3DHAA

An ultral high resolution structure of n-acyl homoserine lactone hydrolase with the product n-hexanoyl-l-homoserine bound at an alternative site
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
254
structure length
254
Chain Sequence
b'GRISMTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIETEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-Acyl Homoserine Lactone Hydrolase
molecule tags Hydrolase
source organism Bacillus thuringiensis serovar kurstaki
publication title Mechanism of the quorum-quenching lactonase (AiiA) from Bacillus thuringiensis. 1. Product-bound structures.
pubmed doi rcsb
total genus 80
structure length 254
sequence length 254
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2008-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3dhaA01
5IQKA 3SW3A 3X2ZA 4D1TA 5AYAA 3LVZA 5AEBA 4RAMA 1YCFA 2QDTA 5HIPA 4V0HA 3SBLA 3AF5A 1M2XA 2BFZB 3PY6A 4NQ6A 5KILA 4BP0A 4ZO2A 5FQBA 4C09A 1ZNBA 3G1PA 2AIOA 3IEMA 4Z7RA 2GFJA 5EW0A 2CBNA 1XM8A 2A7MA 1JT1A 2BC2A 4F6HA 3AF6A 2BFLA 4PVTA 3DHAA 2YNVA 2I7VA 4ZNBA 3RPCA 4YSKA 3FCZA 2YNUA 2P4ZA 1HLKA 3ZQ4A 4TZ9A 4AWYB 1ZTCA 3IOFA 1BVTA 2BG8A 4TYFA 5FQCA 2WYMA 4RBSA 3Q6VA 3KNSA 3VQZA 5ACTA 3H3EA 2BG6A 4RAWA 2FU9A 2BG8B 5K0WA 1L9YA 2Q0JA 3R2UA 4XUKA 3DHCA 4O98A 2M5CA 1BMCA 4XWTA 4ZO3A 4NQ2A 4P62A 5AXRA 5EH9A 1Y44A 2YZ3A 2GFKA 4Z60A 2NZFA 4EFZA 2ZZIA 3WXCA 4GYQA 3I0VA 2WYMC 1QH3A 4AWZA 2XF4A 2FK6A 3BV6A 1X8HA 2GKLA 2NYPA 4UBQA 4LE6A 3BC2A 2FU7A 1JJTA 1WUPA 2BTNA 1VJNA 5EV6A 2XR1A 3BK1A 1E5DA 2Q9UA 3A4YA 5LMCA 2DOOA 2QDSA 3IE2A 4JO0A 4Z5ZA 4TZEA 2Y87A 1P9EA 4UA4A 4GYUA 3RKJA 5A0VA 5LCHA 2BGAA 1KO2A 4Z5YA 5ACQA 4RM5A 5LM6A 4PVOA 3AJ3A 4D02A 1YCGA 3VPEA 3SFPA 4AX0B 5ACWA 4D1UA 2NZEA 4J5FA 5HIOA 4Z6XA 4GCWA 3S0ZA 5DPXA 3KL7A 2BIBA 3T3NA 4KEQA 4U4LA 4H0DA 5HH5A 3P2UA 2WRSA 2H6AA 5K4NA 1X8GA 5ACUA 4B87A 1KR3A 3SD9A 4NQ4A 2ZWRA 4HKYA 2P18A 2BMIA 2DKFA 2FHXB 4J5HA 2WYLA 4BZ3A 2VW8A 5EVDA 4FEKA 1BC2A 3IDZA 4UWSB 4C1EA 5LE1A 4DILA 4WD6A 2P97A 3ESHA 3L6NA 2P1EA 4Z67A 1A7TA 2Q0IA 4C1FA 4NQ5A 2M5DA 1QH5A 4UAMA 4UWPB 3IE1A 2ZNBA 4TZFA 4CHLA 2BR6A 1WRAA 3PG4A 5LLDA 4YSBA 5LCFA 3PY5A 4F6ZA 5AHOA 3ZR9A 2BFKA 2YNVB 5LCAA 1JJEA 5AHRA 2BG7A 1DXKA 3IEKA 2YNTB 2UYXA 1YCHA 4DIKA 2QINA 3I14A 3X2YA 2OHHA 4UWOB 2YCBA 5EV8A 4XWWA 5HH6A 3ADRA 3KNRA 3ZWFA 1KO3A 4YSLA 5KIKA 3TP9A 2YNTA 3X30A 5EWAA 3SPUA 4EY2A 5A5ZA 1X8IA 1VMEA 5ACVA 2FU8A 2Q42A 2FU6A 5ACXA 4C1CA 4C1GA 3I13A 2HB9A 2FM6A 2GMNA 4RL0A 4HL1A 4EYBA 2QJSA 3ZNBA 3BK2A 3F9OA 4UWRB 5ACRA 3MD7A 5HH4A 5B3RA 5K4MA 4FSBA 4EYLA 3RKKA 2Y8AA 5LS3A 4C1HA 2YNWA 3IOGA 4EYFA 2FHXA 4TZBA 2WHGA 4C1DA 5EVKA 3DH8A 2Y8BA 3QH8A 1DD6A 5A87A 4HL2A 1WUOA 2R2DA 3FAIA 2I7XA 5LSCA 3DHBA 1SMLA 5AXOA 5HISA 3IE0A 4EXSA 1WW1A 3IELA 5ACPA 5B15A 2GCUA 4EXYA 2NXAA 5ACSA 4D1VA 2ZO4A 5HIQA 5A0TA 4AX1B 3I15A 5K4KA 5EVBA 5EHTA 5B1UA 2AZ4A 3SRXA 2I7TA 1XTOA 4ZEJA 1DDKA 3I11A 2OHIA 1K07A 5FQAA 3JXPA 4RL2A 1MQOA 4AD9A 4FR7A 3T9MA 1VGNA 3X2XA 1ZKPA 4KEPA 4TYTA 2BFZA 3T3OA 2QEDA 4D1WA 2E7YA 2OHJA 2BG2A 1A8TA
chains in the Genus database with same CATH superfamily
5IQKA 3SW3A 3X2ZA 4D1TA 5AYAA 3LVZA 5AEBA 4RAMA 1YCFA 2QDTA 5HIPA 4V0HA 3SBLA 3AF5A 1M2XA 2BFZB 3PY6A 4NQ6A 5KILA 4BP0A 4ZO2A 5FQBA 4C09A 1ZNBA 3G1PA 2AIOA 3IEMA 4Z7RA 2GFJA 5EW0A 2CBNA 1XM8A 2A7MA 1JT1A 2BC2A 4F6HA 3AF6A 2BFLA 4PVTA 3DHAA 2YNVA 2I7VA 4ZNBA 3RPCA 4YSKA 3FCZA 2YNUA 2P4ZA 4AXHA 4PDXA 1HLKA 3ZQ4A 4TZ9A 4AWYB 1ZTCA 3IOFA 1BVTA 2BG8A 4TYFA 5FQCA 2WYMA 4NURA 4RBSA 3Q6VA 3KNSA 3VQZA 5ACTA 3H3EA 2BG6A 4RAWA 2FU9A 2BG8B 5K0WA 1L9YA 2Q0JA 3R2UA 4XUKA 3DHCA 4O98A 2M5CA 1BMCA 4XWTA 4ZO3A 4NQ2A 4P62A 5AXRA 5EH9A 1Y44A 2YZ3A 2GFKA 4Z60A 2NZFA 4EFZA 2ZZIA 3WXCA 4GYQA 3I0VA 2WYMC 1QH3A 4AWZA 2XF4A 2FK6A 3BV6A 1X8HA 2GKLA 2NYPA 4UBQA 4LE6A 3BC2A 2FU7A 1JJTA 1WUPA 2BTNA 1VJNA 2CFZA 5EV6A 2XR1A 3BK1A 1E5DA 2Q9UA 3A4YA 5LMCA 2DOOA 2QDSA 3IE2A 4JO0A 4Z5ZA 4TZEA 2Y87A 1P9EA 4UA4A 4GYUA 3RKJA 5A0VA 5LCHA 2BGAA 1KO2A 4Z5YA 5ACQA 4AV7A 4RM5A 5LM6A 4PVOA 3AJ3A 4D02A 1YCGA 3VPEA 3SFPA 4AX0B 5ACWA 2CG2A 4D1UA 2NZEA 4J5FA 5HIOA 4Z6XA 4GCWA 3S0ZA 5DPXA 3KL7A 2BIBA 3T3NA 4KEQA 4U4LA 4H0DA 2CG3A 2CFUA 5HH5A 3P2UA 2WRSA 2H6AA 5K4NA 1X8GA 5ACUA 4B87A 1KR3A 3SD9A 4NQ4A 2ZWRA 4HKYA 2P18A 2BMIA 2DKFA 2FHXB 4J5HA 2WYLA 5AIJA 4BZ3A 2VW8A 5EVDA 4FEKA 1BC2A 3IDZA 4UWSB 4C1EA 5LE1A 4DILA 4WD6A 2P97A 3ESHA 3L6NA 2P1EA 4Z67A 1A7TA 2Q0IA 4C1FA 2YHEA 4NQ5A 2M5DA 1QH5A 4UAMA 4UWPB 3IE1A 2ZNBA 4TZFA 4CHLA 2BR6A 1WRAA 3PG4A 5LLDA 4YSBA 5LCFA 3PY5A 4F6ZA 5AHOA 3ZR9A 2BFKA 2YNVB 5LCAA 1JJEA 5AHRA 2BG7A 1DXKA 3IEKA 2YNTB 2UYXA 1YCHA 4DIKA 2QINA 3I14A 3X2YA 2OHHA 4UWOB 2YCBA 5EV8A 4XWWA 5HH6A 3ADRA 3KNRA 3ZWFA 1KO3A 4YSLA 5KIKA 3TP9A 2YNTA 3X30A 5EWAA 3SPUA 4EY2A 5A5ZA 1X8IA 1VMEA 5ACVA 2FU8A 2Q42A 2FU6A 5ACXA 4C1CA 4C1GA 3I13A 2HB9A 2FM6A 2GMNA 4RL0A 4HL1A 4EYBA 2QJSA 3ZNBA 3BK2A 3F9OA 4UWRB 5ACRA 3MD7A 5HH4A 5B3RA 5K4MA 4FSBA 4EYLA 3RKKA 2Y8AA 5LS3A 4C1HA 2YNWA 3IOGA 4EYFA 5A23A 2FHXA 4TZBA 2WHGA 4C1DA 5EVKA 3DH8A 2Y8BA 3QH8A 1DD6A 5A87A 4HL2A 1WUOA 2R2DA 3FAIA 2I7XA 5LSCA 3DHBA 1SMLA 5AXOA 5HISA 3IE0A 4EXSA 1WW1A 3IELA 5ACPA 5B15A 2GCUA 4EXYA 2NXAA 5ACSA 4D1VA 2ZO4A 5HIQA 5A0TA 4AX1B 3I15A 5K4KA 5EVBA 5EHTA 5B1UA 2AZ4A 3SRXA 2I7TA 1XTOA 4ZEJA 1DDKA 3I11A 2OHIA 1K07A 5FQAA 5AJLA 3JXPA 4RL2A 1MQOA 4AD9A 4FR7A 3T9MA 1VGNA 3X2XA 1ZKPA 4KEPA 4TYTA 2BFZA 3T3OA 2QEDA 4D1WA 2E7YA 2OHJA 2BG2A 1A8TA
chains in the Genus database with same CATH topology
5IQKA 3SW3A 3X2ZA 4D1TA 5AYAA 3LVZA 5AEBA 4RAMA 1YCFA 2QDTA 5HIPA 4V0HA 3SBLA 3AF5A 1M2XA 2BFZB 3PY6A 4NQ6A 5KILA 4BP0A 4ZO2A 5FQBA 4C09A 1ZNBA 3G1PA 2AIOA 3IEMA 4Z7RA 2GFJA 5EW0A 2CBNA 1XM8A 2A7MA 1JT1A 2BC2A 4F6HA 3AF6A 2BFLA 4PVTA 3DHAA 2YNVA 2I7VA 4ZNBA 3RPCA 4YSKA 3FCZA 2YNUA 2P4ZA 1HLKA 3ZQ4A 4TZ9A 4AWYB 1ZTCA 3IOFA 1BVTA 2BG8A 4TYFA 5FQCA 2WYMA 4RBSA 3Q6VA 3KNSA 3VQZA 5ACTA 3H3EA 2BG6A 4RAWA 2FU9A 2BG8B 5K0WA 1L9YA 2Q0JA 3R2UA 4XUKA 3DHCA 4O98A 2M5CA 1BMCA 4XWTA 4ZO3A 4NQ2A 4P62A 5AXRA 5EH9A 1Y44A 2YZ3A 2GFKA 4Z60A 2NZFA 4EFZA 2ZZIA 3WXCA 4GYQA 3I0VA 2WYMC 1QH3A 4AWZA 2XF4A 2FK6A 3BV6A 1X8HA 2GKLA 2NYPA 4UBQA 4LE6A 3BC2A 2FU7A 1JJTA 1WUPA 2BTNA 1VJNA 5EV6A 2XR1A 3BK1A 1E5DA 2Q9UA 3A4YA 5LMCA 2DOOA 2QDSA 3IE2A 4JO0A 4Z5ZA 4TZEA 2Y87A 1P9EA 4UA4A 4GYUA 3RKJA 5A0VA 5LCHA 2BGAA 1KO2A 4Z5YA 5ACQA 4RM5A 5LM6A 4PVOA 3AJ3A 4D02A 1YCGA 3VPEA 3SFPA 4AX0B 5ACWA 4D1UA 2NZEA 4J5FA 5HIOA 4Z6XA 4GCWA 3S0ZA 5DPXA 3KL7A 2BIBA 3T3NA 4KEQA 4U4LA 4H0DA 5HH5A 3P2UA 2WRSA 2H6AA 5K4NA 1X8GA 5ACUA 4B87A 1KR3A 3SD9A 4NQ4A 2ZWRA 4HKYA 2P18A 2BMIA 2DKFA 2FHXB 4J5HA 2WYLA 4BZ3A 2VW8A 5EVDA 4FEKA 1BC2A 3IDZA 4UWSB 4C1EA 5LE1A 4DILA 4WD6A 2P97A 3ESHA 3L6NA 2P1EA 4Z67A 1A7TA 2Q0IA 4C1FA 4NQ5A 2M5DA 1QH5A 4UAMA 4UWPB 3IE1A 2ZNBA 4TZFA 4CHLA 2BR6A 1WRAA 3PG4A 5LLDA 4YSBA 5LCFA 3PY5A 4F6ZA 5AHOA 3ZR9A 2BFKA 2YNVB 5LCAA 1JJEA 5AHRA 2BG7A 1DXKA 3IEKA 2YNTB 2UYXA 1YCHA 4DIKA 2QINA 3I14A 3X2YA 2OHHA 4UWOB 2YCBA 5EV8A 4XWWA 5HH6A 3ADRA 3KNRA 3ZWFA 1KO3A 4YSLA 5KIKA 3TP9A 2YNTA 3X30A 5EWAA 3SPUA 4EY2A 5A5ZA 1X8IA 1VMEA 5ACVA 2FU8A 2Q42A 2FU6A 5ACXA 4C1CA 4C1GA 3I13A 2HB9A 2FM6A 2GMNA 4RL0A 4HL1A 4EYBA 2QJSA 3ZNBA 3BK2A 3F9OA 4UWRB 5ACRA 3MD7A 5HH4A 5B3RA 5K4MA 4FSBA 4EYLA 3RKKA 2Y8AA 5LS3A 4C1HA 2YNWA 3IOGA 4EYFA 2FHXA 4TZBA 2WHGA 4C1DA 5EVKA 3DH8A 2Y8BA 3QH8A 1DD6A 5A87A 4HL2A 1WUOA 2R2DA 3FAIA 2I7XA 5LSCA 3DHBA 1SMLA 5AXOA 5HISA 3IE0A 4EXSA 1WW1A 3IELA 5ACPA 5B15A 2GCUA 4EXYA 2NXAA 5ACSA 4D1VA 2ZO4A 5HIQA 5A0TA 4AX1B 3I15A 5K4KA 5EVBA 5EHTA 5B1UA 2AZ4A 3SRXA 2I7TA 1XTOA 4ZEJA 1DDKA 3I11A 2OHIA 1K07A 5FQAA 3JXPA 4RL2A 1MQOA 4AD9A 4FR7A 3T9MA 1VGNA 3X2XA 1ZKPA 4KEPA 4TYTA 2BFZA 3T3OA 2QEDA 4D1WA 2E7YA 2OHJA 2BG2A 1A8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IQK A;  3SW3 A;  3X2Z A;  4D1T A;  5AYA A;  3LVZ A;  5AEB A;  4RAM A;  1YCF A;  2QDT A;  5HIP A;  4V0H A;  3SBL A;  3AF5 A;  1M2X A;  2BFZ B;  3PY6 A;  4NQ6 A;  5KIL A;  4BP0 A;  4ZO2 A;  5FQB A;  4C09 A;  1ZNB A;  3G1P A;  2AIO A;  3IEM A;  4Z7R A;  2GFJ A;  5EW0 A;  2CBN A;  1XM8 A;  2A7M A;  1JT1 A;  2BC2 A;  4F6H A;  3AF6 A;  2BFL A;  4PVT A;  3DHA A;  2YNV A;  2I7V A;  4ZNB A;  3RPC A;  4YSK A;  3FCZ A;  2YNU A;  2P4Z A;  1HLK A;  3ZQ4 A;  4TZ9 A;  4AWY B;  1ZTC A;  3IOF A;  1BVT A;  2BG8 A;  4TYF A;  5FQC A;  2WYM A;  4RBS A;  3Q6V A;  3KNS A;  3VQZ A;  5ACT A;  3H3E A;  2BG6 A;  4RAW A;  2FU9 A;  2BG8 B;  5K0W A;  1L9Y A;  2Q0J A;  3R2U A;  4XUK A;  3DHC A;  4O98 A;  2M5C A;  1BMC A;  4XWT A;  4ZO3 A;  4NQ2 A;  4P62 A;  5AXR A;  5EH9 A;  1Y44 A;  2YZ3 A;  2GFK A;  4Z60 A;  2NZF A;  4EFZ A;  2ZZI A;  3WXC A;  4GYQ A;  3I0V A;  2WYM C;  1QH3 A;  4AWZ A;  2XF4 A;  2FK6 A;  3BV6 A;  1X8H A;  2GKL A;  2NYP A;  4UBQ A;  4LE6 A;  3BC2 A;  2FU7 A;  1JJT A;  1WUP A;  2BTN A;  1VJN A;  5EV6 A;  2XR1 A;  3BK1 A;  1E5D A;  2Q9U A;  3A4Y A;  5LMC A;  2DOO A;  2QDS A;  3IE2 A;  4JO0 A;  4Z5Z A;  4TZE A;  2Y87 A;  1P9E A;  4UA4 A;  4GYU A;  3RKJ A;  5A0V A;  5LCH A;  2BGA A;  1KO2 A;  4Z5Y A;  5ACQ A;  4RM5 A;  5LM6 A;  4PVO A;  3AJ3 A;  4D02 A;  1YCG A;  3VPE A;  3SFP A;  4AX0 B;  5ACW A;  4D1U A;  2NZE A;  4J5F A;  5HIO A;  4Z6X A;  4GCW A;  3S0Z A;  5DPX A;  3KL7 A;  2BIB A;  3T3N A;  4KEQ A;  4U4L A;  4H0D A;  5HH5 A;  3P2U A;  2WRS A;  2H6A A;  5K4N A;  1X8G A;  5ACU A;  4B87 A;  1KR3 A;  3SD9 A;  4NQ4 A;  2ZWR A;  4HKY A;  2P18 A;  2BMI A;  2DKF A;  2FHX B;  4J5H A;  2WYL A;  4BZ3 A;  2VW8 A;  5EVD A;  4FEK A;  1BC2 A;  3IDZ A;  4UWS B;  4C1E A;  5LE1 A;  4DIL A;  4WD6 A;  2P97 A;  3ESH A;  3L6N A;  2P1E A;  4Z67 A;  1A7T A;  2Q0I A;  4C1F A;  4NQ5 A;  2M5D A;  1QH5 A;  4UAM A;  4UWP B;  3IE1 A;  2ZNB A;  4TZF A;  4CHL A;  2BR6 A;  1WRA A;  3PG4 A;  5LLD A;  4YSB A;  5LCF A;  3PY5 A;  4F6Z A;  5AHO A;  3ZR9 A;  2BFK A;  2YNV B;  5LCA A;  1JJE A;  5AHR A;  2BG7 A;  1DXK A;  3IEK A;  2YNT B;  2UYX A;  1YCH A;  4DIK A;  2QIN A;  3I14 A;  3X2Y A;  2OHH A;  4UWO B;  2YCB A;  5EV8 A;  4XWW A;  5HH6 A;  3ADR A;  3KNR A;  3ZWF A;  1KO3 A;  4YSL A;  5KIK A;  3TP9 A;  2YNT A;  3X30 A;  5EWA A;  3SPU A;  4EY2 A;  5A5Z A;  1X8I A;  1VME A;  5ACV A;  2FU8 A;  2Q42 A;  2FU6 A;  5ACX A;  4C1C A;  4C1G A;  3I13 A;  2HB9 A;  2FM6 A;  2GMN A;  4RL0 A;  4HL1 A;  4EYB A;  2QJS A;  3ZNB A;  3BK2 A;  3F9O A;  4UWR B;  5ACR A;  3MD7 A;  5HH4 A;  5B3R A;  5K4M A;  4FSB A;  4EYL A;  3RKK A;  2Y8A A;  5LS3 A;  4C1H A;  2YNW A;  3IOG A;  4EYF A;  2FHX A;  4TZB A;  2WHG A;  4C1D A;  5EVK A;  3DH8 A;  2Y8B A;  3QH8 A;  1DD6 A;  5A87 A;  4HL2 A;  1WUO A;  2R2D A;  3FAI A;  2I7X A;  5LSC A;  3DHB A;  1SML A;  5AXO A;  5HIS A;  3IE0 A;  4EXS A;  1WW1 A;  3IEL A;  5ACP A;  5B15 A;  2GCU A;  4EXY A;  2NXA A;  5ACS A;  4D1V A;  2ZO4 A;  5HIQ A;  5A0T A;  4AX1 B;  3I15 A;  5K4K A;  5EVB A;  5EHT A;  5B1U A;  2AZ4 A;  3SRX A;  2I7T A;  1XTO A;  4ZEJ A;  1DDK A;  3I11 A;  2OHI A;  1K07 A;  5FQA A;  3JXP A;  4RL2 A;  1MQO A;  4AD9 A;  4FR7 A;  3T9M A;  1VGN A;  3X2X A;  1ZKP A;  4KEP A;  4TYT A;  2BFZ A;  3T3O A;  2QED A;  4D1W A;  2E7Y A;  2OHJ A;  2BG2 A;  1A8T A; 
#chains in the Genus database with same CATH topology
 5IQK A;  3SW3 A;  3X2Z A;  4D1T A;  5AYA A;  3LVZ A;  5AEB A;  4RAM A;  1YCF A;  2QDT A;  5HIP A;  4V0H A;  3SBL A;  3AF5 A;  1M2X A;  2BFZ B;  3PY6 A;  4NQ6 A;  5KIL A;  4BP0 A;  4ZO2 A;  5FQB A;  4C09 A;  1ZNB A;  3G1P A;  2AIO A;  3IEM A;  4Z7R A;  2GFJ A;  5EW0 A;  2CBN A;  1XM8 A;  2A7M A;  1JT1 A;  2BC2 A;  4F6H A;  3AF6 A;  2BFL A;  4PVT A;  3DHA A;  2YNV A;  2I7V A;  4ZNB A;  3RPC A;  4YSK A;  3FCZ A;  2YNU A;  2P4Z A;  4AXH A;  4PDX A;  1HLK A;  3ZQ4 A;  4TZ9 A;  4AWY B;  1ZTC A;  3IOF A;  1BVT A;  2BG8 A;  4TYF A;  5FQC A;  2WYM A;  4NUR A;  4RBS A;  3Q6V A;  3KNS A;  3VQZ A;  5ACT A;  3H3E A;  2BG6 A;  4RAW A;  2FU9 A;  2BG8 B;  5K0W A;  1L9Y A;  2Q0J A;  3R2U A;  4XUK A;  3DHC A;  4O98 A;  2M5C A;  1BMC A;  4XWT A;  4ZO3 A;  4NQ2 A;  4P62 A;  5AXR A;  5EH9 A;  1Y44 A;  2YZ3 A;  2GFK A;  4Z60 A;  2NZF A;  4EFZ A;  2ZZI A;  3WXC A;  4GYQ A;  3I0V A;  2WYM C;  1QH3 A;  4AWZ A;  2XF4 A;  2FK6 A;  3BV6 A;  1X8H A;  2GKL A;  2NYP A;  4UBQ A;  4LE6 A;  3BC2 A;  2FU7 A;  1JJT A;  1WUP A;  2BTN A;  1VJN A;  2CFZ A;  5EV6 A;  2XR1 A;  3BK1 A;  1E5D A;  2Q9U A;  3A4Y A;  5LMC A;  2DOO A;  2QDS A;  3IE2 A;  4JO0 A;  4Z5Z A;  4TZE A;  2Y87 A;  1P9E A;  4UA4 A;  4GYU A;  3RKJ A;  5A0V A;  5LCH A;  2BGA A;  1KO2 A;  4Z5Y A;  5ACQ A;  4AV7 A;  4RM5 A;  5LM6 A;  4PVO A;  3AJ3 A;  4D02 A;  1YCG A;  3VPE A;  3SFP A;  4AX0 B;  5ACW A;  2CG2 A;  4D1U A;  2NZE A;  4J5F A;  5HIO A;  4Z6X A;  4GCW A;  3S0Z A;  5DPX A;  3KL7 A;  2BIB A;  3T3N A;  4KEQ A;  4U4L A;  4H0D A;  2CG3 A;  2CFU A;  5HH5 A;  3P2U A;  2WRS A;  2H6A A;  5K4N A;  1X8G A;  5ACU A;  4B87 A;  1KR3 A;  3SD9 A;  4NQ4 A;  2ZWR A;  4HKY A;  2P18 A;  2BMI A;  2DKF A;  2FHX B;  4J5H A;  2WYL A;  5AIJ A;  4BZ3 A;  2VW8 A;  5EVD A;  4FEK A;  1BC2 A;  3IDZ A;  4UWS B;  4C1E A;  5LE1 A;  4DIL A;  4WD6 A;  2P97 A;  3ESH A;  3L6N A;  2P1E A;  4Z67 A;  1A7T A;  2Q0I A;  4C1F A;  2YHE A;  4NQ5 A;  2M5D A;  1QH5 A;  4UAM A;  4UWP B;  3IE1 A;  2ZNB A;  4TZF A;  4CHL A;  2BR6 A;  1WRA A;  3PG4 A;  5LLD A;  4YSB A;  5LCF A;  3PY5 A;  4F6Z A;  5AHO A;  3ZR9 A;  2BFK A;  2YNV B;  5LCA A;  1JJE A;  5AHR A;  2BG7 A;  1DXK A;  3IEK A;  2YNT B;  2UYX A;  1YCH A;  4DIK A;  2QIN A;  3I14 A;  3X2Y A;  2OHH A;  4UWO B;  2YCB A;  5EV8 A;  4XWW A;  5HH6 A;  3ADR A;  3KNR A;  3ZWF A;  1KO3 A;  4YSL A;  5KIK A;  3TP9 A;  2YNT A;  3X30 A;  5EWA A;  3SPU A;  4EY2 A;  5A5Z A;  1X8I A;  1VME A;  5ACV A;  2FU8 A;  2Q42 A;  2FU6 A;  5ACX A;  4C1C A;  4C1G A;  3I13 A;  2HB9 A;  2FM6 A;  2GMN A;  4RL0 A;  4HL1 A;  4EYB A;  2QJS A;  3ZNB A;  3BK2 A;  3F9O A;  4UWR B;  5ACR A;  3MD7 A;  5HH4 A;  5B3R A;  5K4M A;  4FSB A;  4EYL A;  3RKK A;  2Y8A A;  5LS3 A;  4C1H A;  2YNW A;  3IOG A;  4EYF A;  5A23 A;  2FHX A;  4TZB A;  2WHG A;  4C1D A;  5EVK A;  3DH8 A;  2Y8B A;  3QH8 A;  1DD6 A;  5A87 A;  4HL2 A;  1WUO A;  2R2D A;  3FAI A;  2I7X A;  5LSC A;  3DHB A;  1SML A;  5AXO A;  5HIS A;  3IE0 A;  4EXS A;  1WW1 A;  3IEL A;  5ACP A;  5B15 A;  2GCU A;  4EXY A;  2NXA A;  5ACS A;  4D1V A;  2ZO4 A;  5HIQ A;  5A0T A;  4AX1 B;  3I15 A;  5K4K A;  5EVB A;  5EHT A;  5B1U A;  2AZ4 A;  3SRX A;  2I7T A;  1XTO A;  4ZEJ A;  1DDK A;  3I11 A;  2OHI A;  1K07 A;  5FQA A;  5AJL A;  3JXP A;  4RL2 A;  1MQO A;  4AD9 A;  4FR7 A;  3T9M A;  1VGN A;  3X2X A;  1ZKP A;  4KEP A;  4TYT A;  2BFZ A;  3T3O A;  2QED A;  4D1W A;  2E7Y A;  2OHJ A;  2BG2 A;  1A8T A; 
#chains in the Genus database with same CATH homology
 5IQK A;  3SW3 A;  3X2Z A;  4D1T A;  5AYA A;  3LVZ A;  5AEB A;  4RAM A;  1YCF A;  2QDT A;  5HIP A;  4V0H A;  3SBL A;  3AF5 A;  1M2X A;  2BFZ B;  3PY6 A;  4NQ6 A;  5KIL A;  4BP0 A;  4ZO2 A;  5FQB A;  4C09 A;  1ZNB A;  3G1P A;  2AIO A;  3IEM A;  4Z7R A;  2GFJ A;  5EW0 A;  2CBN A;  1XM8 A;  2A7M A;  1JT1 A;  2BC2 A;  4F6H A;  3AF6 A;  2BFL A;  4PVT A;  3DHA A;  2YNV A;  2I7V A;  4ZNB A;  3RPC A;  4YSK A;  3FCZ A;  2YNU A;  2P4Z A;  1HLK A;  3ZQ4 A;  4TZ9 A;  4AWY B;  1ZTC A;  3IOF A;  1BVT A;  2BG8 A;  4TYF A;  5FQC A;  2WYM A;  4RBS A;  3Q6V A;  3KNS A;  3VQZ A;  5ACT A;  3H3E A;  2BG6 A;  4RAW A;  2FU9 A;  2BG8 B;  5K0W A;  1L9Y A;  2Q0J A;  3R2U A;  4XUK A;  3DHC A;  4O98 A;  2M5C A;  1BMC A;  4XWT A;  4ZO3 A;  4NQ2 A;  4P62 A;  5AXR A;  5EH9 A;  1Y44 A;  2YZ3 A;  2GFK A;  4Z60 A;  2NZF A;  4EFZ A;  2ZZI A;  3WXC A;  4GYQ A;  3I0V A;  2WYM C;  1QH3 A;  4AWZ A;  2XF4 A;  2FK6 A;  3BV6 A;  1X8H A;  2GKL A;  2NYP A;  4UBQ A;  4LE6 A;  3BC2 A;  2FU7 A;  1JJT A;  1WUP A;  2BTN A;  1VJN A;  5EV6 A;  2XR1 A;  3BK1 A;  1E5D A;  2Q9U A;  3A4Y A;  5LMC A;  2DOO A;  2QDS A;  3IE2 A;  4JO0 A;  4Z5Z A;  4TZE A;  2Y87 A;  1P9E A;  4UA4 A;  4GYU A;  3RKJ A;  5A0V A;  5LCH A;  2BGA A;  1KO2 A;  4Z5Y A;  5ACQ A;  4RM5 A;  5LM6 A;  4PVO A;  3AJ3 A;  4D02 A;  1YCG A;  3VPE A;  3SFP A;  4AX0 B;  5ACW A;  4D1U A;  2NZE A;  4J5F A;  5HIO A;  4Z6X A;  4GCW A;  3S0Z A;  5DPX A;  3KL7 A;  2BIB A;  3T3N A;  4KEQ A;  4U4L A;  4H0D A;  5HH5 A;  3P2U A;  2WRS A;  2H6A A;  5K4N A;  1X8G A;  5ACU A;  4B87 A;  1KR3 A;  3SD9 A;  4NQ4 A;  2ZWR A;  4HKY A;  2P18 A;  2BMI A;  2DKF A;  2FHX B;  4J5H A;  2WYL A;  4BZ3 A;  2VW8 A;  5EVD A;  4FEK A;  1BC2 A;  3IDZ A;  4UWS B;  4C1E A;  5LE1 A;  4DIL A;  4WD6 A;  2P97 A;  3ESH A;  3L6N A;  2P1E A;  4Z67 A;  1A7T A;  2Q0I A;  4C1F A;  4NQ5 A;  2M5D A;  1QH5 A;  4UAM A;  4UWP B;  3IE1 A;  2ZNB A;  4TZF A;  4CHL A;  2BR6 A;  1WRA A;  3PG4 A;  5LLD A;  4YSB A;  5LCF A;  3PY5 A;  4F6Z A;  5AHO A;  3ZR9 A;  2BFK A;  2YNV B;  5LCA A;  1JJE A;  5AHR A;  2BG7 A;  1DXK A;  3IEK A;  2YNT B;  2UYX A;  1YCH A;  4DIK A;  2QIN A;  3I14 A;  3X2Y A;  2OHH A;  4UWO B;  2YCB A;  5EV8 A;  4XWW A;  5HH6 A;  3ADR A;  3KNR A;  3ZWF A;  1KO3 A;  4YSL A;  5KIK A;  3TP9 A;  2YNT A;  3X30 A;  5EWA A;  3SPU A;  4EY2 A;  5A5Z A;  1X8I A;  1VME A;  5ACV A;  2FU8 A;  2Q42 A;  2FU6 A;  5ACX A;  4C1C A;  4C1G A;  3I13 A;  2HB9 A;  2FM6 A;  2GMN A;  4RL0 A;  4HL1 A;  4EYB A;  2QJS A;  3ZNB A;  3BK2 A;  3F9O A;  4UWR B;  5ACR A;  3MD7 A;  5HH4 A;  5B3R A;  5K4M A;  4FSB A;  4EYL A;  3RKK A;  2Y8A A;  5LS3 A;  4C1H A;  2YNW A;  3IOG A;  4EYF A;  2FHX A;  4TZB A;  2WHG A;  4C1D A;  5EVK A;  3DH8 A;  2Y8B A;  3QH8 A;  1DD6 A;  5A87 A;  4HL2 A;  1WUO A;  2R2D A;  3FAI A;  2I7X A;  5LSC A;  3DHB A;  1SML A;  5AXO A;  5HIS A;  3IE0 A;  4EXS A;  1WW1 A;  3IEL A;  5ACP A;  5B15 A;  2GCU A;  4EXY A;  2NXA A;  5ACS A;  4D1V A;  2ZO4 A;  5HIQ A;  5A0T A;  4AX1 B;  3I15 A;  5K4K A;  5EVB A;  5EHT A;  5B1U A;  2AZ4 A;  3SRX A;  2I7T A;  1XTO A;  4ZEJ A;  1DDK A;  3I11 A;  2OHI A;  1K07 A;  5FQA A;  3JXP A;  4RL2 A;  1MQO A;  4AD9 A;  4FR7 A;  3T9M A;  1VGN A;  3X2X A;  1ZKP A;  4KEP A;  4TYT A;  2BFZ A;  3T3O A;  2QED A;  4D1W A;  2E7Y A;  2OHJ A;  2BG2 A;  1A8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...