3VPEA

Crystal structure of metallo-beta-lactamase smb-1
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
259
structure length
259
Chain Sequence
RDWSSPQQPFTIYGNTHYVGTGGISAVLLSSPQGHILVDGTTEKGAQVVAANIRAMGFKLSDVKYILSTHSHEDHAGGISAMQKLTGATVLAGAANVDTLRTGVSPKSDPQFGSLSNFPGSAKVRAVADGELVKLGPLAVKAHATPGHTEGGITWTWQSCEQGKCKDVVFADSLTAVSADSYRFSDHPEVVASLRGSFEAVEKLSCDIAIAAHPEVNDMWTRQQRAAKEGNSAYVDNGACRAIAAAGRKRLETRLASEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Subclass B3 Metallo-beta-Lactamase SMB-1 and the Mode of Inhibition by the Common Metallo- -Lactamase Inhibitor Mercaptoacetate
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Hydrolase
molecule keywords Metallo-beta-lactamase
total genus 85
structure length 259
sequence length 259
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3vpeA00
4J5HA 3I15A 1DXKA 3VPEA 4AX1B 4C1FA 2I7TA 4TZ9A 3PY5A 4GYQA 3ZWFA 4YSKA 2OHHA 3I11A 1A7TA 3I14A 1A8TA 2R2DA 4J5FA 5EVDA 4RAMA 2ZO4A 4C1HA 1HLKA 4D1VA 3P2UA 3KNSA 3IE2A 4ZNBA 2XR1A 1M2XA 4D02A 2BFLA 4EYLA 5KIKA 1BMCA 5HH6A 5FQCA 4EYBA 2GKLA 5AHOA 4PVOA 4UWRB 4EXYA 4F6ZA 2YCBA 5AXOA 2BC2A 5LE1A 3X30A 1KR3A 2DKFA 4XWTA 3BK1A 4TZFA 5ACWA 1SMLA 3DHAA 4TYTA 4AWZA 3IOGA 2VW8A 2QDTA 3ADRA 3L6NA 4NQ6A 3IDZA 3KNRA 4D1UA 5EWAA 2GCUA 1VJNA 4TZEA 4LE6A 2FK6A 5ACPA 3IOFA 3X2XA 3ESHA 2BTNA 4Z6XA 1YCFA 3T3OA 1XM8A 2FHXB 2ZWRA 3Q6VA 1XTOA 5KILA 5LLDA 5ACXA 1VGNA 3AF5A 3LVZA 3IELA 4Z60A 2FU6A 2I7XA 2BGAA 3SPUA 1WUOA 2A7MA 3H3EA 4UWPB 2OHJA 4F6HA 5LCHA 2GFJA 2Y8BA 1BVTA 4BZ3A 3BC2A 5ACUA 4UWSB 5ACTA 2P1EA 5B1UA 4AWYB 5A5ZA 2BG8A 5LCFA 2GFKA 3IE0A 5K4NA 4C1EA 2BFZB 4V0HA 1YCGA 3SFPA 1JT1A 2FU8A 4RM5A 2H6AA 2NZEA 4D1WA 5EV8A 1YCHA 3RKJA 1L9YA 2WYLA 2P4ZA 2ZZIA 1X8HA 3VQZA 5EH9A 1KO2A 3AF6A 1DD6A 4NQ2A 4P62A 1Y44A 5EHTA 4O98A 1X8IA 2XF4A 4FR7A 1WUPA 4GYUA 4U4LA 5IQKA 3TP9A 3I0VA 5FQAA 3I13A 4DILA 5ACQA 4FSBA 4YSLA 3KL7A 2BIBA 4UBQA 5LS3A 4ZEJA 4H0DA 4UA4A 2M5DA 1QH3A 1ZTCA 5AEBA 2BR6A 5A87A 4TZBA 3JXPA 2Y87A 3QH8A 4UAMA 1BC2A 4KEQA 3R2UA 5AHRA 5HH4A 2NYPA 5B15A 2P18A 2GMNA 1JJEA 3IE1A 4UWOB 1WW1A 3PG4A 1WRAA 3DHBA 4EYFA 2YNVB 4PVTA 5K4KA 2WYMA 4RAWA 2FHXA 1DDKA 4HL1A 3WXCA 2CBNA 5HIPA 4C1DA 2M5CA 4GCWA 4RBSA 2BG7A 4XUKA 5ACVA 4EFZA 4AX0B 2QDSA 2OHIA 4Z5ZA 2BMIA 1JJTA 4RL2A 3DH8A 3SBLA 2WRSA 3DHCA 2AZ4A 2YNUA 2FU9A 3SD9A 3X2YA 2YNWA 4C09A 5EV6A 3RKKA 2Q9UA 3ZR9A 4XWWA 2Q0IA 3A4YA 4C1CA 3RPCA 4YSBA 2WYMC 1VMEA 2Y8AA 5K4MA 4ZO3A 3G1PA 3MD7A 3BV6A 2YNVA 2WHGA 5LMCA 4HKYA 3X2ZA 5AYAA 5B3RA 2NZFA 1MQOA 5ACRA 4Z5YA 4D1TA 5EW0A 1ZNBA 2FM6A 5FQBA 3ZNBA 5EVKA 5A0TA 2DOOA 2QEDA 3SW3A 3S0ZA 2AIOA 4FEKA 2HB9A 4CHLA 5ACSA 4KEPA 4NQ4A 1E5DA 5A0VA 5HISA 5AXRA 4NQ5A 3AJ3A 2ZNBA 4Z67A 2UYXA 5HH5A 2QINA 2QJSA 5HIQA 3IEKA 5K0WA 3T9MA 4TYFA 4HL2A 2BG6A 4EXSA 2BFKA 2Q42A 3T3NA 1K07A 3FAIA 2E7YA 2I7VA 4BP0A 4B87A 2BG2A 2YZ3A 4EY2A 2BFZA 4JO0A 4C1GA 3IEMA 4AD9A 5LCAA 5HIOA 2NXAA 3FCZA 1ZKPA 2Q0JA 1X8GA 5LSCA 4ZO2A 2YNTB 3BK2A 3PY6A 1P9EA 4WD6A 4RL0A 4Z7RA 2YNTA 5DPXA 4DIKA 3SRXA 5EVBA 2FU7A 1QH5A 5LM6A 1KO3A 3ZQ4A 2BG8B 2P97A 3F9OA
chains in the Genus database with same CATH superfamily
4J5HA 3I15A 1DXKA 2CFZA 3VPEA 4AX1B 4C1FA 2I7TA 4TZ9A 3PY5A 4GYQA 3ZWFA 4YSKA 2OHHA 3I11A 1A7TA 3I14A 1A8TA 2R2DA 4J5FA 4PDXA 5EVDA 4RAMA 2ZO4A 4C1HA 1HLKA 4AXHA 4D1VA 3P2UA 3KNSA 3IE2A 4ZNBA 2XR1A 1M2XA 4D02A 2BFLA 4EYLA 5KIKA 1BMCA 5HH6A 5FQCA 4EYBA 2GKLA 5AHOA 4PVOA 4UWRB 4EXYA 4F6ZA 2YCBA 5AXOA 2BC2A 5LE1A 3X30A 1KR3A 2DKFA 4XWTA 3BK1A 4TZFA 5ACWA 1SMLA 3DHAA 4TYTA 4AWZA 3IOGA 2CFUA 2VW8A 2QDTA 4AV7A 3ADRA 3L6NA 4NQ6A 3IDZA 3KNRA 4D1UA 5EWAA 2GCUA 1VJNA 4TZEA 4LE6A 2FK6A 5ACPA 3IOFA 3X2XA 2CG3A 3ESHA 2BTNA 4Z6XA 1YCFA 3T3OA 1XM8A 5A23A 2FHXB 2ZWRA 3Q6VA 1XTOA 5KILA 5LLDA 5ACXA 1VGNA 3AF5A 3LVZA 3IELA 4Z60A 2FU6A 2I7XA 2BGAA 3SPUA 1WUOA 2A7MA 3H3EA 4UWPB 2OHJA 4F6HA 5LCHA 2GFJA 2Y8BA 1BVTA 4BZ3A 3BC2A 5ACUA 4UWSB 5ACTA 2CG2A 2P1EA 5B1UA 4AWYB 5A5ZA 2BG8A 5LCFA 2GFKA 3IE0A 5K4NA 4C1EA 2BFZB 4V0HA 1YCGA 3SFPA 1JT1A 2FU8A 4RM5A 2H6AA 2NZEA 4D1WA 5EV8A 1YCHA 3RKJA 1L9YA 2WYLA 2P4ZA 2ZZIA 1X8HA 3VQZA 5EH9A 1KO2A 3AF6A 1DD6A 4NQ2A 4P62A 1Y44A 5EHTA 4O98A 1X8IA 2YHEA 2XF4A 4FR7A 1WUPA 4GYUA 4U4LA 5IQKA 3TP9A 3I0VA 5FQAA 3I13A 4DILA 5ACQA 4FSBA 4YSLA 3KL7A 2BIBA 4UBQA 5LS3A 4ZEJA 4H0DA 4UA4A 2M5DA 1QH3A 1ZTCA 5AEBA 2BR6A 5A87A 4TZBA 3JXPA 2Y87A 3QH8A 4UAMA 1BC2A 4KEQA 3R2UA 5AHRA 5HH4A 2NYPA 5B15A 2P18A 2GMNA 1JJEA 3IE1A 4UWOB 1WW1A 3PG4A 1WRAA 3DHBA 4EYFA 2YNVB 4PVTA 5K4KA 2WYMA 4RAWA 2FHXA 1DDKA 4HL1A 3WXCA 2CBNA 5HIPA 4C1DA 2M5CA 4GCWA 4RBSA 2BG7A 4XUKA 5ACVA 4EFZA 4AX0B 2QDSA 2OHIA 4Z5ZA 2BMIA 1JJTA 5AIJA 4RL2A 3DH8A 3SBLA 2WRSA 3DHCA 2AZ4A 2YNUA 2FU9A 3SD9A 3X2YA 2YNWA 4C09A 5EV6A 3RKKA 2Q9UA 3ZR9A 4XWWA 2Q0IA 3A4YA 4C1CA 3RPCA 4YSBA 2WYMC 1VMEA 2Y8AA 5K4MA 4ZO3A 3G1PA 3MD7A 3BV6A 2YNVA 2WHGA 5LMCA 4HKYA 3X2ZA 5AYAA 5B3RA 2NZFA 1MQOA 5ACRA 4Z5YA 4D1TA 5EW0A 1ZNBA 2FM6A 5FQBA 3ZNBA 5EVKA 5A0TA 2DOOA 2QEDA 3SW3A 3S0ZA 5AJLA 2AIOA 4FEKA 2HB9A 4CHLA 5ACSA 4KEPA 4NQ4A 1E5DA 5A0VA 5HISA 5AXRA 4NQ5A 3AJ3A 2ZNBA 4Z67A 2UYXA 5HH5A 2QINA 2QJSA 5HIQA 3IEKA 5K0WA 3T9MA 4TYFA 4HL2A 2BG6A 4EXSA 2BFKA 2Q42A 3T3NA 1K07A 3FAIA 2E7YA 2I7VA 4BP0A 4B87A 2BG2A 2YZ3A 4EY2A 2BFZA 4JO0A 4C1GA 3IEMA 4AD9A 5LCAA 5HIOA 2NXAA 3FCZA 1ZKPA 2Q0JA 1X8GA 5LSCA 4ZO2A 2YNTB 3BK2A 4NURA 3PY6A 1P9EA 4WD6A 4RL0A 4Z7RA 2YNTA 5DPXA 4DIKA 3SRXA 5EVBA 2FU7A 1QH5A 5LM6A 1KO3A 3ZQ4A 2BG8B 2P97A 3F9OA
chains in the Genus database with same CATH topology
4J5HA 3I15A 1DXKA 3VPEA 4AX1B 4C1FA 2I7TA 4TZ9A 3PY5A 4GYQA 3ZWFA 4YSKA 2OHHA 3I11A 1A7TA 3I14A 1A8TA 2R2DA 4J5FA 5EVDA 4RAMA 2ZO4A 4C1HA 1HLKA 4D1VA 3P2UA 3KNSA 3IE2A 4ZNBA 2XR1A 1M2XA 4D02A 2BFLA 4EYLA 5KIKA 1BMCA 5HH6A 5FQCA 4EYBA 2GKLA 5AHOA 4PVOA 4UWRB 4EXYA 4F6ZA 2YCBA 5AXOA 2BC2A 5LE1A 3X30A 1KR3A 2DKFA 4XWTA 3BK1A 4TZFA 5ACWA 1SMLA 3DHAA 4TYTA 4AWZA 3IOGA 2VW8A 2QDTA 3ADRA 3L6NA 4NQ6A 3IDZA 3KNRA 4D1UA 5EWAA 2GCUA 1VJNA 4TZEA 4LE6A 2FK6A 5ACPA 3IOFA 3X2XA 3ESHA 2BTNA 4Z6XA 1YCFA 3T3OA 1XM8A 2FHXB 2ZWRA 3Q6VA 1XTOA 5KILA 5LLDA 5ACXA 1VGNA 3AF5A 3LVZA 3IELA 4Z60A 2FU6A 2I7XA 2BGAA 3SPUA 1WUOA 2A7MA 3H3EA 4UWPB 2OHJA 4F6HA 5LCHA 2GFJA 2Y8BA 1BVTA 4BZ3A 3BC2A 5ACUA 4UWSB 5ACTA 2P1EA 5B1UA 4AWYB 5A5ZA 2BG8A 5LCFA 2GFKA 3IE0A 5K4NA 4C1EA 2BFZB 4V0HA 1YCGA 3SFPA 1JT1A 2FU8A 4RM5A 2H6AA 2NZEA 4D1WA 5EV8A 1YCHA 3RKJA 1L9YA 2WYLA 2P4ZA 2ZZIA 1X8HA 3VQZA 5EH9A 1KO2A 3AF6A 1DD6A 4NQ2A 4P62A 1Y44A 5EHTA 4O98A 1X8IA 2XF4A 4FR7A 1WUPA 4GYUA 4U4LA 5IQKA 3TP9A 3I0VA 5FQAA 3I13A 4DILA 5ACQA 4FSBA 4YSLA 3KL7A 2BIBA 4UBQA 5LS3A 4ZEJA 4H0DA 4UA4A 2M5DA 1QH3A 1ZTCA 5AEBA 2BR6A 5A87A 4TZBA 3JXPA 2Y87A 3QH8A 4UAMA 1BC2A 4KEQA 3R2UA 5AHRA 5HH4A 2NYPA 5B15A 2P18A 2GMNA 1JJEA 3IE1A 4UWOB 1WW1A 3PG4A 1WRAA 3DHBA 4EYFA 2YNVB 4PVTA 5K4KA 2WYMA 4RAWA 2FHXA 1DDKA 4HL1A 3WXCA 2CBNA 5HIPA 4C1DA 2M5CA 4GCWA 4RBSA 2BG7A 4XUKA 5ACVA 4EFZA 4AX0B 2QDSA 2OHIA 4Z5ZA 2BMIA 1JJTA 4RL2A 3DH8A 3SBLA 2WRSA 3DHCA 2AZ4A 2YNUA 2FU9A 3SD9A 3X2YA 2YNWA 4C09A 5EV6A 3RKKA 2Q9UA 3ZR9A 4XWWA 2Q0IA 3A4YA 4C1CA 3RPCA 4YSBA 2WYMC 1VMEA 2Y8AA 5K4MA 4ZO3A 3G1PA 3MD7A 3BV6A 2YNVA 2WHGA 5LMCA 4HKYA 3X2ZA 5AYAA 5B3RA 2NZFA 1MQOA 5ACRA 4Z5YA 4D1TA 5EW0A 1ZNBA 2FM6A 5FQBA 3ZNBA 5EVKA 5A0TA 2DOOA 2QEDA 3SW3A 3S0ZA 2AIOA 4FEKA 2HB9A 4CHLA 5ACSA 4KEPA 4NQ4A 1E5DA 5A0VA 5HISA 5AXRA 4NQ5A 3AJ3A 2ZNBA 4Z67A 2UYXA 5HH5A 2QINA 2QJSA 5HIQA 3IEKA 5K0WA 3T9MA 4TYFA 4HL2A 2BG6A 4EXSA 2BFKA 2Q42A 3T3NA 1K07A 3FAIA 2E7YA 2I7VA 4BP0A 4B87A 2BG2A 2YZ3A 4EY2A 2BFZA 4JO0A 4C1GA 3IEMA 4AD9A 5LCAA 5HIOA 2NXAA 3FCZA 1ZKPA 2Q0JA 1X8GA 5LSCA 4ZO2A 2YNTB 3BK2A 3PY6A 1P9EA 4WD6A 4RL0A 4Z7RA 2YNTA 5DPXA 4DIKA 3SRXA 5EVBA 2FU7A 1QH5A 5LM6A 1KO3A 3ZQ4A 2BG8B 2P97A 3F9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J5H A;  3I15 A;  1DXK A;  3VPE A;  4AX1 B;  4C1F A;  2I7T A;  4TZ9 A;  3PY5 A;  4GYQ A;  3ZWF A;  4YSK A;  2OHH A;  3I11 A;  1A7T A;  3I14 A;  1A8T A;  2R2D A;  4J5F A;  5EVD A;  4RAM A;  2ZO4 A;  4C1H A;  1HLK A;  4D1V A;  3P2U A;  3KNS A;  3IE2 A;  4ZNB A;  2XR1 A;  1M2X A;  4D02 A;  2BFL A;  4EYL A;  5KIK A;  1BMC A;  5HH6 A;  5FQC A;  4EYB A;  2GKL A;  5AHO A;  4PVO A;  4UWR B;  4EXY A;  4F6Z A;  2YCB A;  5AXO A;  2BC2 A;  5LE1 A;  3X30 A;  1KR3 A;  2DKF A;  4XWT A;  3BK1 A;  4TZF A;  5ACW A;  1SML A;  3DHA A;  4TYT A;  4AWZ A;  3IOG A;  2VW8 A;  2QDT A;  3ADR A;  3L6N A;  4NQ6 A;  3IDZ A;  3KNR A;  4D1U A;  5EWA A;  2GCU A;  1VJN A;  4TZE A;  4LE6 A;  2FK6 A;  5ACP A;  3IOF A;  3X2X A;  3ESH A;  2BTN A;  4Z6X A;  1YCF A;  3T3O A;  1XM8 A;  2FHX B;  2ZWR A;  3Q6V A;  1XTO A;  5KIL A;  5LLD A;  5ACX A;  1VGN A;  3AF5 A;  3LVZ A;  3IEL A;  4Z60 A;  2FU6 A;  2I7X A;  2BGA A;  3SPU A;  1WUO A;  2A7M A;  3H3E A;  4UWP B;  2OHJ A;  4F6H A;  5LCH A;  2GFJ A;  2Y8B A;  1BVT A;  4BZ3 A;  3BC2 A;  5ACU A;  4UWS B;  5ACT A;  2P1E A;  5B1U A;  4AWY B;  5A5Z A;  2BG8 A;  5LCF A;  2GFK A;  3IE0 A;  5K4N A;  4C1E A;  2BFZ B;  4V0H A;  1YCG A;  3SFP A;  1JT1 A;  2FU8 A;  4RM5 A;  2H6A A;  2NZE A;  4D1W A;  5EV8 A;  1YCH A;  3RKJ A;  1L9Y A;  2WYL A;  2P4Z A;  2ZZI A;  1X8H A;  3VQZ A;  5EH9 A;  1KO2 A;  3AF6 A;  1DD6 A;  4NQ2 A;  4P62 A;  1Y44 A;  5EHT A;  4O98 A;  1X8I A;  2XF4 A;  4FR7 A;  1WUP A;  4GYU A;  4U4L A;  5IQK A;  3TP9 A;  3I0V A;  5FQA A;  3I13 A;  4DIL A;  5ACQ A;  4FSB A;  4YSL A;  3KL7 A;  2BIB A;  4UBQ A;  5LS3 A;  4ZEJ A;  4H0D A;  4UA4 A;  2M5D A;  1QH3 A;  1ZTC A;  5AEB A;  2BR6 A;  5A87 A;  4TZB A;  3JXP A;  2Y87 A;  3QH8 A;  4UAM A;  1BC2 A;  4KEQ A;  3R2U A;  5AHR A;  5HH4 A;  2NYP A;  5B15 A;  2P18 A;  2GMN A;  1JJE A;  3IE1 A;  4UWO B;  1WW1 A;  3PG4 A;  1WRA A;  3DHB A;  4EYF A;  2YNV B;  4PVT A;  5K4K A;  2WYM A;  4RAW A;  2FHX A;  1DDK A;  4HL1 A;  3WXC A;  2CBN A;  5HIP A;  4C1D A;  2M5C A;  4GCW A;  4RBS A;  2BG7 A;  4XUK A;  5ACV A;  4EFZ A;  4AX0 B;  2QDS A;  2OHI A;  4Z5Z A;  2BMI A;  1JJT A;  4RL2 A;  3DH8 A;  3SBL A;  2WRS A;  3DHC A;  2AZ4 A;  2YNU A;  2FU9 A;  3SD9 A;  3X2Y A;  2YNW A;  4C09 A;  5EV6 A;  3RKK A;  2Q9U A;  3ZR9 A;  4XWW A;  2Q0I A;  3A4Y A;  4C1C A;  3RPC A;  4YSB A;  2WYM C;  1VME A;  2Y8A A;  5K4M A;  4ZO3 A;  3G1P A;  3MD7 A;  3BV6 A;  2YNV A;  2WHG A;  5LMC A;  4HKY A;  3X2Z A;  5AYA A;  5B3R A;  2NZF A;  1MQO A;  5ACR A;  4Z5Y A;  4D1T A;  5EW0 A;  1ZNB A;  2FM6 A;  5FQB A;  3ZNB A;  5EVK A;  5A0T A;  2DOO A;  2QED A;  3SW3 A;  3S0Z A;  2AIO A;  4FEK A;  2HB9 A;  4CHL A;  5ACS A;  4KEP A;  4NQ4 A;  1E5D A;  5A0V A;  5HIS A;  5AXR A;  4NQ5 A;  3AJ3 A;  2ZNB A;  4Z67 A;  2UYX A;  5HH5 A;  2QIN A;  2QJS A;  5HIQ A;  3IEK A;  5K0W A;  3T9M A;  4TYF A;  4HL2 A;  2BG6 A;  4EXS A;  2BFK A;  2Q42 A;  3T3N A;  1K07 A;  3FAI A;  2E7Y A;  2I7V A;  4BP0 A;  4B87 A;  2BG2 A;  2YZ3 A;  4EY2 A;  2BFZ A;  4JO0 A;  4C1G A;  3IEM A;  4AD9 A;  5LCA A;  5HIO A;  2NXA A;  3FCZ A;  1ZKP A;  2Q0J A;  1X8G A;  5LSC A;  4ZO2 A;  2YNT B;  3BK2 A;  3PY6 A;  1P9E A;  4WD6 A;  4RL0 A;  4Z7R A;  2YNT A;  5DPX A;  4DIK A;  3SRX A;  5EVB A;  2FU7 A;  1QH5 A;  5LM6 A;  1KO3 A;  3ZQ4 A;  2BG8 B;  2P97 A;  3F9O A; 
#chains in the Genus database with same CATH topology
 4J5H A;  3I15 A;  1DXK A;  2CFZ A;  3VPE A;  4AX1 B;  4C1F A;  2I7T A;  4TZ9 A;  3PY5 A;  4GYQ A;  3ZWF A;  4YSK A;  2OHH A;  3I11 A;  1A7T A;  3I14 A;  1A8T A;  2R2D A;  4J5F A;  4PDX A;  5EVD A;  4RAM A;  2ZO4 A;  4C1H A;  1HLK A;  4AXH A;  4D1V A;  3P2U A;  3KNS A;  3IE2 A;  4ZNB A;  2XR1 A;  1M2X A;  4D02 A;  2BFL A;  4EYL A;  5KIK A;  1BMC A;  5HH6 A;  5FQC A;  4EYB A;  2GKL A;  5AHO A;  4PVO A;  4UWR B;  4EXY A;  4F6Z A;  2YCB A;  5AXO A;  2BC2 A;  5LE1 A;  3X30 A;  1KR3 A;  2DKF A;  4XWT A;  3BK1 A;  4TZF A;  5ACW A;  1SML A;  3DHA A;  4TYT A;  4AWZ A;  3IOG A;  2CFU A;  2VW8 A;  2QDT A;  4AV7 A;  3ADR A;  3L6N A;  4NQ6 A;  3IDZ A;  3KNR A;  4D1U A;  5EWA A;  2GCU A;  1VJN A;  4TZE A;  4LE6 A;  2FK6 A;  5ACP A;  3IOF A;  3X2X A;  2CG3 A;  3ESH A;  2BTN A;  4Z6X A;  1YCF A;  3T3O A;  1XM8 A;  5A23 A;  2FHX B;  2ZWR A;  3Q6V A;  1XTO A;  5KIL A;  5LLD A;  5ACX A;  1VGN A;  3AF5 A;  3LVZ A;  3IEL A;  4Z60 A;  2FU6 A;  2I7X A;  2BGA A;  3SPU A;  1WUO A;  2A7M A;  3H3E A;  4UWP B;  2OHJ A;  4F6H A;  5LCH A;  2GFJ A;  2Y8B A;  1BVT A;  4BZ3 A;  3BC2 A;  5ACU A;  4UWS B;  5ACT A;  2CG2 A;  2P1E A;  5B1U A;  4AWY B;  5A5Z A;  2BG8 A;  5LCF A;  2GFK A;  3IE0 A;  5K4N A;  4C1E A;  2BFZ B;  4V0H A;  1YCG A;  3SFP A;  1JT1 A;  2FU8 A;  4RM5 A;  2H6A A;  2NZE A;  4D1W A;  5EV8 A;  1YCH A;  3RKJ A;  1L9Y A;  2WYL A;  2P4Z A;  2ZZI A;  1X8H A;  3VQZ A;  5EH9 A;  1KO2 A;  3AF6 A;  1DD6 A;  4NQ2 A;  4P62 A;  1Y44 A;  5EHT A;  4O98 A;  1X8I A;  2YHE A;  2XF4 A;  4FR7 A;  1WUP A;  4GYU A;  4U4L A;  5IQK A;  3TP9 A;  3I0V A;  5FQA A;  3I13 A;  4DIL A;  5ACQ A;  4FSB A;  4YSL A;  3KL7 A;  2BIB A;  4UBQ A;  5LS3 A;  4ZEJ A;  4H0D A;  4UA4 A;  2M5D A;  1QH3 A;  1ZTC A;  5AEB A;  2BR6 A;  5A87 A;  4TZB A;  3JXP A;  2Y87 A;  3QH8 A;  4UAM A;  1BC2 A;  4KEQ A;  3R2U A;  5AHR A;  5HH4 A;  2NYP A;  5B15 A;  2P18 A;  2GMN A;  1JJE A;  3IE1 A;  4UWO B;  1WW1 A;  3PG4 A;  1WRA A;  3DHB A;  4EYF A;  2YNV B;  4PVT A;  5K4K A;  2WYM A;  4RAW A;  2FHX A;  1DDK A;  4HL1 A;  3WXC A;  2CBN A;  5HIP A;  4C1D A;  2M5C A;  4GCW A;  4RBS A;  2BG7 A;  4XUK A;  5ACV A;  4EFZ A;  4AX0 B;  2QDS A;  2OHI A;  4Z5Z A;  2BMI A;  1JJT A;  5AIJ A;  4RL2 A;  3DH8 A;  3SBL A;  2WRS A;  3DHC A;  2AZ4 A;  2YNU A;  2FU9 A;  3SD9 A;  3X2Y A;  2YNW A;  4C09 A;  5EV6 A;  3RKK A;  2Q9U A;  3ZR9 A;  4XWW A;  2Q0I A;  3A4Y A;  4C1C A;  3RPC A;  4YSB A;  2WYM C;  1VME A;  2Y8A A;  5K4M A;  4ZO3 A;  3G1P A;  3MD7 A;  3BV6 A;  2YNV A;  2WHG A;  5LMC A;  4HKY A;  3X2Z A;  5AYA A;  5B3R A;  2NZF A;  1MQO A;  5ACR A;  4Z5Y A;  4D1T A;  5EW0 A;  1ZNB A;  2FM6 A;  5FQB A;  3ZNB A;  5EVK A;  5A0T A;  2DOO A;  2QED A;  3SW3 A;  3S0Z A;  5AJL A;  2AIO A;  4FEK A;  2HB9 A;  4CHL A;  5ACS A;  4KEP A;  4NQ4 A;  1E5D A;  5A0V A;  5HIS A;  5AXR A;  4NQ5 A;  3AJ3 A;  2ZNB A;  4Z67 A;  2UYX A;  5HH5 A;  2QIN A;  2QJS A;  5HIQ A;  3IEK A;  5K0W A;  3T9M A;  4TYF A;  4HL2 A;  2BG6 A;  4EXS A;  2BFK A;  2Q42 A;  3T3N A;  1K07 A;  3FAI A;  2E7Y A;  2I7V A;  4BP0 A;  4B87 A;  2BG2 A;  2YZ3 A;  4EY2 A;  2BFZ A;  4JO0 A;  4C1G A;  3IEM A;  4AD9 A;  5LCA A;  5HIO A;  2NXA A;  3FCZ A;  1ZKP A;  2Q0J A;  1X8G A;  5LSC A;  4ZO2 A;  2YNT B;  3BK2 A;  4NUR A;  3PY6 A;  1P9E A;  4WD6 A;  4RL0 A;  4Z7R A;  2YNT A;  5DPX A;  4DIK A;  3SRX A;  5EVB A;  2FU7 A;  1QH5 A;  5LM6 A;  1KO3 A;  3ZQ4 A;  2BG8 B;  2P97 A;  3F9O A; 
#chains in the Genus database with same CATH homology
 4J5H A;  3I15 A;  1DXK A;  3VPE A;  4AX1 B;  4C1F A;  2I7T A;  4TZ9 A;  3PY5 A;  4GYQ A;  3ZWF A;  4YSK A;  2OHH A;  3I11 A;  1A7T A;  3I14 A;  1A8T A;  2R2D A;  4J5F A;  5EVD A;  4RAM A;  2ZO4 A;  4C1H A;  1HLK A;  4D1V A;  3P2U A;  3KNS A;  3IE2 A;  4ZNB A;  2XR1 A;  1M2X A;  4D02 A;  2BFL A;  4EYL A;  5KIK A;  1BMC A;  5HH6 A;  5FQC A;  4EYB A;  2GKL A;  5AHO A;  4PVO A;  4UWR B;  4EXY A;  4F6Z A;  2YCB A;  5AXO A;  2BC2 A;  5LE1 A;  3X30 A;  1KR3 A;  2DKF A;  4XWT A;  3BK1 A;  4TZF A;  5ACW A;  1SML A;  3DHA A;  4TYT A;  4AWZ A;  3IOG A;  2VW8 A;  2QDT A;  3ADR A;  3L6N A;  4NQ6 A;  3IDZ A;  3KNR A;  4D1U A;  5EWA A;  2GCU A;  1VJN A;  4TZE A;  4LE6 A;  2FK6 A;  5ACP A;  3IOF A;  3X2X A;  3ESH A;  2BTN A;  4Z6X A;  1YCF A;  3T3O A;  1XM8 A;  2FHX B;  2ZWR A;  3Q6V A;  1XTO A;  5KIL A;  5LLD A;  5ACX A;  1VGN A;  3AF5 A;  3LVZ A;  3IEL A;  4Z60 A;  2FU6 A;  2I7X A;  2BGA A;  3SPU A;  1WUO A;  2A7M A;  3H3E A;  4UWP B;  2OHJ A;  4F6H A;  5LCH A;  2GFJ A;  2Y8B A;  1BVT A;  4BZ3 A;  3BC2 A;  5ACU A;  4UWS B;  5ACT A;  2P1E A;  5B1U A;  4AWY B;  5A5Z A;  2BG8 A;  5LCF A;  2GFK A;  3IE0 A;  5K4N A;  4C1E A;  2BFZ B;  4V0H A;  1YCG A;  3SFP A;  1JT1 A;  2FU8 A;  4RM5 A;  2H6A A;  2NZE A;  4D1W A;  5EV8 A;  1YCH A;  3RKJ A;  1L9Y A;  2WYL A;  2P4Z A;  2ZZI A;  1X8H A;  3VQZ A;  5EH9 A;  1KO2 A;  3AF6 A;  1DD6 A;  4NQ2 A;  4P62 A;  1Y44 A;  5EHT A;  4O98 A;  1X8I A;  2XF4 A;  4FR7 A;  1WUP A;  4GYU A;  4U4L A;  5IQK A;  3TP9 A;  3I0V A;  5FQA A;  3I13 A;  4DIL A;  5ACQ A;  4FSB A;  4YSL A;  3KL7 A;  2BIB A;  4UBQ A;  5LS3 A;  4ZEJ A;  4H0D A;  4UA4 A;  2M5D A;  1QH3 A;  1ZTC A;  5AEB A;  2BR6 A;  5A87 A;  4TZB A;  3JXP A;  2Y87 A;  3QH8 A;  4UAM A;  1BC2 A;  4KEQ A;  3R2U A;  5AHR A;  5HH4 A;  2NYP A;  5B15 A;  2P18 A;  2GMN A;  1JJE A;  3IE1 A;  4UWO B;  1WW1 A;  3PG4 A;  1WRA A;  3DHB A;  4EYF A;  2YNV B;  4PVT A;  5K4K A;  2WYM A;  4RAW A;  2FHX A;  1DDK A;  4HL1 A;  3WXC A;  2CBN A;  5HIP A;  4C1D A;  2M5C A;  4GCW A;  4RBS A;  2BG7 A;  4XUK A;  5ACV A;  4EFZ A;  4AX0 B;  2QDS A;  2OHI A;  4Z5Z A;  2BMI A;  1JJT A;  4RL2 A;  3DH8 A;  3SBL A;  2WRS A;  3DHC A;  2AZ4 A;  2YNU A;  2FU9 A;  3SD9 A;  3X2Y A;  2YNW A;  4C09 A;  5EV6 A;  3RKK A;  2Q9U A;  3ZR9 A;  4XWW A;  2Q0I A;  3A4Y A;  4C1C A;  3RPC A;  4YSB A;  2WYM C;  1VME A;  2Y8A A;  5K4M A;  4ZO3 A;  3G1P A;  3MD7 A;  3BV6 A;  2YNV A;  2WHG A;  5LMC A;  4HKY A;  3X2Z A;  5AYA A;  5B3R A;  2NZF A;  1MQO A;  5ACR A;  4Z5Y A;  4D1T A;  5EW0 A;  1ZNB A;  2FM6 A;  5FQB A;  3ZNB A;  5EVK A;  5A0T A;  2DOO A;  2QED A;  3SW3 A;  3S0Z A;  2AIO A;  4FEK A;  2HB9 A;  4CHL A;  5ACS A;  4KEP A;  4NQ4 A;  1E5D A;  5A0V A;  5HIS A;  5AXR A;  4NQ5 A;  3AJ3 A;  2ZNB A;  4Z67 A;  2UYX A;  5HH5 A;  2QIN A;  2QJS A;  5HIQ A;  3IEK A;  5K0W A;  3T9M A;  4TYF A;  4HL2 A;  2BG6 A;  4EXS A;  2BFK A;  2Q42 A;  3T3N A;  1K07 A;  3FAI A;  2E7Y A;  2I7V A;  4BP0 A;  4B87 A;  2BG2 A;  2YZ3 A;  4EY2 A;  2BFZ A;  4JO0 A;  4C1G A;  3IEM A;  4AD9 A;  5LCA A;  5HIO A;  2NXA A;  3FCZ A;  1ZKP A;  2Q0J A;  1X8G A;  5LSC A;  4ZO2 A;  2YNT B;  3BK2 A;  3PY6 A;  1P9E A;  4WD6 A;  4RL0 A;  4Z7R A;  2YNT A;  5DPX A;  4DIK A;  3SRX A;  5EVB A;  2FU7 A;  1QH5 A;  5LM6 A;  1KO3 A;  3ZQ4 A;  2BG8 B;  2P97 A;  3F9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...