 5ACXA 2FM6A 5EV6A 5HISA 3A4YA 4AD9A 2E7YA 5LCAA 3SFPA 3TP9A 3SBLA 4J5FA 4D1UA 4UWSB 2ZWRA 2I7XA 4KEQA 4TZ9A 4Z5ZA 2FU8A 5EVBA 1YCHA 5AYAA 1KO2A 3Q6VA 5B15A 4EYBA 1BC2A 2AIOA 2BC2A 5AHOA 1XTOA 3FAIA 2Q9UA 3I11A 4TZEA 5EVKA 2H6AA 1HLKA 2BMIA 4NQ5A 3I14A 2QINA 4TYTA 1DDKA 2BGAA 4FR7A 5ACSA 2YNUA 2XF4A 2FHXA 3IEMA 3IOFA 2Q0JA 2WYLA 2FU7A 3IDZA 4UAMA 2Y8BA 4NQ4A 4RBSA 4BP0A 1ZNBA 3BK2A 1VMEA 1DD6A 5KIKA 3X2XA 5HH6A 4C1DA 2Y8AA 2M5CA 1M2XA 4FEKA 2OHHA 3PY5A 2FHXB 1L9YA 3AJ3A 1MQOA 3DH8A 2P1EA 2P18A 2OHIA 5K4NA 2BG6A 2HB9A 3T9MA 4KEPA 5LCHA 4ZEJA 4F6HA 1JJTA 4V0HA 4D1TA 4TYFA 3WXCA 1VGNA 3DHAA 5DPXA 5FQCA 4YSLA 2FK6A 1WUPA 5ACQA 2BFZA 1ZTCA 4EXYA 5LMCA 2FU9A 1X8IA 4ZNBA 2NZFA 4XWTA 4EYFA 4TZFA 2QJSA 2M5DA 5K4MA 2GKLA 2GFJA 4XUKA 5FQBA 3R2UA 1DXKA 3AF6A 3DHCA 2BFZB 3G1PA 4ZO3A 4AWZA 3S0ZA 3QH8A 1JT1A 4WD6A 4DILA 4EXSA 2DOOA 4UWRB 2YZ3A
chains in the Genus database with same CATH superfamily
2NXAA 5EW0A 3IELA 2YNVA 5HIOA 3RKKA 4Z67A 3X2ZA 5ACRA 3AF5A 4YSBA 3IE0A 5EV8A 4P62A 1E5DA 4YSKA 5AXRA 3ZR9A 1WUOA 3SW3A 4GCWA 5FQAA 2BG8A 3F9OA 4C09A 5AIJA 3SRXA 4TZBA 1VJNA 2QDTA 1KR3A 1P9EA 2YNVB 3ZWFA 4PVTA 2BFLA 2ZZIA 2DKFA 5ACTA 1BMCA 2CFZA 3KNRA 1YCFA 4GYQA 3X30A 3PY6A 3X2YA 2Y87A 5LM6A 4C1HA 1JJEA 5LS3A 2CBNA 4D02A 2BG8B 4D1WA 3IE2A 2GCUA 4UWOB 4XWWA 1QH5A 3KL7A 3RKJA 2A7MA 2BFKA 4B87A 4EY2A 4RAWA 4Z7RA 3ESHA 4FSBA 4RM5A 4O98A 5KILA 3JXPA 4UWPB 3I0VA 2WHGA 4HL2A 5HIQA 3IOGA 5ACPA 4U4LA 3T3NA 3I15A 4JO0A 2Q0IA 4Z6XA 5LSCA 4D1VA 5LE1A 5HH4A 2CG3A 2UYXA 2BIBA 1QH3A 2Q42A 2P97A 1K07A 2ZO4A 5B1UA 4RL0A 3SD9A 3IE1A 2VW8A 3MD7A 4RL2A 3VPEA 5AHRA 5HIPA 3ADRA 2BR6A 4H0DA 5A87A 1XM8A 2R2DA 2YNTA 4AX0B 4C1CA 3BV6A 2NYPA 2BG7A 4EFZA 2WRSA 4DIKA 1A7TA 2I7VA 3RPCA 1WRAA 4NQ2A 2CG2A 2YNWA 5AJLA 4C1FA 3DHBA 5AEBA 5EHTA 1KO3A 3FCZA 2BG2A 4ZO2A 1A8TA 2YNTB 5AXOA 3P2UA 5A23A 4LE6A 5A5ZA 1BVTA 5ACVA 4PVOA 1YCGA 2OHJA 3BK1A 2NZEA 2QEDA 3KNSA 2FU6A 5HH5A 2QDSA 4CHLA 4F6ZA 4AX1B 1X8HA 4UBQA 5LCFA 5B3RA 1ZKPA 4RAMA 5ACUA 3LVZA 4Z5YA 4HKYA 2AZ4A 2ZNBA 3ZQ4A 3BC2A 4BZ3A 5K4KA 3SPUA 3VQZA 2YCBA 4EYLA 4HL1A 2GMNA 5EVDA 5EH9A 1X8GA 5EWAA 2BTNA 2GFKA 4AWYB 2WYMC 5A0TA 1SMLA 3PG4A 3T3OA 3ZNBA 4C1GA 5K0WA 2WYMA 5A0VA 4Z60A 3I13A 4C1EA 1Y44A 5ACWA 2I7TA 2P4ZA 4J5HA 5LLDA 4NQ6A 3H3EA 4UA4A 2YHEA 5IQKA 3IEKA 4GYUA 3L6NA 1WW1A 2XR1A 5ACXA 2FM6A 5EV6A 5HISA 3A4YA 4AD9A 2E7YA 5LCAA 3SFPA 4AXHA 3TP9A 3SBLA 4J5FA 4AV7A 4D1UA 4UWSB 2ZWRA 2I7XA 4KEQA 4TZ9A 4Z5ZA 2FU8A 5EVBA 1YCHA 5AYAA 1KO2A 3Q6VA 5B15A 4EYBA 1BC2A 4NURA 2AIOA 2BC2A 5AHOA 1XTOA 3FAIA 2Q9UA 3I11A 4TZEA 5EVKA 2H6AA 1HLKA 2BMIA 4NQ5A 3I14A 2QINA 4TYTA 1DDKA 2BGAA 4FR7A 5ACSA 2YNUA 2XF4A 2FHXA 3IEMA 3IOFA 2Q0JA 2WYLA 2FU7A 3IDZA 4UAMA 2Y8BA 4NQ4A 4RBSA 4BP0A 1ZNBA 3BK2A 1VMEA 1DD6A 5KIKA 3X2XA 5HH6A 4C1DA 2Y8AA 2M5CA 1M2XA 4FEKA 2OHHA 3PY5A 2CFUA 2FHXB 1L9YA 3AJ3A 1MQOA 3DH8A 2P1EA 2P18A 2OHIA 5K4NA 2BG6A 2HB9A 3T9MA 4KEPA 5LCHA 4ZEJA 4F6HA 1JJTA 4V0HA 4D1TA 4TYFA 3WXCA 1VGNA 3DHAA 5DPXA 5FQCA 4YSLA 2FK6A 1WUPA 5ACQA 2BFZA 1ZTCA 4EXYA 5LMCA 2FU9A 1X8IA 4ZNBA 2NZFA 4XWTA 4EYFA 4TZFA 2QJSA 2M5DA 5K4MA 2GKLA 2GFJA 4XUKA 5FQBA 3R2UA 1DXKA 4PDXA 3AF6A 3DHCA 2BFZB 3G1PA 4ZO3A 4AWZA 3S0ZA 3QH8A 1JT1A 4WD6A 4DILA 4EXSA 2DOOA 4UWRB 2YZ3A
chains in the Genus database with same CATH topology
2NXAA 5EW0A 3IELA 2YNVA 5HIOA 3RKKA 4Z67A 3X2ZA 5ACRA 3AF5A 4YSBA 3IE0A 5EV8A 4P62A 1E5DA 4YSKA 5AXRA 3ZR9A 1WUOA 3SW3A 4GCWA 5FQAA 2BG8A 3F9OA 4C09A 3SRXA 4TZBA 1VJNA 2QDTA 1KR3A 1P9EA 2YNVB 3ZWFA 4PVTA 2BFLA 2ZZIA 2DKFA 5ACTA 1BMCA 3KNRA 1YCFA 4GYQA 3X30A 3PY6A 3X2YA 2Y87A 5LM6A 4C1HA 1JJEA 5LS3A 2CBNA 4D02A 2BG8B 4D1WA 3IE2A 2GCUA 4UWOB 4XWWA 1QH5A 3KL7A 3RKJA 2A7MA 2BFKA 4B87A 4EY2A 4RAWA 4Z7RA 3ESHA 4FSBA 4RM5A 4O98A 5KILA 3JXPA 4UWPB 3I0VA 2WHGA 4HL2A 5HIQA 3IOGA 5ACPA 4U4LA 3T3NA 3I15A 4JO0A 2Q0IA 4Z6XA 5LSCA 4D1VA 5LE1A 5HH4A 2UYXA 2BIBA 1QH3A 2Q42A 2P97A 1K07A 2ZO4A 5B1UA 4RL0A 3SD9A 3IE1A 2VW8A 3MD7A 4RL2A 3VPEA 5AHRA 5HIPA 3ADRA 2BR6A 4H0DA 5A87A 1XM8A 2R2DA 2YNTA 4AX0B 4C1CA 3BV6A 2NYPA 2BG7A 4EFZA 2WRSA 4DIKA 1A7TA 2I7VA 3RPCA 1WRAA 4NQ2A 2YNWA 4C1FA 3DHBA 5AEBA 5EHTA 1KO3A 3FCZA 2BG2A 4ZO2A 1A8TA 2YNTB 5AXOA 3P2UA 4LE6A 5A5ZA 1BVTA 5ACVA 4PVOA 1YCGA 2OHJA 3BK1A 2NZEA 2QEDA 3KNSA 2FU6A 5HH5A 2QDSA 4CHLA 4F6ZA 4AX1B 1X8HA 4UBQA 5LCFA 5B3RA 1ZKPA 4RAMA 5ACUA 3LVZA 4Z5YA 4HKYA 2AZ4A 2ZNBA 3ZQ4A 3BC2A 4BZ3A 5K4KA 3SPUA 3VQZA 2YCBA 4EYLA 4HL1A 2GMNA 5EVDA 5EH9A 1X8GA 5EWAA 2BTNA 2GFKA 4AWYB 2WYMC 5A0TA 1SMLA 3PG4A 3T3OA 3ZNBA 4C1GA 5K0WA 2WYMA 5A0VA 4Z60A 3I13A 4C1EA 1Y44A 5ACWA 2I7TA 2P4ZA 4J5HA 5LLDA 4NQ6A 3H3EA 4UA4A 5IQKA 3IEKA 4GYUA 3L6NA 1WW1A 2XR1A 5ACXA 2FM6A 5EV6A 5HISA 3A4YA 4AD9A 2E7YA 5LCAA 3SFPA 3TP9A 3SBLA 4J5FA 4D1UA 4UWSB 2ZWRA 2I7XA 4KEQA 4TZ9A 4Z5ZA 2FU8A 5EVBA 1YCHA 5AYAA 1KO2A 3Q6VA 5B15A 4EYBA 1BC2A 2AIOA 2BC2A 5AHOA 1XTOA 3FAIA 2Q9UA 3I11A 4TZEA 5EVKA 2H6AA 1HLKA 2BMIA 4NQ5A 3I14A 2QINA 4TYTA 1DDKA 2BGAA 4FR7A 5ACSA 2YNUA 2XF4A 2FHXA 3IEMA 3IOFA 2Q0JA 2WYLA 2FU7A 3IDZA 4UAMA 2Y8BA 4NQ4A 4RBSA 4BP0A 1ZNBA 3BK2A 1VMEA 1DD6A 5KIKA 3X2XA 5HH6A 4C1DA 2Y8AA 2M5CA 1M2XA 4FEKA 2OHHA 3PY5A 2FHXB 1L9YA 3AJ3A 1MQOA 3DH8A 2P1EA 2P18A 2OHIA 5K4NA 2BG6A 2HB9A 3T9MA 4KEPA 5LCHA 4ZEJA 4F6HA 1JJTA 4V0HA 4D1TA 4TYFA 3WXCA 1VGNA 3DHAA 5DPXA 5FQCA 4YSLA 2FK6A 1WUPA 5ACQA 2BFZA 1ZTCA 4EXYA 5LMCA 2FU9A 1X8IA 4ZNBA 2NZFA 4XWTA 4EYFA 4TZFA 2QJSA 2M5DA 5K4MA 2GKLA 2GFJA 4XUKA 5FQBA 3R2UA 1DXKA 3AF6A 3DHCA 2BFZB 3G1PA 4ZO3A 4AWZA 3S0ZA 3QH8A 1JT1A 4WD6A 4DILA 4EXSA 2DOOA 4UWRB 2YZ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NXA A;  5EW0 A;  3IEL A;  2YNV A;  5HIO A;  3RKK A;  4Z67 A;  3X2Z A;  5ACR A;  3AF5 A;  4YSB A;  3IE0 A;  5EV8 A;  4P62 A;  1E5D A;  4YSK A;  5AXR A;  3ZR9 A;  1WUO A;  3SW3 A;  4GCW A;  5FQA A;  2BG8 A;  3F9O A;  4C09 A;  3SRX A;  4TZB A;  1VJN A;  2QDT A;  1KR3 A;  1P9E A;  2YNV B;  3ZWF A;  4PVT A;  2BFL A;  2ZZI A;  2DKF A;  5ACT A;  1BMC A;  3KNR A;  1YCF A;  4GYQ A;  3X30 A;  3PY6 A;  3X2Y A;  2Y87 A;  5LM6 A;  4C1H A;  1JJE A;  5LS3 A;  2CBN A;  4D02 A;  2BG8 B;  4D1W A;  3IE2 A;  2GCU A;  4UWO B;  4XWW A;  1QH5 A;  3KL7 A;  3RKJ A;  2A7M A;  2BFK A;  4B87 A;  4EY2 A;  4RAW A;  4Z7R A;  3ESH A;  4FSB A;  4RM5 A;  4O98 A;  5KIL A;  3JXP A;  4UWP B;  3I0V A;  2WHG A;  4HL2 A;  5HIQ A;  3IOG A;  5ACP A;  4U4L A;  3T3N A;  3I15 A;  4JO0 A;  2Q0I A;  4Z6X A;  5LSC A;  4D1V A;  5LE1 A;  5HH4 A;  2UYX A;  2BIB A;  1QH3 A;  2Q42 A;  2P97 A;  1K07 A;  2ZO4 A;  5B1U A;  4RL0 A;  3SD9 A;  3IE1 A;  2VW8 A;  3MD7 A;  4RL2 A;  3VPE A;  5AHR A;  5HIP A;  3ADR A;  2BR6 A;  4H0D A;  5A87 A;  1XM8 A;  2R2D A;  2YNT A;  4AX0 B;  4C1C A;  3BV6 A;  2NYP A;  2BG7 A;  4EFZ A;  2WRS A;  4DIK A;  1A7T A;  2I7V A;  3RPC A;  1WRA A;  4NQ2 A;  2YNW A;  4C1F A;  3DHB A;  5AEB A;  5EHT A;  1KO3 A;  3FCZ A;  2BG2 A;  4ZO2 A;  1A8T A;  2YNT B;  5AXO A;  3P2U A;  4LE6 A;  5A5Z A;  1BVT A;  5ACV A;  4PVO A;  1YCG A;  2OHJ A;  3BK1 A;  2NZE A;  2QED A;  3KNS A;  2FU6 A;  5HH5 A;  2QDS A;  4CHL A;  4F6Z A;  4AX1 B;  1X8H A;  4UBQ A;  5LCF A;  5B3R A;  1ZKP A;  4RAM A;  5ACU A;  3LVZ A;  4Z5Y A;  4HKY A;  2AZ4 A;  2ZNB A;  3ZQ4 A;  3BC2 A;  4BZ3 A;  5K4K A;  3SPU A;  3VQZ A;  2YCB A;  4EYL A;  4HL1 A;  2GMN A;  5EVD A;  5EH9 A;  1X8G A;  5EWA A;  2BTN A;  2GFK A;  4AWY B;  2WYM C;  5A0T A;  1SML A;  3PG4 A;  3T3O A;  3ZNB A;  4C1G A;  5K0W A;  2WYM A;  5A0V A;  4Z60 A;  3I13 A;  4C1E A;  1Y44 A;  5ACW A;  2I7T A;  2P4Z A;  4J5H A;  5LLD A;  4NQ6 A;  3H3E A;  4UA4 A;  5IQK A;  3IEK A;  4GYU A;  3L6N A;  1WW1 A;  2XR1 A;  5ACX A;  2FM6 A;  5EV6 A;  5HIS A;  3A4Y A;  4AD9 A;  2E7Y A;  5LCA A;  3SFP A;  3TP9 A;  3SBL A;  4J5F A;  4D1U A;  4UWS B;  2ZWR A;  2I7X A;  4KEQ A;  4TZ9 A;  4Z5Z A;  2FU8 A;  5EVB A;  1YCH A;  5AYA A;  1KO2 A;  3Q6V A;  5B15 A;  4EYB A;  1BC2 A;  2AIO A;  2BC2 A;  5AHO A;  1XTO A;  3FAI A;  2Q9U A;  3I11 A;  4TZE A;  5EVK A;  2H6A A;  1HLK A;  2BMI A;  4NQ5 A;  3I14 A;  2QIN A;  4TYT A;  1DDK A;  2BGA A;  4FR7 A;  5ACS A;  2YNU A;  2XF4 A;  2FHX A;  3IEM A;  3IOF A;  2Q0J A;  2WYL A;  2FU7 A;  3IDZ A;  4UAM A;  2Y8B A;  4NQ4 A;  4RBS A;  4BP0 A;  1ZNB A;  3BK2 A;  1VME A;  1DD6 A;  5KIK A;  3X2X A;  5HH6 A;  4C1D A;  2Y8A A;  2M5C A;  1M2X A;  4FEK A;  2OHH A;  3PY5 A;  2FHX B;  1L9Y A;  3AJ3 A;  1MQO A;  3DH8 A;  2P1E A;  2P18 A;  2OHI A;  5K4N A;  2BG6 A;  2HB9 A;  3T9M A;  4KEP A;  5LCH A;  4ZEJ A;  4F6H A;  1JJT A;  4V0H A;  4D1T A;  4TYF A;  3WXC A;  1VGN A;  3DHA A;  5DPX A;  5FQC A;  4YSL A;  2FK6 A;  1WUP A;  5ACQ A;  2BFZ A;  1ZTC A;  4EXY A;  5LMC A;  2FU9 A;  1X8I A;  4ZNB A;  2NZF A;  4XWT A;  4EYF A;  4TZF A;  2QJS A;  2M5D A;  5K4M A;  2GKL A;  2GFJ A;  4XUK A;  5FQB A;  3R2U A;  1DXK A;  3AF6 A;  3DHC A;  2BFZ B;  3G1P A;  4ZO3 A;  4AWZ A;  3S0Z A;  3QH8 A;  1JT1 A;  4WD6 A;  4DIL A;  4EXS A;  2DOO A;  4UWR B;  2YZ3 A; 
#chains in the Genus database with same CATH topology
 2NXA A;  5EW0 A;  3IEL A;  2YNV A;  5HIO A;  3RKK A;  4Z67 A;  3X2Z A;  5ACR A;  3AF5 A;  4YSB A;  3IE0 A;  5EV8 A;  4P62 A;  1E5D A;  4YSK A;  5AXR A;  3ZR9 A;  1WUO A;  3SW3 A;  4GCW A;  5FQA A;  2BG8 A;  3F9O A;  4C09 A;  5AIJ A;  3SRX A;  4TZB A;  1VJN A;  2QDT A;  1KR3 A;  1P9E A;  2YNV B;  3ZWF A;  4PVT A;  2BFL A;  2ZZI A;  2DKF A;  5ACT A;  1BMC A;  2CFZ A;  3KNR A;  1YCF A;  4GYQ A;  3X30 A;  3PY6 A;  3X2Y A;  2Y87 A;  5LM6 A;  4C1H A;  1JJE A;  5LS3 A;  2CBN A;  4D02 A;  2BG8 B;  4D1W A;  3IE2 A;  2GCU A;  4UWO B;  4XWW A;  1QH5 A;  3KL7 A;  3RKJ A;  2A7M A;  2BFK A;  4B87 A;  4EY2 A;  4RAW A;  4Z7R A;  3ESH A;  4FSB A;  4RM5 A;  4O98 A;  5KIL A;  3JXP A;  4UWP B;  3I0V A;  2WHG A;  4HL2 A;  5HIQ A;  3IOG A;  5ACP A;  4U4L A;  3T3N A;  3I15 A;  4JO0 A;  2Q0I A;  4Z6X A;  5LSC A;  4D1V A;  5LE1 A;  5HH4 A;  2CG3 A;  2UYX A;  2BIB A;  1QH3 A;  2Q42 A;  2P97 A;  1K07 A;  2ZO4 A;  5B1U A;  4RL0 A;  3SD9 A;  3IE1 A;  2VW8 A;  3MD7 A;  4RL2 A;  3VPE A;  5AHR A;  5HIP A;  3ADR A;  2BR6 A;  4H0D A;  5A87 A;  1XM8 A;  2R2D A;  2YNT A;  4AX0 B;  4C1C A;  3BV6 A;  2NYP A;  2BG7 A;  4EFZ A;  2WRS A;  4DIK A;  1A7T A;  2I7V A;  3RPC A;  1WRA A;  4NQ2 A;  2CG2 A;  2YNW A;  5AJL A;  4C1F A;  3DHB A;  5AEB A;  5EHT A;  1KO3 A;  3FCZ A;  2BG2 A;  4ZO2 A;  1A8T A;  2YNT B;  5AXO A;  3P2U A;  5A23 A;  4LE6 A;  5A5Z A;  1BVT A;  5ACV A;  4PVO A;  1YCG A;  2OHJ A;  3BK1 A;  2NZE A;  2QED A;  3KNS A;  2FU6 A;  5HH5 A;  2QDS A;  4CHL A;  4F6Z A;  4AX1 B;  1X8H A;  4UBQ A;  5LCF A;  5B3R A;  1ZKP A;  4RAM A;  5ACU A;  3LVZ A;  4Z5Y A;  4HKY A;  2AZ4 A;  2ZNB A;  3ZQ4 A;  3BC2 A;  4BZ3 A;  5K4K A;  3SPU A;  3VQZ A;  2YCB A;  4EYL A;  4HL1 A;  2GMN A;  5EVD A;  5EH9 A;  1X8G A;  5EWA A;  2BTN A;  2GFK A;  4AWY B;  2WYM C;  5A0T A;  1SML A;  3PG4 A;  3T3O A;  3ZNB A;  4C1G A;  5K0W A;  2WYM A;  5A0V A;  4Z60 A;  3I13 A;  4C1E A;  1Y44 A;  5ACW A;  2I7T A;  2P4Z A;  4J5H A;  5LLD A;  4NQ6 A;  3H3E A;  4UA4 A;  2YHE A;  5IQK A;  3IEK A;  4GYU A;  3L6N A;  1WW1 A;  2XR1 A;  5ACX A;  2FM6 A;  5EV6 A;  5HIS A;  3A4Y A;  4AD9 A;  2E7Y A;  5LCA A;  3SFP A;  4AXH A;  3TP9 A;  3SBL A;  4J5F A;  4AV7 A;  4D1U A;  4UWS B;  2ZWR A;  2I7X A;  4KEQ A;  4TZ9 A;  4Z5Z A;  2FU8 A;  5EVB A;  1YCH A;  5AYA A;  1KO2 A;  3Q6V A;  5B15 A;  4EYB A;  1BC2 A;  4NUR A;  2AIO A;  2BC2 A;  5AHO A;  1XTO A;  3FAI A;  2Q9U A;  3I11 A;  4TZE A;  5EVK A;  2H6A A;  1HLK A;  2BMI A;  4NQ5 A;  3I14 A;  2QIN A;  4TYT A;  1DDK A;  2BGA A;  4FR7 A;  5ACS A;  2YNU A;  2XF4 A;  2FHX A;  3IEM A;  3IOF A;  2Q0J A;  2WYL A;  2FU7 A;  3IDZ A;  4UAM A;  2Y8B A;  4NQ4 A;  4RBS A;  4BP0 A;  1ZNB A;  3BK2 A;  1VME A;  1DD6 A;  5KIK A;  3X2X A;  5HH6 A;  4C1D A;  2Y8A A;  2M5C A;  1M2X A;  4FEK A;  2OHH A;  3PY5 A;  2CFU A;  2FHX B;  1L9Y A;  3AJ3 A;  1MQO A;  3DH8 A;  2P1E A;  2P18 A;  2OHI A;  5K4N A;  2BG6 A;  2HB9 A;  3T9M A;  4KEP A;  5LCH A;  4ZEJ A;  4F6H A;  1JJT A;  4V0H A;  4D1T A;  4TYF A;  3WXC A;  1VGN A;  3DHA A;  5DPX A;  5FQC A;  4YSL A;  2FK6 A;  1WUP A;  5ACQ A;  2BFZ A;  1ZTC A;  4EXY A;  5LMC A;  2FU9 A;  1X8I A;  4ZNB A;  2NZF A;  4XWT A;  4EYF A;  4TZF A;  2QJS A;  2M5D A;  5K4M A;  2GKL A;  2GFJ A;  4XUK A;  5FQB A;  3R2U A;  1DXK A;  4PDX A;  3AF6 A;  3DHC A;  2BFZ B;  3G1P A;  4ZO3 A;  4AWZ A;  3S0Z A;  3QH8 A;  1JT1 A;  4WD6 A;  4DIL A;  4EXS A;  2DOO A;  4UWR B;  2YZ3 A; 
#chains in the Genus database with same CATH homology
 2NXA A;  5EW0 A;  3IEL A;  2YNV A;  5HIO A;  3RKK A;  4Z67 A;  3X2Z A;  5ACR A;  3AF5 A;  4YSB A;  3IE0 A;  5EV8 A;  4P62 A;  1E5D A;  4YSK A;  5AXR A;  3ZR9 A;  1WUO A;  3SW3 A;  4GCW A;  5FQA A;  2BG8 A;  3F9O A;  4C09 A;  3SRX A;  4TZB A;  1VJN A;  2QDT A;  1KR3 A;  1P9E A;  2YNV B;  3ZWF A;  4PVT A;  2BFL A;  2ZZI A;  2DKF A;  5ACT A;  1BMC A;  3KNR A;  1YCF A;  4GYQ A;  3X30 A;  3PY6 A;  3X2Y A;  2Y87 A;  5LM6 A;  4C1H A;  1JJE A;  5LS3 A;  2CBN A;  4D02 A;  2BG8 B;  4D1W A;  3IE2 A;  2GCU A;  4UWO B;  4XWW A;  1QH5 A;  3KL7 A;  3RKJ A;  2A7M A;  2BFK A;  4B87 A;  4EY2 A;  4RAW A;  4Z7R A;  3ESH A;  4FSB A;  4RM5 A;  4O98 A;  5KIL A;  3JXP A;  4UWP B;  3I0V A;  2WHG A;  4HL2 A;  5HIQ A;  3IOG A;  5ACP A;  4U4L A;  3T3N A;  3I15 A;  4JO0 A;  2Q0I A;  4Z6X A;  5LSC A;  4D1V A;  5LE1 A;  5HH4 A;  2UYX A;  2BIB A;  1QH3 A;  2Q42 A;  2P97 A;  1K07 A;  2ZO4 A;  5B1U A;  4RL0 A;  3SD9 A;  3IE1 A;  2VW8 A;  3MD7 A;  4RL2 A;  3VPE A;  5AHR A;  5HIP A;  3ADR A;  2BR6 A;  4H0D A;  5A87 A;  1XM8 A;  2R2D A;  2YNT A;  4AX0 B;  4C1C A;  3BV6 A;  2NYP A;  2BG7 A;  4EFZ A;  2WRS A;  4DIK A;  1A7T A;  2I7V A;  3RPC A;  1WRA A;  4NQ2 A;  2YNW A;  4C1F A;  3DHB A;  5AEB A;  5EHT A;  1KO3 A;  3FCZ A;  2BG2 A;  4ZO2 A;  1A8T A;  2YNT B;  5AXO A;  3P2U A;  4LE6 A;  5A5Z A;  1BVT A;  5ACV A;  4PVO A;  1YCG A;  2OHJ A;  3BK1 A;  2NZE A;  2QED A;  3KNS A;  2FU6 A;  5HH5 A;  2QDS A;  4CHL A;  4F6Z A;  4AX1 B;  1X8H A;  4UBQ A;  5LCF A;  5B3R A;  1ZKP A;  4RAM A;  5ACU A;  3LVZ A;  4Z5Y A;  4HKY A;  2AZ4 A;  2ZNB A;  3ZQ4 A;  3BC2 A;  4BZ3 A;  5K4K A;  3SPU A;  3VQZ A;  2YCB A;  4EYL A;  4HL1 A;  2GMN A;  5EVD A;  5EH9 A;  1X8G A;  5EWA A;  2BTN A;  2GFK A;  4AWY B;  2WYM C;  5A0T A;  1SML A;  3PG4 A;  3T3O A;  3ZNB A;  4C1G A;  5K0W A;  2WYM A;  5A0V A;  4Z60 A;  3I13 A;  4C1E A;  1Y44 A;  5ACW A;  2I7T A;  2P4Z A;  4J5H A;  5LLD A;  4NQ6 A;  3H3E A;  4UA4 A;  5IQK A;  3IEK A;  4GYU A;  3L6N A;  1WW1 A;  2XR1 A;  5ACX A;  2FM6 A;  5EV6 A;  5HIS A;  3A4Y A;  4AD9 A;  2E7Y A;  5LCA A;  3SFP A;  3TP9 A;  3SBL A;  4J5F A;  4D1U A;  4UWS B;  2ZWR A;  2I7X A;  4KEQ A;  4TZ9 A;  4Z5Z A;  2FU8 A;  5EVB A;  1YCH A;  5AYA A;  1KO2 A;  3Q6V A;  5B15 A;  4EYB A;  1BC2 A;  2AIO A;  2BC2 A;  5AHO A;  1XTO A;  3FAI A;  2Q9U A;  3I11 A;  4TZE A;  5EVK A;  2H6A A;  1HLK A;  2BMI A;  4NQ5 A;  3I14 A;  2QIN A;  4TYT A;  1DDK A;  2BGA A;  4FR7 A;  5ACS A;  2YNU A;  2XF4 A;  2FHX A;  3IEM A;  3IOF A;  2Q0J A;  2WYL A;  2FU7 A;  3IDZ A;  4UAM A;  2Y8B A;  4NQ4 A;  4RBS A;  4BP0 A;  1ZNB A;  3BK2 A;  1VME A;  1DD6 A;  5KIK A;  3X2X A;  5HH6 A;  4C1D A;  2Y8A A;  2M5C A;  1M2X A;  4FEK A;  2OHH A;  3PY5 A;  2FHX B;  1L9Y A;  3AJ3 A;  1MQO A;  3DH8 A;  2P1E A;  2P18 A;  2OHI A;  5K4N A;  2BG6 A;  2HB9 A;  3T9M A;  4KEP A;  5LCH A;  4ZEJ A;  4F6H A;  1JJT A;  4V0H A;  4D1T A;  4TYF A;  3WXC A;  1VGN A;  3DHA A;  5DPX A;  5FQC A;  4YSL A;  2FK6 A;  1WUP A;  5ACQ A;  2BFZ A;  1ZTC A;  4EXY A;  5LMC A;  2FU9 A;  1X8I A;  4ZNB A;  2NZF A;  4XWT A;  4EYF A;  4TZF A;  2QJS A;  2M5D A;  5K4M A;  2GKL A;  2GFJ A;  4XUK A;  5FQB A;  3R2U A;  1DXK A;  3AF6 A;  3DHC A;  2BFZ B;  3G1P A;  4ZO3 A;  4AWZ A;  3S0Z A;  3QH8 A;  1JT1 A;  4WD6 A;  4DIL A;  4EXS A;  2DOO A;  4UWR B;  2YZ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...