3VPEA

Crystal structure of metallo-beta-lactamase smb-1
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
259
structure length
259
Chain Sequence
b'RDWSSPQQPFTIYGNTHYVGTGGISAVLLSSPQGHILVDGTTEKGAQVVAANIRAMGFKLSDVKYILSTHSHEDHAGGISAMQKLTGATVLAGAANVDTLRTGVSPKSDPQFGSLSNFPGSAKVRAVADGELVKLGPLAVKAHATPGHTEGGITWTWQSCEQGKCKDVVFADSLTAVSADSYRFSDHPEVVASLRGSFEAVEKLSCDIAIAAHPEVNDMWTRQQRAAKEGNSAYVDNGACRAIAAAGRKRLETRLASEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metallo-beta-lactamase
molecule tags Hydrolase
source organism Serratia marcescens
publication title Structural Insights into the Subclass B3 Metallo-beta-Lactamase SMB-1 and the Mode of Inhibition by the Common Metallo- -Lactamase Inhibitor Mercaptoacetate
pubmed doi rcsb
total genus 85
structure length 259
sequence length 259
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3vpeA00
2AZ4A 4C1DA 4BP0A 5FQCA 4Z7RA 3T3OA 5B3RA 1X8IA 5EHTA 3IEMA 4YSLA 5EV8A 4C1HA 5AXRA 2M5CA 4UWOB 5AEBA 4NQ5A 3AF6A 3IEKA 4FSBA 2QINA 5LCHA 2P18A 4EYLA 5HH6A 5LCFA 3BV6A 4TZEA 1DXKA 1XTOA 2QDTA 2BMIA 2Q42A 1A7TA 2CBNA 5DPXA 3H3EA 3KNRA 4C1FA 4UWRB 3RKJA 2NYPA 5ACWA 4XWTA 3IE2A 2DOOA 2XF4A 5AHOA 5LS3A 4JO0A 3VPEA 3X2XA 3AF5A 2P97A 1BC2A 3T3NA 1ZKPA 3LVZA 4AX1B 2OHJA 4NQ4A 3DHCA 3SRXA 3I0VA 3ZR9A 4UBQA 3F9OA 5EVKA 3X30A 4TYTA 1K07A 4RAWA 4NQ2A 3IELA 5EV6A 2BFZB 5FQBA 2WYLA 4FR7A 1KR3A 3QH8A 2YNWA 2I7VA 3I13A 2VW8A 2GFJA 2FM6A 2YNTB 4UWSB 4RM5A 1DD6A 2BC2A 4U4LA 1Y44A 3ZWFA 5HISA 2P4ZA 2FU7A 4WD6A 2NZEA 2P1EA 4RAMA 5HH4A 4UAMA 1QH5A 5LSCA 2YZ3A 4C09A 4V0HA 3ADRA 2BFKA 3IOGA 4KEPA 5ACXA 2BG6A 2GCUA 4YSKA 3PG4A 3BC2A 4XUKA 5K4MA 4UWPB 2FHXA 2OHHA 1BVTA 4Z6XA 2Q0IA 5HH5A 4P62A 1A8TA 2QJSA 4UA4A 4EYFA 1QH3A 4GYUA 4CHLA 4ZO2A 3BK2A 2WHGA 3R2UA 1WUOA 3PY5A 3FAIA 1WW1A 5EH9A 4D1WA 3ESHA 2NXAA 5ACRA 2FU8A 3FCZA 4C1CA 1L9YA 3G1PA 1KO3A 4C1GA 1ZTCA 2ZZIA 3PY6A 2YCBA 3WXCA 1P9EA 5AXOA 1VJNA 2WRSA 4TZFA 5LMCA 2ZNBA 4TZ9A 1VMEA 2NZFA 4ZNBA 4GCWA 4EXYA 2AIOA 4J5FA 4XWWA 3JXPA 4RL2A 4ZO3A 5KILA 2Y8AA 2QDSA 3DHBA 4B87A 5ACTA 5A5ZA 2BFZA 4H0DA 4HL2A 1YCFA 5ACQA 5K4KA 2YNUA 2R2DA 4D02A 1JJEA 3S0ZA 5IQKA 1WUPA 2BG2A 2Y8BA 1KO2A 3I15A 2BG8B 2OHIA 5KIKA 1YCGA 4EXSA 2E7YA 5K4NA 3SBLA 5HIPA 3DHAA 3ZQ4A 5A0VA 2Q9UA 4D1VA 1YCHA 5B1UA 4EY2A 4EFZA 2I7XA 2YNTA 1XM8A 1DDKA 2GMNA 2ZO4A 3VQZA 4LE6A 4KEQA 1SMLA 4RBSA 4RL0A 4O98A 4PVTA 2I7TA 4AD9A 2BR6A 3X2ZA 5LLDA 1BMCA 4BZ3A 5LM6A 4Z5YA 5EW0A 4DIKA 2FU6A 2DKFA 2M5DA 2H6AA 5AHRA 5AYAA 4AWZA 5A87A 3SPUA 3ZNBA 4AWYB 4F6HA 3IE0A 5A0TA 4C1EA 5EVDA 4HKYA 2YNVA 1E5DA 4EYBA 1M2XA 5HIQA 4J5HA 5LCAA 2BFLA 2A7MA 1JJTA 1X8GA 3SW3A 1WRAA 5K0WA 5LE1A 1X8HA 2FU9A 3SFPA 5B15A 3P2UA 3Q6VA 4YSBA 2QEDA 2BTNA 4ZEJA 3AJ3A 3I11A 3KNSA 2WYMA 4Z60A 5EWAA 2XR1A 4FEKA 2BGAA 3RPCA 4D1TA 2BG8A 5ACUA 2Q0JA 4NQ6A 3RKKA 3MD7A 1ZNBA 3SD9A 2YNVB 2BIBA 4TYFA 3IE1A 2GKLA 3X2YA 4GYQA 5FQAA 2Y87A 3T9MA 3IDZA 4TZBA 2HB9A 4PVOA 5ACPA 2WYMC 2GFKA 3DH8A 2ZWRA 4DILA 3TP9A 4Z5ZA 4AX0B 5HIOA 3I14A 2BG7A 1VGNA 2FK6A 2FHXB 2UYXA 1JT1A 5EVBA 3A4YA 5ACSA 4F6ZA 1HLKA 1MQOA 3BK1A 3IOFA 4D1UA 3KL7A 5ACVA 4Z67A 3L6NA 4HL1A
chains in the Genus database with same CATH superfamily
2AZ4A 4C1DA 4BP0A 5FQCA 4Z7RA 3T3OA 5B3RA 1X8IA 5EHTA 3IEMA 4YSLA 5EV8A 4C1HA 5AXRA 2M5CA 4UWOB 5AEBA 4NQ5A 3AF6A 3IEKA 4FSBA 2QINA 5LCHA 2P18A 4EYLA 5HH6A 5LCFA 3BV6A 4TZEA 1DXKA 1XTOA 2QDTA 2BMIA 2Q42A 1A7TA 2CBNA 5DPXA 3H3EA 3KNRA 4C1FA 4UWRB 4AV7A 3RKJA 2NYPA 5ACWA 4XWTA 3IE2A 2DOOA 2XF4A 5AHOA 5LS3A 4JO0A 3VPEA 3X2XA 3AF5A 2P97A 1BC2A 3T3NA 1ZKPA 3LVZA 4AX1B 2OHJA 4NQ4A 3DHCA 3SRXA 3I0VA 3ZR9A 4UBQA 3F9OA 5EVKA 3X30A 4TYTA 1K07A 4RAWA 4NQ2A 3IELA 5EV6A 2BFZB 5FQBA 2WYLA 4FR7A 1KR3A 3QH8A 2YNWA 2I7VA 3I13A 2VW8A 2GFJA 2FM6A 2YNTB 4UWSB 4RM5A 4NURA 1DD6A 2BC2A 4U4LA 4AXHA 1Y44A 3ZWFA 2P4ZA 5HISA 2FU7A 4WD6A 2NZEA 2P1EA 4RAMA 5HH4A 4UAMA 1QH5A 5LSCA 5A23A 2YZ3A 5AJLA 4C09A 4V0HA 3ADRA 2BFKA 3IOGA 4KEPA 5ACXA 2BG6A 2GCUA 4YSKA 3PG4A 3BC2A 4XUKA 5K4MA 4UWPB 2FHXA 2OHHA 1BVTA 4Z6XA 2Q0IA 5HH5A 4P62A 1A8TA 2CFUA 2QJSA 4UA4A 4EYFA 1QH3A 4GYUA 4CHLA 4ZO2A 3BK2A 2WHGA 3R2UA 1WUOA 3PY5A 3FAIA 1WW1A 5EH9A 4D1WA 3ESHA 2NXAA 5ACRA 2FU8A 3FCZA 2CG3A 4C1CA 1L9YA 3G1PA 1KO3A 4C1GA 1ZTCA 2ZZIA 3PY6A 2YCBA 3WXCA 1P9EA 5AXOA 1VJNA 2WRSA 4TZFA 5LMCA 2ZNBA 4TZ9A 1VMEA 2NZFA 4ZNBA 4GCWA 4EXYA 2AIOA 4J5FA 4XWWA 3JXPA 4RL2A 4ZO3A 5KILA 2Y8AA 2QDSA 3DHBA 2YHEA 4B87A 5ACTA 5A5ZA 2BFZA 4H0DA 4HL2A 1YCFA 5ACQA 5K4KA 2YNUA 2R2DA 4D02A 1JJEA 3S0ZA 5IQKA 1WUPA 2BG2A 2Y8BA 1KO2A 3I15A 2BG8B 2OHIA 5KIKA 1YCGA 4EXSA 2E7YA 5K4NA 3SBLA 5HIPA 3DHAA 3ZQ4A 5A0VA 2Q9UA 4D1VA 1YCHA 5B1UA 4EY2A 4EFZA 2I7XA 2YNTA 1XM8A 1DDKA 2GMNA 2ZO4A 3VQZA 4LE6A 4KEQA 1SMLA 4RBSA 4RL0A 4O98A 4PVTA 2I7TA 4AD9A 2BR6A 3X2ZA 5LLDA 1BMCA 4BZ3A 5LM6A 4Z5YA 5EW0A 4DIKA 2FU6A 2DKFA 2M5DA 2H6AA 5AHRA 5AYAA 5AIJA 4AWZA 5A87A 3SPUA 3ZNBA 4PDXA 4AWYB 4F6HA 3IE0A 5A0TA 4C1EA 5EVDA 4HKYA 2YNVA 1E5DA 4EYBA 1M2XA 5HIQA 4J5HA 5LCAA 2BFLA 2A7MA 1JJTA 1X8GA 3SW3A 1WRAA 5K0WA 5LE1A 1X8HA 2FU9A 3SFPA 5B15A 3P2UA 3Q6VA 4YSBA 2QEDA 2BTNA 4ZEJA 3AJ3A 3I11A 3KNSA 2WYMA 4Z60A 5EWAA 2XR1A 4FEKA 2BGAA 3RPCA 4D1TA 2BG8A 5ACUA 2Q0JA 4NQ6A 3RKKA 3MD7A 1ZNBA 3SD9A 2YNVB 2BIBA 4TYFA 3IE1A 2GKLA 3X2YA 4GYQA 5FQAA 2Y87A 3T9MA 3IDZA 4TZBA 2HB9A 4PVOA 5ACPA 2WYMC 2GFKA 3DH8A 2ZWRA 4DILA 2CFZA 3TP9A 4Z5ZA 4AX0B 5HIOA 3I14A 2BG7A 1VGNA 2FK6A 2FHXB 2UYXA 1JT1A 5EVBA 3A4YA 5ACSA 4F6ZA 1HLKA 1MQOA 3BK1A 3IOFA 4D1UA 3KL7A 2CG2A 5ACVA 4Z67A 3L6NA 4HL1A
chains in the Genus database with same CATH topology
2AZ4A 4C1DA 4BP0A 5FQCA 4Z7RA 3T3OA 5B3RA 1X8IA 5EHTA 3IEMA 4YSLA 5EV8A 4C1HA 5AXRA 2M5CA 4UWOB 5AEBA 4NQ5A 3AF6A 3IEKA 4FSBA 2QINA 5LCHA 2P18A 4EYLA 5HH6A 5LCFA 3BV6A 4TZEA 1DXKA 1XTOA 2QDTA 2BMIA 2Q42A 1A7TA 2CBNA 5DPXA 3H3EA 3KNRA 4C1FA 4UWRB 3RKJA 2NYPA 5ACWA 4XWTA 3IE2A 2DOOA 2XF4A 5AHOA 5LS3A 4JO0A 3VPEA 3X2XA 3AF5A 2P97A 1BC2A 3T3NA 1ZKPA 3LVZA 4AX1B 2OHJA 4NQ4A 3DHCA 3SRXA 3I0VA 3ZR9A 4UBQA 3F9OA 5EVKA 3X30A 4TYTA 1K07A 4RAWA 4NQ2A 3IELA 5EV6A 2BFZB 5FQBA 2WYLA 4FR7A 1KR3A 3QH8A 2YNWA 2I7VA 3I13A 2VW8A 2GFJA 2FM6A 2YNTB 4UWSB 4RM5A 1DD6A 2BC2A 4U4LA 1Y44A 3ZWFA 5HISA 2P4ZA 2FU7A 4WD6A 2NZEA 2P1EA 4RAMA 5HH4A 4UAMA 1QH5A 5LSCA 2YZ3A 4C09A 4V0HA 3ADRA 2BFKA 3IOGA 4KEPA 5ACXA 2BG6A 2GCUA 4YSKA 3PG4A 3BC2A 4XUKA 5K4MA 4UWPB 2FHXA 2OHHA 1BVTA 4Z6XA 2Q0IA 5HH5A 4P62A 1A8TA 2QJSA 4UA4A 4EYFA 1QH3A 4GYUA 4CHLA 4ZO2A 3BK2A 2WHGA 3R2UA 1WUOA 3PY5A 3FAIA 1WW1A 5EH9A 4D1WA 3ESHA 2NXAA 5ACRA 2FU8A 3FCZA 4C1CA 1L9YA 3G1PA 1KO3A 4C1GA 1ZTCA 2ZZIA 3PY6A 2YCBA 3WXCA 1P9EA 5AXOA 1VJNA 2WRSA 4TZFA 5LMCA 2ZNBA 4TZ9A 1VMEA 2NZFA 4ZNBA 4GCWA 4EXYA 2AIOA 4J5FA 4XWWA 3JXPA 4RL2A 4ZO3A 5KILA 2Y8AA 2QDSA 3DHBA 4B87A 5ACTA 5A5ZA 2BFZA 4H0DA 4HL2A 1YCFA 5ACQA 5K4KA 2YNUA 2R2DA 4D02A 1JJEA 3S0ZA 5IQKA 1WUPA 2BG2A 2Y8BA 1KO2A 3I15A 2BG8B 2OHIA 5KIKA 1YCGA 4EXSA 2E7YA 5K4NA 3SBLA 5HIPA 3DHAA 3ZQ4A 5A0VA 2Q9UA 4D1VA 1YCHA 5B1UA 4EY2A 4EFZA 2I7XA 2YNTA 1XM8A 1DDKA 2GMNA 2ZO4A 3VQZA 4LE6A 4KEQA 1SMLA 4RBSA 4RL0A 4O98A 4PVTA 2I7TA 4AD9A 2BR6A 3X2ZA 5LLDA 1BMCA 4BZ3A 5LM6A 4Z5YA 5EW0A 4DIKA 2FU6A 2DKFA 2M5DA 2H6AA 5AHRA 5AYAA 4AWZA 5A87A 3SPUA 3ZNBA 4AWYB 4F6HA 3IE0A 5A0TA 4C1EA 5EVDA 4HKYA 2YNVA 1E5DA 4EYBA 1M2XA 5HIQA 4J5HA 5LCAA 2BFLA 2A7MA 1JJTA 1X8GA 3SW3A 1WRAA 5K0WA 5LE1A 1X8HA 2FU9A 3SFPA 5B15A 3P2UA 3Q6VA 4YSBA 2QEDA 2BTNA 4ZEJA 3AJ3A 3I11A 3KNSA 2WYMA 4Z60A 5EWAA 2XR1A 4FEKA 2BGAA 3RPCA 4D1TA 2BG8A 5ACUA 2Q0JA 4NQ6A 3RKKA 3MD7A 1ZNBA 3SD9A 2YNVB 2BIBA 4TYFA 3IE1A 2GKLA 3X2YA 4GYQA 5FQAA 2Y87A 3T9MA 3IDZA 4TZBA 2HB9A 4PVOA 5ACPA 2WYMC 2GFKA 3DH8A 2ZWRA 4DILA 3TP9A 4Z5ZA 4AX0B 5HIOA 3I14A 2BG7A 1VGNA 2FK6A 2FHXB 2UYXA 1JT1A 5EVBA 3A4YA 5ACSA 4F6ZA 1HLKA 1MQOA 3BK1A 3IOFA 4D1UA 3KL7A 5ACVA 4Z67A 3L6NA 4HL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AZ4 A;  4C1D A;  4BP0 A;  5FQC A;  4Z7R A;  3T3O A;  5B3R A;  1X8I A;  5EHT A;  3IEM A;  4YSL A;  5EV8 A;  4C1H A;  5AXR A;  2M5C A;  4UWO B;  5AEB A;  4NQ5 A;  3AF6 A;  3IEK A;  4FSB A;  2QIN A;  5LCH A;  2P18 A;  4EYL A;  5HH6 A;  5LCF A;  3BV6 A;  4TZE A;  1DXK A;  1XTO A;  2QDT A;  2BMI A;  2Q42 A;  1A7T A;  2CBN A;  5DPX A;  3H3E A;  3KNR A;  4C1F A;  4UWR B;  3RKJ A;  2NYP A;  5ACW A;  4XWT A;  3IE2 A;  2DOO A;  2XF4 A;  5AHO A;  5LS3 A;  4JO0 A;  3VPE A;  3X2X A;  3AF5 A;  2P97 A;  1BC2 A;  3T3N A;  1ZKP A;  3LVZ A;  4AX1 B;  2OHJ A;  4NQ4 A;  3DHC A;  3SRX A;  3I0V A;  3ZR9 A;  4UBQ A;  3F9O A;  5EVK A;  3X30 A;  4TYT A;  1K07 A;  4RAW A;  4NQ2 A;  3IEL A;  5EV6 A;  2BFZ B;  5FQB A;  2WYL A;  4FR7 A;  1KR3 A;  3QH8 A;  2YNW A;  2I7V A;  3I13 A;  2VW8 A;  2GFJ A;  2FM6 A;  2YNT B;  4UWS B;  4RM5 A;  1DD6 A;  2BC2 A;  4U4L A;  1Y44 A;  3ZWF A;  5HIS A;  2P4Z A;  2FU7 A;  4WD6 A;  2NZE A;  2P1E A;  4RAM A;  5HH4 A;  4UAM A;  1QH5 A;  5LSC A;  2YZ3 A;  4C09 A;  4V0H A;  3ADR A;  2BFK A;  3IOG A;  4KEP A;  5ACX A;  2BG6 A;  2GCU A;  4YSK A;  3PG4 A;  3BC2 A;  4XUK A;  5K4M A;  4UWP B;  2FHX A;  2OHH A;  1BVT A;  4Z6X A;  2Q0I A;  5HH5 A;  4P62 A;  1A8T A;  2QJS A;  4UA4 A;  4EYF A;  1QH3 A;  4GYU A;  4CHL A;  4ZO2 A;  3BK2 A;  2WHG A;  3R2U A;  1WUO A;  3PY5 A;  3FAI A;  1WW1 A;  5EH9 A;  4D1W A;  3ESH A;  2NXA A;  5ACR A;  2FU8 A;  3FCZ A;  4C1C A;  1L9Y A;  3G1P A;  1KO3 A;  4C1G A;  1ZTC A;  2ZZI A;  3PY6 A;  2YCB A;  3WXC A;  1P9E A;  5AXO A;  1VJN A;  2WRS A;  4TZF A;  5LMC A;  2ZNB A;  4TZ9 A;  1VME A;  2NZF A;  4ZNB A;  4GCW A;  4EXY A;  2AIO A;  4J5F A;  4XWW A;  3JXP A;  4RL2 A;  4ZO3 A;  5KIL A;  2Y8A A;  2QDS A;  3DHB A;  4B87 A;  5ACT A;  5A5Z A;  2BFZ A;  4H0D A;  4HL2 A;  1YCF A;  5ACQ A;  5K4K A;  2YNU A;  2R2D A;  4D02 A;  1JJE A;  3S0Z A;  5IQK A;  1WUP A;  2BG2 A;  2Y8B A;  1KO2 A;  3I15 A;  2BG8 B;  2OHI A;  5KIK A;  1YCG A;  4EXS A;  2E7Y A;  5K4N A;  3SBL A;  5HIP A;  3DHA A;  3ZQ4 A;  5A0V A;  2Q9U A;  4D1V A;  1YCH A;  5B1U A;  4EY2 A;  4EFZ A;  2I7X A;  2YNT A;  1XM8 A;  1DDK A;  2GMN A;  2ZO4 A;  3VQZ A;  4LE6 A;  4KEQ A;  1SML A;  4RBS A;  4RL0 A;  4O98 A;  4PVT A;  2I7T A;  4AD9 A;  2BR6 A;  3X2Z A;  5LLD A;  1BMC A;  4BZ3 A;  5LM6 A;  4Z5Y A;  5EW0 A;  4DIK A;  2FU6 A;  2DKF A;  2M5D A;  2H6A A;  5AHR A;  5AYA A;  4AWZ A;  5A87 A;  3SPU A;  3ZNB A;  4AWY B;  4F6H A;  3IE0 A;  5A0T A;  4C1E A;  5EVD A;  4HKY A;  2YNV A;  1E5D A;  4EYB A;  1M2X A;  5HIQ A;  4J5H A;  5LCA A;  2BFL A;  2A7M A;  1JJT A;  1X8G A;  3SW3 A;  1WRA A;  5K0W A;  5LE1 A;  1X8H A;  2FU9 A;  3SFP A;  5B15 A;  3P2U A;  3Q6V A;  4YSB A;  2QED A;  2BTN A;  4ZEJ A;  3AJ3 A;  3I11 A;  3KNS A;  2WYM A;  4Z60 A;  5EWA A;  2XR1 A;  4FEK A;  2BGA A;  3RPC A;  4D1T A;  2BG8 A;  5ACU A;  2Q0J A;  4NQ6 A;  3RKK A;  3MD7 A;  1ZNB A;  3SD9 A;  2YNV B;  2BIB A;  4TYF A;  3IE1 A;  2GKL A;  3X2Y A;  4GYQ A;  5FQA A;  2Y87 A;  3T9M A;  3IDZ A;  4TZB A;  2HB9 A;  4PVO A;  5ACP A;  2WYM C;  2GFK A;  3DH8 A;  2ZWR A;  4DIL A;  3TP9 A;  4Z5Z A;  4AX0 B;  5HIO A;  3I14 A;  2BG7 A;  1VGN A;  2FK6 A;  2FHX B;  2UYX A;  1JT1 A;  5EVB A;  3A4Y A;  5ACS A;  4F6Z A;  1HLK A;  1MQO A;  3BK1 A;  3IOF A;  4D1U A;  3KL7 A;  5ACV A;  4Z67 A;  3L6N A;  4HL1 A; 
#chains in the Genus database with same CATH topology
 2AZ4 A;  4C1D A;  4BP0 A;  5FQC A;  4Z7R A;  3T3O A;  5B3R A;  1X8I A;  5EHT A;  3IEM A;  4YSL A;  5EV8 A;  4C1H A;  5AXR A;  2M5C A;  4UWO B;  5AEB A;  4NQ5 A;  3AF6 A;  3IEK A;  4FSB A;  2QIN A;  5LCH A;  2P18 A;  4EYL A;  5HH6 A;  5LCF A;  3BV6 A;  4TZE A;  1DXK A;  1XTO A;  2QDT A;  2BMI A;  2Q42 A;  1A7T A;  2CBN A;  5DPX A;  3H3E A;  3KNR A;  4C1F A;  4UWR B;  4AV7 A;  3RKJ A;  2NYP A;  5ACW A;  4XWT A;  3IE2 A;  2DOO A;  2XF4 A;  5AHO A;  5LS3 A;  4JO0 A;  3VPE A;  3X2X A;  3AF5 A;  2P97 A;  1BC2 A;  3T3N A;  1ZKP A;  3LVZ A;  4AX1 B;  2OHJ A;  4NQ4 A;  3DHC A;  3SRX A;  3I0V A;  3ZR9 A;  4UBQ A;  3F9O A;  5EVK A;  3X30 A;  4TYT A;  1K07 A;  4RAW A;  4NQ2 A;  3IEL A;  5EV6 A;  2BFZ B;  5FQB A;  2WYL A;  4FR7 A;  1KR3 A;  3QH8 A;  2YNW A;  2I7V A;  3I13 A;  2VW8 A;  2GFJ A;  2FM6 A;  2YNT B;  4UWS B;  4RM5 A;  4NUR A;  1DD6 A;  2BC2 A;  4U4L A;  4AXH A;  1Y44 A;  3ZWF A;  2P4Z A;  5HIS A;  2FU7 A;  4WD6 A;  2NZE A;  2P1E A;  4RAM A;  5HH4 A;  4UAM A;  1QH5 A;  5LSC A;  5A23 A;  2YZ3 A;  5AJL A;  4C09 A;  4V0H A;  3ADR A;  2BFK A;  3IOG A;  4KEP A;  5ACX A;  2BG6 A;  2GCU A;  4YSK A;  3PG4 A;  3BC2 A;  4XUK A;  5K4M A;  4UWP B;  2FHX A;  2OHH A;  1BVT A;  4Z6X A;  2Q0I A;  5HH5 A;  4P62 A;  1A8T A;  2CFU A;  2QJS A;  4UA4 A;  4EYF A;  1QH3 A;  4GYU A;  4CHL A;  4ZO2 A;  3BK2 A;  2WHG A;  3R2U A;  1WUO A;  3PY5 A;  3FAI A;  1WW1 A;  5EH9 A;  4D1W A;  3ESH A;  2NXA A;  5ACR A;  2FU8 A;  3FCZ A;  2CG3 A;  4C1C A;  1L9Y A;  3G1P A;  1KO3 A;  4C1G A;  1ZTC A;  2ZZI A;  3PY6 A;  2YCB A;  3WXC A;  1P9E A;  5AXO A;  1VJN A;  2WRS A;  4TZF A;  5LMC A;  2ZNB A;  4TZ9 A;  1VME A;  2NZF A;  4ZNB A;  4GCW A;  4EXY A;  2AIO A;  4J5F A;  4XWW A;  3JXP A;  4RL2 A;  4ZO3 A;  5KIL A;  2Y8A A;  2QDS A;  3DHB A;  2YHE A;  4B87 A;  5ACT A;  5A5Z A;  2BFZ A;  4H0D A;  4HL2 A;  1YCF A;  5ACQ A;  5K4K A;  2YNU A;  2R2D A;  4D02 A;  1JJE A;  3S0Z A;  5IQK A;  1WUP A;  2BG2 A;  2Y8B A;  1KO2 A;  3I15 A;  2BG8 B;  2OHI A;  5KIK A;  1YCG A;  4EXS A;  2E7Y A;  5K4N A;  3SBL A;  5HIP A;  3DHA A;  3ZQ4 A;  5A0V A;  2Q9U A;  4D1V A;  1YCH A;  5B1U A;  4EY2 A;  4EFZ A;  2I7X A;  2YNT A;  1XM8 A;  1DDK A;  2GMN A;  2ZO4 A;  3VQZ A;  4LE6 A;  4KEQ A;  1SML A;  4RBS A;  4RL0 A;  4O98 A;  4PVT A;  2I7T A;  4AD9 A;  2BR6 A;  3X2Z A;  5LLD A;  1BMC A;  4BZ3 A;  5LM6 A;  4Z5Y A;  5EW0 A;  4DIK A;  2FU6 A;  2DKF A;  2M5D A;  2H6A A;  5AHR A;  5AYA A;  5AIJ A;  4AWZ A;  5A87 A;  3SPU A;  3ZNB A;  4PDX A;  4AWY B;  4F6H A;  3IE0 A;  5A0T A;  4C1E A;  5EVD A;  4HKY A;  2YNV A;  1E5D A;  4EYB A;  1M2X A;  5HIQ A;  4J5H A;  5LCA A;  2BFL A;  2A7M A;  1JJT A;  1X8G A;  3SW3 A;  1WRA A;  5K0W A;  5LE1 A;  1X8H A;  2FU9 A;  3SFP A;  5B15 A;  3P2U A;  3Q6V A;  4YSB A;  2QED A;  2BTN A;  4ZEJ A;  3AJ3 A;  3I11 A;  3KNS A;  2WYM A;  4Z60 A;  5EWA A;  2XR1 A;  4FEK A;  2BGA A;  3RPC A;  4D1T A;  2BG8 A;  5ACU A;  2Q0J A;  4NQ6 A;  3RKK A;  3MD7 A;  1ZNB A;  3SD9 A;  2YNV B;  2BIB A;  4TYF A;  3IE1 A;  2GKL A;  3X2Y A;  4GYQ A;  5FQA A;  2Y87 A;  3T9M A;  3IDZ A;  4TZB A;  2HB9 A;  4PVO A;  5ACP A;  2WYM C;  2GFK A;  3DH8 A;  2ZWR A;  4DIL A;  2CFZ A;  3TP9 A;  4Z5Z A;  4AX0 B;  5HIO A;  3I14 A;  2BG7 A;  1VGN A;  2FK6 A;  2FHX B;  2UYX A;  1JT1 A;  5EVB A;  3A4Y A;  5ACS A;  4F6Z A;  1HLK A;  1MQO A;  3BK1 A;  3IOF A;  4D1U A;  3KL7 A;  2CG2 A;  5ACV A;  4Z67 A;  3L6N A;  4HL1 A; 
#chains in the Genus database with same CATH homology
 2AZ4 A;  4C1D A;  4BP0 A;  5FQC A;  4Z7R A;  3T3O A;  5B3R A;  1X8I A;  5EHT A;  3IEM A;  4YSL A;  5EV8 A;  4C1H A;  5AXR A;  2M5C A;  4UWO B;  5AEB A;  4NQ5 A;  3AF6 A;  3IEK A;  4FSB A;  2QIN A;  5LCH A;  2P18 A;  4EYL A;  5HH6 A;  5LCF A;  3BV6 A;  4TZE A;  1DXK A;  1XTO A;  2QDT A;  2BMI A;  2Q42 A;  1A7T A;  2CBN A;  5DPX A;  3H3E A;  3KNR A;  4C1F A;  4UWR B;  3RKJ A;  2NYP A;  5ACW A;  4XWT A;  3IE2 A;  2DOO A;  2XF4 A;  5AHO A;  5LS3 A;  4JO0 A;  3VPE A;  3X2X A;  3AF5 A;  2P97 A;  1BC2 A;  3T3N A;  1ZKP A;  3LVZ A;  4AX1 B;  2OHJ A;  4NQ4 A;  3DHC A;  3SRX A;  3I0V A;  3ZR9 A;  4UBQ A;  3F9O A;  5EVK A;  3X30 A;  4TYT A;  1K07 A;  4RAW A;  4NQ2 A;  3IEL A;  5EV6 A;  2BFZ B;  5FQB A;  2WYL A;  4FR7 A;  1KR3 A;  3QH8 A;  2YNW A;  2I7V A;  3I13 A;  2VW8 A;  2GFJ A;  2FM6 A;  2YNT B;  4UWS B;  4RM5 A;  1DD6 A;  2BC2 A;  4U4L A;  1Y44 A;  3ZWF A;  5HIS A;  2P4Z A;  2FU7 A;  4WD6 A;  2NZE A;  2P1E A;  4RAM A;  5HH4 A;  4UAM A;  1QH5 A;  5LSC A;  2YZ3 A;  4C09 A;  4V0H A;  3ADR A;  2BFK A;  3IOG A;  4KEP A;  5ACX A;  2BG6 A;  2GCU A;  4YSK A;  3PG4 A;  3BC2 A;  4XUK A;  5K4M A;  4UWP B;  2FHX A;  2OHH A;  1BVT A;  4Z6X A;  2Q0I A;  5HH5 A;  4P62 A;  1A8T A;  2QJS A;  4UA4 A;  4EYF A;  1QH3 A;  4GYU A;  4CHL A;  4ZO2 A;  3BK2 A;  2WHG A;  3R2U A;  1WUO A;  3PY5 A;  3FAI A;  1WW1 A;  5EH9 A;  4D1W A;  3ESH A;  2NXA A;  5ACR A;  2FU8 A;  3FCZ A;  4C1C A;  1L9Y A;  3G1P A;  1KO3 A;  4C1G A;  1ZTC A;  2ZZI A;  3PY6 A;  2YCB A;  3WXC A;  1P9E A;  5AXO A;  1VJN A;  2WRS A;  4TZF A;  5LMC A;  2ZNB A;  4TZ9 A;  1VME A;  2NZF A;  4ZNB A;  4GCW A;  4EXY A;  2AIO A;  4J5F A;  4XWW A;  3JXP A;  4RL2 A;  4ZO3 A;  5KIL A;  2Y8A A;  2QDS A;  3DHB A;  4B87 A;  5ACT A;  5A5Z A;  2BFZ A;  4H0D A;  4HL2 A;  1YCF A;  5ACQ A;  5K4K A;  2YNU A;  2R2D A;  4D02 A;  1JJE A;  3S0Z A;  5IQK A;  1WUP A;  2BG2 A;  2Y8B A;  1KO2 A;  3I15 A;  2BG8 B;  2OHI A;  5KIK A;  1YCG A;  4EXS A;  2E7Y A;  5K4N A;  3SBL A;  5HIP A;  3DHA A;  3ZQ4 A;  5A0V A;  2Q9U A;  4D1V A;  1YCH A;  5B1U A;  4EY2 A;  4EFZ A;  2I7X A;  2YNT A;  1XM8 A;  1DDK A;  2GMN A;  2ZO4 A;  3VQZ A;  4LE6 A;  4KEQ A;  1SML A;  4RBS A;  4RL0 A;  4O98 A;  4PVT A;  2I7T A;  4AD9 A;  2BR6 A;  3X2Z A;  5LLD A;  1BMC A;  4BZ3 A;  5LM6 A;  4Z5Y A;  5EW0 A;  4DIK A;  2FU6 A;  2DKF A;  2M5D A;  2H6A A;  5AHR A;  5AYA A;  4AWZ A;  5A87 A;  3SPU A;  3ZNB A;  4AWY B;  4F6H A;  3IE0 A;  5A0T A;  4C1E A;  5EVD A;  4HKY A;  2YNV A;  1E5D A;  4EYB A;  1M2X A;  5HIQ A;  4J5H A;  5LCA A;  2BFL A;  2A7M A;  1JJT A;  1X8G A;  3SW3 A;  1WRA A;  5K0W A;  5LE1 A;  1X8H A;  2FU9 A;  3SFP A;  5B15 A;  3P2U A;  3Q6V A;  4YSB A;  2QED A;  2BTN A;  4ZEJ A;  3AJ3 A;  3I11 A;  3KNS A;  2WYM A;  4Z60 A;  5EWA A;  2XR1 A;  4FEK A;  2BGA A;  3RPC A;  4D1T A;  2BG8 A;  5ACU A;  2Q0J A;  4NQ6 A;  3RKK A;  3MD7 A;  1ZNB A;  3SD9 A;  2YNV B;  2BIB A;  4TYF A;  3IE1 A;  2GKL A;  3X2Y A;  4GYQ A;  5FQA A;  2Y87 A;  3T9M A;  3IDZ A;  4TZB A;  2HB9 A;  4PVO A;  5ACP A;  2WYM C;  2GFK A;  3DH8 A;  2ZWR A;  4DIL A;  3TP9 A;  4Z5Z A;  4AX0 B;  5HIO A;  3I14 A;  2BG7 A;  1VGN A;  2FK6 A;  2FHX B;  2UYX A;  1JT1 A;  5EVB A;  3A4Y A;  5ACS A;  4F6Z A;  1HLK A;  1MQO A;  3BK1 A;  3IOF A;  4D1U A;  3KL7 A;  5ACV A;  4Z67 A;  3L6N A;  4HL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...