3VPEA

Crystal structure of metallo-beta-lactamase smb-1
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
259
structure length
259
Chain Sequence
RDWSSPQQPFTIYGNTHYVGTGGISAVLLSSPQGHILVDGTTEKGAQVVAANIRAMGFKLSDVKYILSTHSHEDHAGGISAMQKLTGATVLAGAANVDTLRTGVSPKSDPQFGSLSNFPGSAKVRAVADGELVKLGPLAVKAHATPGHTEGGITWTWQSCEQGKCKDVVFADSLTAVSADSYRFSDHPEVVASLRGSFEAVEKLSCDIAIAAHPEVNDMWTRQQRAAKEGNSAYVDNGACRAIAAAGRKRLETRLASEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Subclass B3 Metallo-beta-Lactamase SMB-1 and the Mode of Inhibition by the Common Metallo- -Lactamase Inhibitor Mercaptoacetate
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Hydrolase
molecule keywords Metallo-beta-lactamase
total genus 85
structure length 259
sequence length 259
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3vpeA00
4Z60A 2NZFA 3I14A 4AWZA 4EYLA 3TP9A 4PVTA 3I15A 4LE6A 2NYPA 2YNTB 5ACPA 4FEKA 1L9YA 4RL2A 3H3EA 2GCUA 3JXPA 2E7YA 3AJ3A 2QEDA 2GKLA 3LVZA 1X8IA 2BTNA 3IOGA 2AZ4A 3IOFA 3IDZA 1YCGA 5KILA 4D02A 4Z5ZA 3F9OA 4WD6A 4YSKA 2DOOA 4V0HA 2GFJA 5DPXA 2I7XA 4DILA 3R2UA 5LCFA 2FU7A 4AX0B 3SW3A 1JJTA 3VPEA 5EHTA 5LCHA 3RPCA 2A7MA 5AXRA 5HIQA 4D1WA 1P9EA 2YZ3A 4XWWA 5EWAA 1K07A 5A5ZA 2BG7A 2BR6A 2YNVA 5KIKA 3PY6A 1A8TA 4C1EA 4H0DA 1M2XA 4BZ3A 2YNTA 2DKFA 4RAWA 1X8HA 3SD9A 1DD6A 4TZBA 1DDKA 1Y44A 4ZO3A 4ZO2A 2YNUA 4GYUA 2P4ZA 5B3RA 3IEKA 1KO2A 1WW1A 2BIBA 2M5DA 2Q42A 2NXAA 3SRXA 4XUKA 4J5HA 3I11A 3X30A 4EXSA 3AF5A 4TZFA 2P97A 2BFZB 2FU9A 4Z67A 2AIOA 5AEBA 3KNRA 3RKJA 4YSBA 2BG6A 4RM5A 4HL1A 3BV6A 5FQBA 4C1HA 3SPUA 4TYFA 4TYTA 4ZNBA 3PG4A 5K4MA 3SFPA 3DHAA 4C1DA 3DHBA 1ZKPA 4Z7RA 4UBQA 2FM6A 4U4LA 3I0VA 2NZEA 4C1FA 2XR1A 2H6AA 2Y8AA 3I13A 2OHHA 1SMLA 5EVDA 3S0ZA 3IE2A 3ZR9A 2UYXA 2WRSA 2BMIA 4AX1B 2QINA 5EV6A 4BP0A 1QH5A 5ACVA 1YCHA 3KNSA 3QH8A 5LM6A 4F6HA 3DH8A 5IQKA 1VMEA 1VGNA 3SBLA 4J5FA 2Q0IA 2BFLA 3L6NA 5AYAA 2I7VA 3RKKA 3IE0A 4PVOA 3BK1A 5HH6A 4RAMA 5FQCA 2FHXB 5FQAA 2ZZIA 4Z6XA 4P62A 4AWYB 4KEPA 4ZEJA 1A7TA 3X2YA 4D1UA 5ACXA 5ACRA 1BMCA 4Z5YA 2OHJA 5LMCA 5K0WA 2WYMC 2R2DA 5LSCA 1JJEA 4KEQA 2XF4A 2YNWA 2QDTA 4FSBA 1WRAA 2BFZA 4RBSA 2QDSA 4NQ4A 4UAMA 4XWTA 5HIOA 3ZWFA 3Q6VA 3ZNBA 5ACQA 5EW0A 1MQOA 3G1PA 4O98A 2M5CA 4NQ6A 4EXYA 1E5DA 2QJSA 3T9MA 5K4KA 2ZWRA 2WYMA 2Y87A 1XTOA 4B87A 2BG8B 1X8GA 2BG8A 4GYQA 3AF6A 5EVBA 1VJNA 1QH3A 2FU6A 3P2UA 3IEMA 2YNVB 5LE1A 5EH9A 2P18A 5LCAA 3MD7A 2CBNA 3BK2A 5LS3A 5HH5A 2VW8A 4CHLA 4C1CA 3DHCA 5ACTA 2OHIA 5ACSA 4C09A 5ACUA 4D1VA 4TZEA 5K4NA 2P1EA 4UWOB 3BC2A 2BG2A 1ZNBA 2I7TA 2FK6A 4D1TA 4AD9A 3IELA 2ZNBA 4NQ5A 5AHOA 4F6ZA 5AHRA 3A4YA 4DIKA 1YCFA 4FR7A 4EYFA 2Q0JA 3ADRA 1DXKA 4JO0A 3FAIA 3IE1A 4EY2A 5HIPA 4EYBA 5A87A 4HL2A 2ZO4A 4UWSB 5EVKA 1KR3A 5ACWA 1KO3A 5LLDA 2Y8BA 2BFKA 2GFKA 3ESHA 3T3NA 2Q9UA 1WUPA 2GMNA 4C1GA 5A0VA 2FHXA 1BC2A 1HLKA 4NQ2A 5HISA 4GCWA 2HB9A 3VQZA 4HKYA 3WXCA 5B15A 3X2XA 2BGAA 2FU8A 4YSLA 1ZTCA 3ZQ4A 5HH4A 2WHGA 2YCBA 4RL0A 2WYLA 3KL7A 1JT1A 1BVTA 3PY5A 1XM8A 2BC2A 3FCZA 4TZ9A 3T3OA 4EFZA 4UWPB 5AXOA 5B1UA 4UWRB 4UA4A 5A0TA 3X2ZA 1WUOA 5EV8A
chains in the Genus database with same CATH superfamily
4Z60A 2NZFA 3I14A 4AWZA 4EYLA 3TP9A 4PVTA 2YHEA 3I15A 4LE6A 2NYPA 2YNTB 5ACPA 4FEKA 1L9YA 4RL2A 3H3EA 2GCUA 3JXPA 2E7YA 3AJ3A 2QEDA 2GKLA 3LVZA 1X8IA 2BTNA 3IOGA 2AZ4A 3IOFA 3IDZA 1YCGA 5KILA 5AIJA 4D02A 4Z5ZA 3F9OA 4WD6A 4YSKA 2DOOA 4V0HA 2GFJA 5DPXA 2I7XA 4DILA 3R2UA 5LCFA 2FU7A 4AX0B 3SW3A 1JJTA 2CFUA 3VPEA 5EHTA 5LCHA 3RPCA 2A7MA 5AXRA 5HIQA 4D1WA 1P9EA 2YZ3A 4XWWA 5EWAA 1K07A 5A5ZA 2BG7A 2BR6A 2YNVA 5KIKA 3PY6A 1A8TA 4C1EA 4H0DA 1M2XA 4BZ3A 2YNTA 2DKFA 4RAWA 1X8HA 3SD9A 1DD6A 4TZBA 1DDKA 1Y44A 4ZO3A 4ZO2A 2YNUA 4GYUA 2P4ZA 5B3RA 3IEKA 1KO2A 1WW1A 2BIBA 2M5DA 2Q42A 2NXAA 3SRXA 4XUKA 4J5HA 3I11A 3X30A 4EXSA 3AF5A 4TZFA 2P97A 2BFZB 2FU9A 4Z67A 2AIOA 4NURA 5AEBA 3KNRA 3RKJA 4YSBA 2BG6A 4RM5A 4HL1A 3BV6A 5FQBA 4C1HA 3SPUA 4AV7A 4TYFA 4TYTA 4ZNBA 3PG4A 5K4MA 3SFPA 3DHAA 4C1DA 3DHBA 1ZKPA 4Z7RA 4UBQA 2FM6A 4U4LA 3I0VA 2NZEA 4C1FA 2XR1A 2H6AA 2Y8AA 3I13A 2OHHA 1SMLA 5EVDA 3S0ZA 3IE2A 3ZR9A 2UYXA 2WRSA 2BMIA 4AX1B 2QINA 5EV6A 4BP0A 1QH5A 5ACVA 1YCHA 3KNSA 3QH8A 5LM6A 4F6HA 3DH8A 5IQKA 1VMEA 1VGNA 3SBLA 4J5FA 2Q0IA 2BFLA 3L6NA 5AYAA 2I7VA 3RKKA 3IE0A 4PVOA 3BK1A 5HH6A 4RAMA 5FQCA 2FHXB 5FQAA 4PDXA 2ZZIA 4Z6XA 4P62A 4AWYB 4KEPA 4ZEJA 1A7TA 3X2YA 4D1UA 5ACXA 5ACRA 1BMCA 4Z5YA 2OHJA 5LMCA 5K0WA 2WYMC 2R2DA 5LSCA 1JJEA 4KEQA 2XF4A 2YNWA 2QDTA 4FSBA 1WRAA 2BFZA 4RBSA 2QDSA 3ZWFA 4NQ4A 4UAMA 2CFZA 4XWTA 5HIOA 3Q6VA 3ZNBA 5ACQA 5EW0A 1MQOA 3G1PA 4O98A 2M5CA 4NQ6A 4EXYA 1E5DA 2QJSA 3T9MA 5K4KA 2ZWRA 2WYMA 2Y87A 1XTOA 4B87A 2BG8B 1X8GA 2BG8A 4GYQA 3AF6A 5EVBA 5AJLA 1VJNA 1QH3A 2FU6A 3P2UA 3IEMA 2YNVB 5LE1A 5EH9A 2P18A 5LCAA 3MD7A 2CBNA 3BK2A 5LS3A 5HH5A 4AXHA 2VW8A 4CHLA 4C1CA 3DHCA 5ACTA 2OHIA 5ACSA 4C09A 5ACUA 4D1VA 4TZEA 5K4NA 2P1EA 4UWOB 3BC2A 2BG2A 1ZNBA 2I7TA 2FK6A 2CG3A 4D1TA 4AD9A 2CG2A 3IELA 2ZNBA 4NQ5A 5AHOA 4F6ZA 5AHRA 3A4YA 4DIKA 1YCFA 4FR7A 4EYFA 2Q0JA 3ADRA 1DXKA 4JO0A 3FAIA 3IE1A 4EY2A 5HIPA 4EYBA 5A87A 4HL2A 2ZO4A 4UWSB 5EVKA 1KR3A 5ACWA 1KO3A 5LLDA 2Y8BA 2BFKA 2GFKA 3ESHA 3T3NA 2Q9UA 1WUPA 2GMNA 4C1GA 5A23A 5A0VA 2FHXA 1BC2A 1HLKA 4NQ2A 5HISA 4GCWA 2HB9A 3VQZA 4HKYA 3WXCA 5B15A 3X2XA 2BGAA 2FU8A 4YSLA 1ZTCA 3ZQ4A 5HH4A 2WHGA 2YCBA 4RL0A 2WYLA 3KL7A 1JT1A 1BVTA 3PY5A 1XM8A 2BC2A 3FCZA 4TZ9A 3T3OA 4EFZA 4UWPB 5AXOA 5B1UA 4UWRB 4UA4A 5A0TA 3X2ZA 1WUOA 5EV8A
chains in the Genus database with same CATH topology
4Z60A 2NZFA 3I14A 4AWZA 4EYLA 3TP9A 4PVTA 3I15A 4LE6A 2NYPA 2YNTB 5ACPA 4FEKA 1L9YA 4RL2A 3H3EA 2GCUA 3JXPA 2E7YA 3AJ3A 2QEDA 2GKLA 3LVZA 1X8IA 2BTNA 3IOGA 2AZ4A 3IOFA 3IDZA 1YCGA 5KILA 4D02A 4Z5ZA 3F9OA 4WD6A 4YSKA 2DOOA 4V0HA 2GFJA 5DPXA 2I7XA 4DILA 3R2UA 5LCFA 2FU7A 4AX0B 3SW3A 1JJTA 3VPEA 5EHTA 5LCHA 3RPCA 2A7MA 5AXRA 5HIQA 4D1WA 1P9EA 2YZ3A 4XWWA 5EWAA 1K07A 5A5ZA 2BG7A 2BR6A 2YNVA 5KIKA 3PY6A 1A8TA 4C1EA 4H0DA 1M2XA 4BZ3A 2YNTA 2DKFA 4RAWA 1X8HA 3SD9A 1DD6A 4TZBA 1DDKA 1Y44A 4ZO3A 4ZO2A 2YNUA 4GYUA 2P4ZA 5B3RA 3IEKA 1KO2A 1WW1A 2BIBA 2M5DA 2Q42A 2NXAA 3SRXA 4XUKA 4J5HA 3I11A 3X30A 4EXSA 3AF5A 4TZFA 2P97A 2BFZB 2FU9A 4Z67A 2AIOA 5AEBA 3KNRA 3RKJA 4YSBA 2BG6A 4RM5A 4HL1A 3BV6A 5FQBA 4C1HA 3SPUA 4TYFA 4TYTA 4ZNBA 3PG4A 5K4MA 3SFPA 3DHAA 4C1DA 3DHBA 1ZKPA 4Z7RA 4UBQA 2FM6A 4U4LA 3I0VA 2NZEA 4C1FA 2XR1A 2H6AA 2Y8AA 3I13A 2OHHA 1SMLA 5EVDA 3S0ZA 3IE2A 3ZR9A 2UYXA 2WRSA 2BMIA 4AX1B 2QINA 5EV6A 4BP0A 1QH5A 5ACVA 1YCHA 3KNSA 3QH8A 5LM6A 4F6HA 3DH8A 5IQKA 1VMEA 1VGNA 3SBLA 4J5FA 2Q0IA 2BFLA 3L6NA 5AYAA 2I7VA 3RKKA 3IE0A 4PVOA 3BK1A 5HH6A 4RAMA 5FQCA 2FHXB 5FQAA 2ZZIA 4Z6XA 4P62A 4AWYB 4KEPA 4ZEJA 1A7TA 3X2YA 4D1UA 5ACXA 5ACRA 1BMCA 4Z5YA 2OHJA 5LMCA 5K0WA 2WYMC 2R2DA 5LSCA 1JJEA 4KEQA 2XF4A 2YNWA 2QDTA 4FSBA 1WRAA 2BFZA 4RBSA 2QDSA 4NQ4A 4UAMA 4XWTA 5HIOA 3ZWFA 3Q6VA 3ZNBA 5ACQA 5EW0A 1MQOA 3G1PA 4O98A 2M5CA 4NQ6A 4EXYA 1E5DA 2QJSA 3T9MA 5K4KA 2ZWRA 2WYMA 2Y87A 1XTOA 4B87A 2BG8B 1X8GA 2BG8A 4GYQA 3AF6A 5EVBA 1VJNA 1QH3A 2FU6A 3P2UA 3IEMA 2YNVB 5LE1A 5EH9A 2P18A 5LCAA 3MD7A 2CBNA 3BK2A 5LS3A 5HH5A 2VW8A 4CHLA 4C1CA 3DHCA 5ACTA 2OHIA 5ACSA 4C09A 5ACUA 4D1VA 4TZEA 5K4NA 2P1EA 4UWOB 3BC2A 2BG2A 1ZNBA 2I7TA 2FK6A 4D1TA 4AD9A 3IELA 2ZNBA 4NQ5A 5AHOA 4F6ZA 5AHRA 3A4YA 4DIKA 1YCFA 4FR7A 4EYFA 2Q0JA 3ADRA 1DXKA 4JO0A 3FAIA 3IE1A 4EY2A 5HIPA 4EYBA 5A87A 4HL2A 2ZO4A 4UWSB 5EVKA 1KR3A 5ACWA 1KO3A 5LLDA 2Y8BA 2BFKA 2GFKA 3ESHA 3T3NA 2Q9UA 1WUPA 2GMNA 4C1GA 5A0VA 2FHXA 1BC2A 1HLKA 4NQ2A 5HISA 4GCWA 2HB9A 3VQZA 4HKYA 3WXCA 5B15A 3X2XA 2BGAA 2FU8A 4YSLA 1ZTCA 3ZQ4A 5HH4A 2WHGA 2YCBA 4RL0A 2WYLA 3KL7A 1JT1A 1BVTA 3PY5A 1XM8A 2BC2A 3FCZA 4TZ9A 3T3OA 4EFZA 4UWPB 5AXOA 5B1UA 4UWRB 4UA4A 5A0TA 3X2ZA 1WUOA 5EV8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z60 A;  2NZF A;  3I14 A;  4AWZ A;  4EYL A;  3TP9 A;  4PVT A;  3I15 A;  4LE6 A;  2NYP A;  2YNT B;  5ACP A;  4FEK A;  1L9Y A;  4RL2 A;  3H3E A;  2GCU A;  3JXP A;  2E7Y A;  3AJ3 A;  2QED A;  2GKL A;  3LVZ A;  1X8I A;  2BTN A;  3IOG A;  2AZ4 A;  3IOF A;  3IDZ A;  1YCG A;  5KIL A;  4D02 A;  4Z5Z A;  3F9O A;  4WD6 A;  4YSK A;  2DOO A;  4V0H A;  2GFJ A;  5DPX A;  2I7X A;  4DIL A;  3R2U A;  5LCF A;  2FU7 A;  4AX0 B;  3SW3 A;  1JJT A;  3VPE A;  5EHT A;  5LCH A;  3RPC A;  2A7M A;  5AXR A;  5HIQ A;  4D1W A;  1P9E A;  2YZ3 A;  4XWW A;  5EWA A;  1K07 A;  5A5Z A;  2BG7 A;  2BR6 A;  2YNV A;  5KIK A;  3PY6 A;  1A8T A;  4C1E A;  4H0D A;  1M2X A;  4BZ3 A;  2YNT A;  2DKF A;  4RAW A;  1X8H A;  3SD9 A;  1DD6 A;  4TZB A;  1DDK A;  1Y44 A;  4ZO3 A;  4ZO2 A;  2YNU A;  4GYU A;  2P4Z A;  5B3R A;  3IEK A;  1KO2 A;  1WW1 A;  2BIB A;  2M5D A;  2Q42 A;  2NXA A;  3SRX A;  4XUK A;  4J5H A;  3I11 A;  3X30 A;  4EXS A;  3AF5 A;  4TZF A;  2P97 A;  2BFZ B;  2FU9 A;  4Z67 A;  2AIO A;  5AEB A;  3KNR A;  3RKJ A;  4YSB A;  2BG6 A;  4RM5 A;  4HL1 A;  3BV6 A;  5FQB A;  4C1H A;  3SPU A;  4TYF A;  4TYT A;  4ZNB A;  3PG4 A;  5K4M A;  3SFP A;  3DHA A;  4C1D A;  3DHB A;  1ZKP A;  4Z7R A;  4UBQ A;  2FM6 A;  4U4L A;  3I0V A;  2NZE A;  4C1F A;  2XR1 A;  2H6A A;  2Y8A A;  3I13 A;  2OHH A;  1SML A;  5EVD A;  3S0Z A;  3IE2 A;  3ZR9 A;  2UYX A;  2WRS A;  2BMI A;  4AX1 B;  2QIN A;  5EV6 A;  4BP0 A;  1QH5 A;  5ACV A;  1YCH A;  3KNS A;  3QH8 A;  5LM6 A;  4F6H A;  3DH8 A;  5IQK A;  1VME A;  1VGN A;  3SBL A;  4J5F A;  2Q0I A;  2BFL A;  3L6N A;  5AYA A;  2I7V A;  3RKK A;  3IE0 A;  4PVO A;  3BK1 A;  5HH6 A;  4RAM A;  5FQC A;  2FHX B;  5FQA A;  2ZZI A;  4Z6X A;  4P62 A;  4AWY B;  4KEP A;  4ZEJ A;  1A7T A;  3X2Y A;  4D1U A;  5ACX A;  5ACR A;  1BMC A;  4Z5Y A;  2OHJ A;  5LMC A;  5K0W A;  2WYM C;  2R2D A;  5LSC A;  1JJE A;  4KEQ A;  2XF4 A;  2YNW A;  2QDT A;  4FSB A;  1WRA A;  2BFZ A;  4RBS A;  2QDS A;  4NQ4 A;  4UAM A;  4XWT A;  5HIO A;  3ZWF A;  3Q6V A;  3ZNB A;  5ACQ A;  5EW0 A;  1MQO A;  3G1P A;  4O98 A;  2M5C A;  4NQ6 A;  4EXY A;  1E5D A;  2QJS A;  3T9M A;  5K4K A;  2ZWR A;  2WYM A;  2Y87 A;  1XTO A;  4B87 A;  2BG8 B;  1X8G A;  2BG8 A;  4GYQ A;  3AF6 A;  5EVB A;  1VJN A;  1QH3 A;  2FU6 A;  3P2U A;  3IEM A;  2YNV B;  5LE1 A;  5EH9 A;  2P18 A;  5LCA A;  3MD7 A;  2CBN A;  3BK2 A;  5LS3 A;  5HH5 A;  2VW8 A;  4CHL A;  4C1C A;  3DHC A;  5ACT A;  2OHI A;  5ACS A;  4C09 A;  5ACU A;  4D1V A;  4TZE A;  5K4N A;  2P1E A;  4UWO B;  3BC2 A;  2BG2 A;  1ZNB A;  2I7T A;  2FK6 A;  4D1T A;  4AD9 A;  3IEL A;  2ZNB A;  4NQ5 A;  5AHO A;  4F6Z A;  5AHR A;  3A4Y A;  4DIK A;  1YCF A;  4FR7 A;  4EYF A;  2Q0J A;  3ADR A;  1DXK A;  4JO0 A;  3FAI A;  3IE1 A;  4EY2 A;  5HIP A;  4EYB A;  5A87 A;  4HL2 A;  2ZO4 A;  4UWS B;  5EVK A;  1KR3 A;  5ACW A;  1KO3 A;  5LLD A;  2Y8B A;  2BFK A;  2GFK A;  3ESH A;  3T3N A;  2Q9U A;  1WUP A;  2GMN A;  4C1G A;  5A0V A;  2FHX A;  1BC2 A;  1HLK A;  4NQ2 A;  5HIS A;  4GCW A;  2HB9 A;  3VQZ A;  4HKY A;  3WXC A;  5B15 A;  3X2X A;  2BGA A;  2FU8 A;  4YSL A;  1ZTC A;  3ZQ4 A;  5HH4 A;  2WHG A;  2YCB A;  4RL0 A;  2WYL A;  3KL7 A;  1JT1 A;  1BVT A;  3PY5 A;  1XM8 A;  2BC2 A;  3FCZ A;  4TZ9 A;  3T3O A;  4EFZ A;  4UWP B;  5AXO A;  5B1U A;  4UWR B;  4UA4 A;  5A0T A;  3X2Z A;  1WUO A;  5EV8 A; 
#chains in the Genus database with same CATH topology
 4Z60 A;  2NZF A;  3I14 A;  4AWZ A;  4EYL A;  3TP9 A;  4PVT A;  2YHE A;  3I15 A;  4LE6 A;  2NYP A;  2YNT B;  5ACP A;  4FEK A;  1L9Y A;  4RL2 A;  3H3E A;  2GCU A;  3JXP A;  2E7Y A;  3AJ3 A;  2QED A;  2GKL A;  3LVZ A;  1X8I A;  2BTN A;  3IOG A;  2AZ4 A;  3IOF A;  3IDZ A;  1YCG A;  5KIL A;  5AIJ A;  4D02 A;  4Z5Z A;  3F9O A;  4WD6 A;  4YSK A;  2DOO A;  4V0H A;  2GFJ A;  5DPX A;  2I7X A;  4DIL A;  3R2U A;  5LCF A;  2FU7 A;  4AX0 B;  3SW3 A;  1JJT A;  2CFU A;  3VPE A;  5EHT A;  5LCH A;  3RPC A;  2A7M A;  5AXR A;  5HIQ A;  4D1W A;  1P9E A;  2YZ3 A;  4XWW A;  5EWA A;  1K07 A;  5A5Z A;  2BG7 A;  2BR6 A;  2YNV A;  5KIK A;  3PY6 A;  1A8T A;  4C1E A;  4H0D A;  1M2X A;  4BZ3 A;  2YNT A;  2DKF A;  4RAW A;  1X8H A;  3SD9 A;  1DD6 A;  4TZB A;  1DDK A;  1Y44 A;  4ZO3 A;  4ZO2 A;  2YNU A;  4GYU A;  2P4Z A;  5B3R A;  3IEK A;  1KO2 A;  1WW1 A;  2BIB A;  2M5D A;  2Q42 A;  2NXA A;  3SRX A;  4XUK A;  4J5H A;  3I11 A;  3X30 A;  4EXS A;  3AF5 A;  4TZF A;  2P97 A;  2BFZ B;  2FU9 A;  4Z67 A;  2AIO A;  4NUR A;  5AEB A;  3KNR A;  3RKJ A;  4YSB A;  2BG6 A;  4RM5 A;  4HL1 A;  3BV6 A;  5FQB A;  4C1H A;  3SPU A;  4AV7 A;  4TYF A;  4TYT A;  4ZNB A;  3PG4 A;  5K4M A;  3SFP A;  3DHA A;  4C1D A;  3DHB A;  1ZKP A;  4Z7R A;  4UBQ A;  2FM6 A;  4U4L A;  3I0V A;  2NZE A;  4C1F A;  2XR1 A;  2H6A A;  2Y8A A;  3I13 A;  2OHH A;  1SML A;  5EVD A;  3S0Z A;  3IE2 A;  3ZR9 A;  2UYX A;  2WRS A;  2BMI A;  4AX1 B;  2QIN A;  5EV6 A;  4BP0 A;  1QH5 A;  5ACV A;  1YCH A;  3KNS A;  3QH8 A;  5LM6 A;  4F6H A;  3DH8 A;  5IQK A;  1VME A;  1VGN A;  3SBL A;  4J5F A;  2Q0I A;  2BFL A;  3L6N A;  5AYA A;  2I7V A;  3RKK A;  3IE0 A;  4PVO A;  3BK1 A;  5HH6 A;  4RAM A;  5FQC A;  2FHX B;  5FQA A;  4PDX A;  2ZZI A;  4Z6X A;  4P62 A;  4AWY B;  4KEP A;  4ZEJ A;  1A7T A;  3X2Y A;  4D1U A;  5ACX A;  5ACR A;  1BMC A;  4Z5Y A;  2OHJ A;  5LMC A;  5K0W A;  2WYM C;  2R2D A;  5LSC A;  1JJE A;  4KEQ A;  2XF4 A;  2YNW A;  2QDT A;  4FSB A;  1WRA A;  2BFZ A;  4RBS A;  2QDS A;  3ZWF A;  4NQ4 A;  4UAM A;  2CFZ A;  4XWT A;  5HIO A;  3Q6V A;  3ZNB A;  5ACQ A;  5EW0 A;  1MQO A;  3G1P A;  4O98 A;  2M5C A;  4NQ6 A;  4EXY A;  1E5D A;  2QJS A;  3T9M A;  5K4K A;  2ZWR A;  2WYM A;  2Y87 A;  1XTO A;  4B87 A;  2BG8 B;  1X8G A;  2BG8 A;  4GYQ A;  3AF6 A;  5EVB A;  5AJL A;  1VJN A;  1QH3 A;  2FU6 A;  3P2U A;  3IEM A;  2YNV B;  5LE1 A;  5EH9 A;  2P18 A;  5LCA A;  3MD7 A;  2CBN A;  3BK2 A;  5LS3 A;  5HH5 A;  4AXH A;  2VW8 A;  4CHL A;  4C1C A;  3DHC A;  5ACT A;  2OHI A;  5ACS A;  4C09 A;  5ACU A;  4D1V A;  4TZE A;  5K4N A;  2P1E A;  4UWO B;  3BC2 A;  2BG2 A;  1ZNB A;  2I7T A;  2FK6 A;  2CG3 A;  4D1T A;  4AD9 A;  2CG2 A;  3IEL A;  2ZNB A;  4NQ5 A;  5AHO A;  4F6Z A;  5AHR A;  3A4Y A;  4DIK A;  1YCF A;  4FR7 A;  4EYF A;  2Q0J A;  3ADR A;  1DXK A;  4JO0 A;  3FAI A;  3IE1 A;  4EY2 A;  5HIP A;  4EYB A;  5A87 A;  4HL2 A;  2ZO4 A;  4UWS B;  5EVK A;  1KR3 A;  5ACW A;  1KO3 A;  5LLD A;  2Y8B A;  2BFK A;  2GFK A;  3ESH A;  3T3N A;  2Q9U A;  1WUP A;  2GMN A;  4C1G A;  5A23 A;  5A0V A;  2FHX A;  1BC2 A;  1HLK A;  4NQ2 A;  5HIS A;  4GCW A;  2HB9 A;  3VQZ A;  4HKY A;  3WXC A;  5B15 A;  3X2X A;  2BGA A;  2FU8 A;  4YSL A;  1ZTC A;  3ZQ4 A;  5HH4 A;  2WHG A;  2YCB A;  4RL0 A;  2WYL A;  3KL7 A;  1JT1 A;  1BVT A;  3PY5 A;  1XM8 A;  2BC2 A;  3FCZ A;  4TZ9 A;  3T3O A;  4EFZ A;  4UWP B;  5AXO A;  5B1U A;  4UWR B;  4UA4 A;  5A0T A;  3X2Z A;  1WUO A;  5EV8 A; 
#chains in the Genus database with same CATH homology
 4Z60 A;  2NZF A;  3I14 A;  4AWZ A;  4EYL A;  3TP9 A;  4PVT A;  3I15 A;  4LE6 A;  2NYP A;  2YNT B;  5ACP A;  4FEK A;  1L9Y A;  4RL2 A;  3H3E A;  2GCU A;  3JXP A;  2E7Y A;  3AJ3 A;  2QED A;  2GKL A;  3LVZ A;  1X8I A;  2BTN A;  3IOG A;  2AZ4 A;  3IOF A;  3IDZ A;  1YCG A;  5KIL A;  4D02 A;  4Z5Z A;  3F9O A;  4WD6 A;  4YSK A;  2DOO A;  4V0H A;  2GFJ A;  5DPX A;  2I7X A;  4DIL A;  3R2U A;  5LCF A;  2FU7 A;  4AX0 B;  3SW3 A;  1JJT A;  3VPE A;  5EHT A;  5LCH A;  3RPC A;  2A7M A;  5AXR A;  5HIQ A;  4D1W A;  1P9E A;  2YZ3 A;  4XWW A;  5EWA A;  1K07 A;  5A5Z A;  2BG7 A;  2BR6 A;  2YNV A;  5KIK A;  3PY6 A;  1A8T A;  4C1E A;  4H0D A;  1M2X A;  4BZ3 A;  2YNT A;  2DKF A;  4RAW A;  1X8H A;  3SD9 A;  1DD6 A;  4TZB A;  1DDK A;  1Y44 A;  4ZO3 A;  4ZO2 A;  2YNU A;  4GYU A;  2P4Z A;  5B3R A;  3IEK A;  1KO2 A;  1WW1 A;  2BIB A;  2M5D A;  2Q42 A;  2NXA A;  3SRX A;  4XUK A;  4J5H A;  3I11 A;  3X30 A;  4EXS A;  3AF5 A;  4TZF A;  2P97 A;  2BFZ B;  2FU9 A;  4Z67 A;  2AIO A;  5AEB A;  3KNR A;  3RKJ A;  4YSB A;  2BG6 A;  4RM5 A;  4HL1 A;  3BV6 A;  5FQB A;  4C1H A;  3SPU A;  4TYF A;  4TYT A;  4ZNB A;  3PG4 A;  5K4M A;  3SFP A;  3DHA A;  4C1D A;  3DHB A;  1ZKP A;  4Z7R A;  4UBQ A;  2FM6 A;  4U4L A;  3I0V A;  2NZE A;  4C1F A;  2XR1 A;  2H6A A;  2Y8A A;  3I13 A;  2OHH A;  1SML A;  5EVD A;  3S0Z A;  3IE2 A;  3ZR9 A;  2UYX A;  2WRS A;  2BMI A;  4AX1 B;  2QIN A;  5EV6 A;  4BP0 A;  1QH5 A;  5ACV A;  1YCH A;  3KNS A;  3QH8 A;  5LM6 A;  4F6H A;  3DH8 A;  5IQK A;  1VME A;  1VGN A;  3SBL A;  4J5F A;  2Q0I A;  2BFL A;  3L6N A;  5AYA A;  2I7V A;  3RKK A;  3IE0 A;  4PVO A;  3BK1 A;  5HH6 A;  4RAM A;  5FQC A;  2FHX B;  5FQA A;  2ZZI A;  4Z6X A;  4P62 A;  4AWY B;  4KEP A;  4ZEJ A;  1A7T A;  3X2Y A;  4D1U A;  5ACX A;  5ACR A;  1BMC A;  4Z5Y A;  2OHJ A;  5LMC A;  5K0W A;  2WYM C;  2R2D A;  5LSC A;  1JJE A;  4KEQ A;  2XF4 A;  2YNW A;  2QDT A;  4FSB A;  1WRA A;  2BFZ A;  4RBS A;  2QDS A;  4NQ4 A;  4UAM A;  4XWT A;  5HIO A;  3ZWF A;  3Q6V A;  3ZNB A;  5ACQ A;  5EW0 A;  1MQO A;  3G1P A;  4O98 A;  2M5C A;  4NQ6 A;  4EXY A;  1E5D A;  2QJS A;  3T9M A;  5K4K A;  2ZWR A;  2WYM A;  2Y87 A;  1XTO A;  4B87 A;  2BG8 B;  1X8G A;  2BG8 A;  4GYQ A;  3AF6 A;  5EVB A;  1VJN A;  1QH3 A;  2FU6 A;  3P2U A;  3IEM A;  2YNV B;  5LE1 A;  5EH9 A;  2P18 A;  5LCA A;  3MD7 A;  2CBN A;  3BK2 A;  5LS3 A;  5HH5 A;  2VW8 A;  4CHL A;  4C1C A;  3DHC A;  5ACT A;  2OHI A;  5ACS A;  4C09 A;  5ACU A;  4D1V A;  4TZE A;  5K4N A;  2P1E A;  4UWO B;  3BC2 A;  2BG2 A;  1ZNB A;  2I7T A;  2FK6 A;  4D1T A;  4AD9 A;  3IEL A;  2ZNB A;  4NQ5 A;  5AHO A;  4F6Z A;  5AHR A;  3A4Y A;  4DIK A;  1YCF A;  4FR7 A;  4EYF A;  2Q0J A;  3ADR A;  1DXK A;  4JO0 A;  3FAI A;  3IE1 A;  4EY2 A;  5HIP A;  4EYB A;  5A87 A;  4HL2 A;  2ZO4 A;  4UWS B;  5EVK A;  1KR3 A;  5ACW A;  1KO3 A;  5LLD A;  2Y8B A;  2BFK A;  2GFK A;  3ESH A;  3T3N A;  2Q9U A;  1WUP A;  2GMN A;  4C1G A;  5A0V A;  2FHX A;  1BC2 A;  1HLK A;  4NQ2 A;  5HIS A;  4GCW A;  2HB9 A;  3VQZ A;  4HKY A;  3WXC A;  5B15 A;  3X2X A;  2BGA A;  2FU8 A;  4YSL A;  1ZTC A;  3ZQ4 A;  5HH4 A;  2WHG A;  2YCB A;  4RL0 A;  2WYL A;  3KL7 A;  1JT1 A;  1BVT A;  3PY5 A;  1XM8 A;  2BC2 A;  3FCZ A;  4TZ9 A;  3T3O A;  4EFZ A;  4UWP B;  5AXO A;  5B1U A;  4UWR B;  4UA4 A;  5A0T A;  3X2Z A;  1WUO A;  5EV8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...