3DHAA

An ultral high resolution structure of n-acyl homoserine lactone hydrolase with the product n-hexanoyl-l-homoserine bound at an alternative site
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
254
structure length
254
Chain Sequence
GRISMTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIETEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords N-Acyl Homoserine Lactone Hydrolase
publication title Mechanism of the quorum-quenching lactonase (AiiA) from Bacillus thuringiensis. 1. Product-bound structures.
pubmed doi rcsb
source organism Bacillus thuringiensis serovar kurstaki
total genus 80
structure length 254
sequence length 254
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2008-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3dhaA01
3T9MA 5HIQA 5A0VA 4RBSA 2ZWRA 5ACWA 5ACQA 4UAMA 2GCUA 2YNTA 3FCZA 2XR1A 1WUPA 5EV6A 4C09A 2ZNBA 2FU8A 5A0TA 3ZWFA 2YNVB 4RM5A 4EYFA 2GFKA 4C1GA 2Q0JA 1DXKA 4ZO2A 1MQOA 5ACTA 4TZFA 5EW0A 4D02A 4CHLA 2ZO4A 5LMCA 4GCWA 5A87A 1BMCA 2BMIA 4TYFA 5EHTA 2Y8AA 1DDKA 2NYPA 4FSBA 2P4ZA 5HH5A 4RAMA 1VMEA 2DOOA 4ZNBA 4NQ4A 3DH8A 4Z67A 3BK2A 5EWAA 2P97A 5EH9A 2FHXA 5B1UA 3SBLA 5FQAA 4RAWA 2GKLA 1WW1A 3KL7A 5B3RA 1ZNBA 3I13A 3SPUA 4KEPA 1L9YA 2R2DA 1DD6A 4UWRB 3R2UA 1WUOA 4J5FA 2WYMC 2DKFA 2BFKA 3SFPA 2WYMA 3SRXA 5ACXA 4C1CA 2BGAA 5ACUA 2Y8BA 5AHRA 5EVBA 5AHOA 2XF4A 5HH4A 5LCAA 5ACRA 4AWYB 5AEBA 2ZZIA 4HL2A 4HKYA 1SMLA 3BV6A 3DHAA 4UWPB 3IOFA 1ZTCA 2QDSA 3IDZA 2FHXB 1VJNA 2Y87A 2M5CA 2WHGA 2BG6A 5AYAA 5K0WA 2OHIA 3JXPA 3I0VA 1HLKA 1X8HA 5LSCA 4YSBA 3SD9A 2E7YA 4EFZA 3X2YA 3IE0A 3WXCA 3IEMA 1BVTA 4C1HA 2AZ4A 1P9EA 2H6AA 3ZNBA 2YNWA 4KEQA 5IQKA 4GYQA 5EVKA 1ZKPA 3TP9A 5B15A 1KR3A 2Q0IA 2BG2A 3P2UA 5HIPA 4RL0A 4Z5ZA 1X8IA 3LVZA 5KILA 3IE2A 2BFLA 3X30A 3ADRA 3ZQ4A 1WRAA 5LCHA 4EXSA 4UWOB 2VW8A 4P62A 3MD7A 1YCHA 2OHJA 4YSKA 4JO0A 2BG8A 4C1DA 1XM8A 2FU7A 3X2ZA 1KO2A 2YNTB 3H3EA 2FU6A 3L6NA 2NZEA 1YCFA 4PVTA 4UWSB 3I11A 3Q6VA 4Z7RA 5K4KA 5ACPA 3F9OA 3RPCA 2Q9UA 5HH6A 4C1FA 5HIOA 2BFZA 3RKKA 4BP0A 3DHBA 1XTOA 3RKJA 4D1TA 4Z6XA 4NQ2A 2M5DA 2OHHA 2YNUA 2YZ3A 3T3NA 3VQZA 4DIKA 2UYXA 4Z5YA 4C1EA 2AIOA 2NZFA 2GMNA 4EY2A 4U4LA 4XWWA 4UA4A 5K4NA 3S0ZA 4AWZA 3IEKA 2P18A 4LE6A 2A7MA 4B87A 2BG8B 2QEDA 4GYUA 2Q42A 1A7TA 4UBQA 4XWTA 2WYLA 4V0HA 4ZO3A 2CBNA 2YCBA 1JJEA 2FM6A 4EYLA 4TZ9A 2FK6A 3G1PA 2BG7A 1X8GA 5ACVA 1K07A 1KO3A 3AJ3A 4D1UA 3BK1A 2FU9A 3KNSA 4DILA 4H0DA 4RL2A 2BFZB 1JT1A 5EV8A 5KIKA 3ZR9A 3ESHA 4WD6A 1JJTA 5LCFA 5AXRA 3DHCA 2BR6A 2BTNA 2WRSA 2QDTA 4D1VA 4FEKA 4TZEA 3T3OA 2BC2A 4TZBA 5FQCA 5AXOA 3AF5A 3VPEA 3I15A 3QH8A 3SW3A 4D1WA 4F6ZA 1QH3A 3FAIA 3KNRA 5A5ZA 4EYBA 2GFJA 4F6HA 4Z60A 4EXYA 4FR7A 1Y44A 5FQBA 1A8TA 4AX0B 3BC2A 5LM6A 3A4YA 3PG4A 5ACSA 1M2XA 4AD9A 2YNVA 1QH5A 2I7VA 4TYTA 5LE1A 4XUKA 3IELA 1YCGA 3I14A 5LLDA 4PVOA 4BZ3A 1VGNA 2QJSA 1E5DA 3IOGA 3PY5A 2NXAA 4O98A 5LS3A 4NQ5A 5EVDA 5K4MA 4HL1A 4NQ6A 5DPXA 3IE1A 2P1EA 1BC2A 4YSLA 4AX1B 3PY6A 2BIBA 3X2XA 4ZEJA 5HISA 3AF6A 2I7TA 4J5HA 2I7XA 2QINA 2HB9A
chains in the Genus database with same CATH superfamily
3T9MA 5HIQA 5A0VA 4RBSA 2ZWRA 5ACWA 5ACQA 4UAMA 2GCUA 2YNTA 3FCZA 2XR1A 1WUPA 5EV6A 4C09A 2ZNBA 2FU8A 5A0TA 3ZWFA 2YNVB 4RM5A 4EYFA 2GFKA 4C1GA 2Q0JA 1DXKA 4ZO2A 1MQOA 5ACTA 4TZFA 5EW0A 4D02A 4CHLA 2ZO4A 5LMCA 4GCWA 5A87A 1BMCA 2BMIA 4TYFA 5EHTA 2Y8AA 1DDKA 2NYPA 4FSBA 2P4ZA 5HH5A 4RAMA 1VMEA 4PDXA 2DOOA 4ZNBA 4NQ4A 3DH8A 4Z67A 3BK2A 5EWAA 2P97A 5EH9A 2FHXA 5B1UA 3SBLA 5FQAA 4RAWA 2GKLA 1WW1A 3KL7A 5B3RA 1ZNBA 3I13A 3SPUA 4KEPA 1L9YA 2YHEA 2R2DA 1DD6A 4UWRB 3R2UA 1WUOA 4J5FA 2WYMC 5A23A 2DKFA 2BFKA 3SFPA 2WYMA 3SRXA 5ACXA 4C1CA 2BGAA 5ACUA 2Y8BA 5AHRA 5EVBA 5AHOA 2XF4A 5HH4A 5LCAA 5ACRA 4AWYB 5AEBA 2ZZIA 4HL2A 2CFZA 4HKYA 1SMLA 3BV6A 3DHAA 4UWPB 3IOFA 1ZTCA 2QDSA 3IDZA 2FHXB 1VJNA 2Y87A 2M5CA 2WHGA 2BG6A 5AYAA 5K0WA 2OHIA 3JXPA 3I0VA 1HLKA 1X8HA 5LSCA 4YSBA 3SD9A 2E7YA 4EFZA 3X2YA 3IE0A 3WXCA 3IEMA 1BVTA 4C1HA 2AZ4A 1P9EA 2H6AA 3ZNBA 2YNWA 4KEQA 5IQKA 4GYQA 5EVKA 1ZKPA 3TP9A 5B15A 1KR3A 2CFUA 2Q0IA 2BG2A 3P2UA 5HIPA 4RL0A 4Z5ZA 1X8IA 3LVZA 5KILA 3IE2A 2BFLA 3X30A 3ADRA 3ZQ4A 1WRAA 5LCHA 4EXSA 4UWOB 2VW8A 4P62A 3MD7A 1YCHA 2OHJA 4YSKA 4JO0A 2BG8A 4C1DA 1XM8A 2FU7A 3X2ZA 1KO2A 2YNTB 3H3EA 2FU6A 3L6NA 2NZEA 1YCFA 4PVTA 4UWSB 3I11A 3Q6VA 4Z7RA 5K4KA 5ACPA 3F9OA 5AJLA 3RPCA 2Q9UA 5HH6A 4C1FA 5HIOA 2BFZA 3RKKA 4BP0A 3DHBA 1XTOA 3RKJA 5AIJA 4D1TA 4Z6XA 4NQ2A 2M5DA 2OHHA 2YNUA 2YZ3A 3T3NA 3VQZA 4DIKA 2UYXA 4Z5YA 4C1EA 2AIOA 2NZFA 2GMNA 4EY2A 4U4LA 4XWWA 4UA4A 5K4NA 3S0ZA 4AWZA 3IEKA 2P18A 4LE6A 2A7MA 4B87A 2BG8B 2QEDA 4GYUA 2Q42A 1A7TA 4UBQA 4XWTA 2WYLA 4V0HA 4ZO3A 2CBNA 4NURA 2YCBA 1JJEA 2FM6A 4EYLA 4TZ9A 2FK6A 3G1PA 2BG7A 1X8GA 5ACVA 1K07A 1KO3A 3AJ3A 4D1UA 3BK1A 2FU9A 3KNSA 4H0DA 4DILA 4RL2A 2BFZB 1JT1A 5EV8A 5KIKA 3ZR9A 3ESHA 4WD6A 1JJTA 5LCFA 5AXRA 3DHCA 2BR6A 2BTNA 2WRSA 2QDTA 4D1VA 4FEKA 4TZEA 3T3OA 2BC2A 4TZBA 5FQCA 2CG3A 5AXOA 3AF5A 3VPEA 3I15A 3QH8A 3SW3A 4D1WA 4F6ZA 1QH3A 3FAIA 3KNRA 5A5ZA 4AV7A 4EYBA 2GFJA 4F6HA 4Z60A 4EXYA 4FR7A 1Y44A 5FQBA 1A8TA 4AX0B 3BC2A 5LM6A 3A4YA 3PG4A 5ACSA 1M2XA 4AD9A 2YNVA 1QH5A 2I7VA 4TYTA 5LE1A 4XUKA 3IELA 1YCGA 3I14A 5LLDA 4PVOA 4BZ3A 1VGNA 2QJSA 1E5DA 3IOGA 3PY5A 2NXAA 4O98A 5LS3A 4NQ5A 5EVDA 2CG2A 5K4MA 4HL1A 4NQ6A 5DPXA 3IE1A 2P1EA 1BC2A 4AXHA 4YSLA 4AX1B 3PY6A 2BIBA 3X2XA 4ZEJA 5HISA 3AF6A 2I7TA 4J5HA 2I7XA 2QINA 2HB9A
chains in the Genus database with same CATH topology
3T9MA 5HIQA 5A0VA 4RBSA 2ZWRA 5ACWA 5ACQA 4UAMA 2GCUA 2YNTA 3FCZA 2XR1A 1WUPA 5EV6A 4C09A 2ZNBA 2FU8A 5A0TA 3ZWFA 2YNVB 4RM5A 4EYFA 2GFKA 4C1GA 2Q0JA 1DXKA 4ZO2A 1MQOA 5ACTA 4TZFA 5EW0A 4D02A 4CHLA 2ZO4A 5LMCA 4GCWA 5A87A 1BMCA 2BMIA 4TYFA 5EHTA 2Y8AA 1DDKA 2NYPA 4FSBA 2P4ZA 5HH5A 4RAMA 1VMEA 2DOOA 4ZNBA 4NQ4A 3DH8A 4Z67A 3BK2A 5EWAA 2P97A 5EH9A 2FHXA 5B1UA 3SBLA 5FQAA 4RAWA 2GKLA 1WW1A 3KL7A 5B3RA 1ZNBA 3I13A 3SPUA 4KEPA 1L9YA 2R2DA 1DD6A 4UWRB 3R2UA 1WUOA 4J5FA 2WYMC 2DKFA 2BFKA 3SFPA 2WYMA 3SRXA 5ACXA 4C1CA 2BGAA 5ACUA 2Y8BA 5AHRA 5EVBA 5AHOA 2XF4A 5HH4A 5LCAA 5ACRA 4AWYB 5AEBA 2ZZIA 4HL2A 4HKYA 1SMLA 3BV6A 3DHAA 4UWPB 3IOFA 1ZTCA 2QDSA 3IDZA 2FHXB 1VJNA 2Y87A 2M5CA 2WHGA 2BG6A 5AYAA 5K0WA 2OHIA 3JXPA 3I0VA 1HLKA 1X8HA 5LSCA 4YSBA 3SD9A 2E7YA 4EFZA 3X2YA 3IE0A 3WXCA 3IEMA 1BVTA 4C1HA 2AZ4A 1P9EA 2H6AA 3ZNBA 2YNWA 4KEQA 5IQKA 4GYQA 5EVKA 1ZKPA 3TP9A 5B15A 1KR3A 2Q0IA 2BG2A 3P2UA 5HIPA 4RL0A 4Z5ZA 1X8IA 3LVZA 5KILA 3IE2A 2BFLA 3X30A 3ADRA 3ZQ4A 1WRAA 5LCHA 4EXSA 4UWOB 2VW8A 4P62A 3MD7A 1YCHA 2OHJA 4YSKA 4JO0A 2BG8A 4C1DA 1XM8A 2FU7A 3X2ZA 1KO2A 2YNTB 3H3EA 2FU6A 3L6NA 2NZEA 1YCFA 4PVTA 4UWSB 3I11A 3Q6VA 4Z7RA 5K4KA 5ACPA 3F9OA 3RPCA 2Q9UA 5HH6A 4C1FA 5HIOA 2BFZA 3RKKA 4BP0A 3DHBA 1XTOA 3RKJA 4D1TA 4Z6XA 4NQ2A 2M5DA 2OHHA 2YNUA 2YZ3A 3T3NA 3VQZA 4DIKA 2UYXA 4Z5YA 4C1EA 2AIOA 2NZFA 2GMNA 4EY2A 4U4LA 4XWWA 4UA4A 5K4NA 3S0ZA 4AWZA 3IEKA 2P18A 4LE6A 2A7MA 4B87A 2BG8B 2QEDA 4GYUA 2Q42A 1A7TA 4UBQA 4XWTA 2WYLA 4V0HA 4ZO3A 2CBNA 2YCBA 1JJEA 2FM6A 4EYLA 4TZ9A 2FK6A 3G1PA 2BG7A 1X8GA 5ACVA 1K07A 1KO3A 3AJ3A 4D1UA 3BK1A 2FU9A 3KNSA 4DILA 4H0DA 4RL2A 2BFZB 1JT1A 5EV8A 5KIKA 3ZR9A 3ESHA 4WD6A 1JJTA 5LCFA 5AXRA 3DHCA 2BR6A 2BTNA 2WRSA 2QDTA 4D1VA 4FEKA 4TZEA 3T3OA 2BC2A 4TZBA 5FQCA 5AXOA 3AF5A 3VPEA 3I15A 3QH8A 3SW3A 4D1WA 4F6ZA 1QH3A 3FAIA 3KNRA 5A5ZA 4EYBA 2GFJA 4F6HA 4Z60A 4EXYA 4FR7A 1Y44A 5FQBA 1A8TA 4AX0B 3BC2A 5LM6A 3A4YA 3PG4A 5ACSA 1M2XA 4AD9A 2YNVA 1QH5A 2I7VA 4TYTA 5LE1A 4XUKA 3IELA 1YCGA 3I14A 5LLDA 4PVOA 4BZ3A 1VGNA 2QJSA 1E5DA 3IOGA 3PY5A 2NXAA 4O98A 5LS3A 4NQ5A 5EVDA 5K4MA 4HL1A 4NQ6A 5DPXA 3IE1A 2P1EA 1BC2A 4YSLA 4AX1B 3PY6A 2BIBA 3X2XA 4ZEJA 5HISA 3AF6A 2I7TA 4J5HA 2I7XA 2QINA 2HB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T9M A;  5HIQ A;  5A0V A;  4RBS A;  2ZWR A;  5ACW A;  5ACQ A;  4UAM A;  2GCU A;  2YNT A;  3FCZ A;  2XR1 A;  1WUP A;  5EV6 A;  4C09 A;  2ZNB A;  2FU8 A;  5A0T A;  3ZWF A;  2YNV B;  4RM5 A;  4EYF A;  2GFK A;  4C1G A;  2Q0J A;  1DXK A;  4ZO2 A;  1MQO A;  5ACT A;  4TZF A;  5EW0 A;  4D02 A;  4CHL A;  2ZO4 A;  5LMC A;  4GCW A;  5A87 A;  1BMC A;  2BMI A;  4TYF A;  5EHT A;  2Y8A A;  1DDK A;  2NYP A;  4FSB A;  2P4Z A;  5HH5 A;  4RAM A;  1VME A;  2DOO A;  4ZNB A;  4NQ4 A;  3DH8 A;  4Z67 A;  3BK2 A;  5EWA A;  2P97 A;  5EH9 A;  2FHX A;  5B1U A;  3SBL A;  5FQA A;  4RAW A;  2GKL A;  1WW1 A;  3KL7 A;  5B3R A;  1ZNB A;  3I13 A;  3SPU A;  4KEP A;  1L9Y A;  2R2D A;  1DD6 A;  4UWR B;  3R2U A;  1WUO A;  4J5F A;  2WYM C;  2DKF A;  2BFK A;  3SFP A;  2WYM A;  3SRX A;  5ACX A;  4C1C A;  2BGA A;  5ACU A;  2Y8B A;  5AHR A;  5EVB A;  5AHO A;  2XF4 A;  5HH4 A;  5LCA A;  5ACR A;  4AWY B;  5AEB A;  2ZZI A;  4HL2 A;  4HKY A;  1SML A;  3BV6 A;  3DHA A;  4UWP B;  3IOF A;  1ZTC A;  2QDS A;  3IDZ A;  2FHX B;  1VJN A;  2Y87 A;  2M5C A;  2WHG A;  2BG6 A;  5AYA A;  5K0W A;  2OHI A;  3JXP A;  3I0V A;  1HLK A;  1X8H A;  5LSC A;  4YSB A;  3SD9 A;  2E7Y A;  4EFZ A;  3X2Y A;  3IE0 A;  3WXC A;  3IEM A;  1BVT A;  4C1H A;  2AZ4 A;  1P9E A;  2H6A A;  3ZNB A;  2YNW A;  4KEQ A;  5IQK A;  4GYQ A;  5EVK A;  1ZKP A;  3TP9 A;  5B15 A;  1KR3 A;  2Q0I A;  2BG2 A;  3P2U A;  5HIP A;  4RL0 A;  4Z5Z A;  1X8I A;  3LVZ A;  5KIL A;  3IE2 A;  2BFL A;  3X30 A;  3ADR A;  3ZQ4 A;  1WRA A;  5LCH A;  4EXS A;  4UWO B;  2VW8 A;  4P62 A;  3MD7 A;  1YCH A;  2OHJ A;  4YSK A;  4JO0 A;  2BG8 A;  4C1D A;  1XM8 A;  2FU7 A;  3X2Z A;  1KO2 A;  2YNT B;  3H3E A;  2FU6 A;  3L6N A;  2NZE A;  1YCF A;  4PVT A;  4UWS B;  3I11 A;  3Q6V A;  4Z7R A;  5K4K A;  5ACP A;  3F9O A;  3RPC A;  2Q9U A;  5HH6 A;  4C1F A;  5HIO A;  2BFZ A;  3RKK A;  4BP0 A;  3DHB A;  1XTO A;  3RKJ A;  4D1T A;  4Z6X A;  4NQ2 A;  2M5D A;  2OHH A;  2YNU A;  2YZ3 A;  3T3N A;  3VQZ A;  4DIK A;  2UYX A;  4Z5Y A;  4C1E A;  2AIO A;  2NZF A;  2GMN A;  4EY2 A;  4U4L A;  4XWW A;  4UA4 A;  5K4N A;  3S0Z A;  4AWZ A;  3IEK A;  2P18 A;  4LE6 A;  2A7M A;  4B87 A;  2BG8 B;  2QED A;  4GYU A;  2Q42 A;  1A7T A;  4UBQ A;  4XWT A;  2WYL A;  4V0H A;  4ZO3 A;  2CBN A;  2YCB A;  1JJE A;  2FM6 A;  4EYL A;  4TZ9 A;  2FK6 A;  3G1P A;  2BG7 A;  1X8G A;  5ACV A;  1K07 A;  1KO3 A;  3AJ3 A;  4D1U A;  3BK1 A;  2FU9 A;  3KNS A;  4DIL A;  4H0D A;  4RL2 A;  2BFZ B;  1JT1 A;  5EV8 A;  5KIK A;  3ZR9 A;  3ESH A;  4WD6 A;  1JJT A;  5LCF A;  5AXR A;  3DHC A;  2BR6 A;  2BTN A;  2WRS A;  2QDT A;  4D1V A;  4FEK A;  4TZE A;  3T3O A;  2BC2 A;  4TZB A;  5FQC A;  5AXO A;  3AF5 A;  3VPE A;  3I15 A;  3QH8 A;  3SW3 A;  4D1W A;  4F6Z A;  1QH3 A;  3FAI A;  3KNR A;  5A5Z A;  4EYB A;  2GFJ A;  4F6H A;  4Z60 A;  4EXY A;  4FR7 A;  1Y44 A;  5FQB A;  1A8T A;  4AX0 B;  3BC2 A;  5LM6 A;  3A4Y A;  3PG4 A;  5ACS A;  1M2X A;  4AD9 A;  2YNV A;  1QH5 A;  2I7V A;  4TYT A;  5LE1 A;  4XUK A;  3IEL A;  1YCG A;  3I14 A;  5LLD A;  4PVO A;  4BZ3 A;  1VGN A;  2QJS A;  1E5D A;  3IOG A;  3PY5 A;  2NXA A;  4O98 A;  5LS3 A;  4NQ5 A;  5EVD A;  5K4M A;  4HL1 A;  4NQ6 A;  5DPX A;  3IE1 A;  2P1E A;  1BC2 A;  4YSL A;  4AX1 B;  3PY6 A;  2BIB A;  3X2X A;  4ZEJ A;  5HIS A;  3AF6 A;  2I7T A;  4J5H A;  2I7X A;  2QIN A;  2HB9 A; 
#chains in the Genus database with same CATH topology
 3T9M A;  5HIQ A;  5A0V A;  4RBS A;  2ZWR A;  5ACW A;  5ACQ A;  4UAM A;  2GCU A;  2YNT A;  3FCZ A;  2XR1 A;  1WUP A;  5EV6 A;  4C09 A;  2ZNB A;  2FU8 A;  5A0T A;  3ZWF A;  2YNV B;  4RM5 A;  4EYF A;  2GFK A;  4C1G A;  2Q0J A;  1DXK A;  4ZO2 A;  1MQO A;  5ACT A;  4TZF A;  5EW0 A;  4D02 A;  4CHL A;  2ZO4 A;  5LMC A;  4GCW A;  5A87 A;  1BMC A;  2BMI A;  4TYF A;  5EHT A;  2Y8A A;  1DDK A;  2NYP A;  4FSB A;  2P4Z A;  5HH5 A;  4RAM A;  1VME A;  4PDX A;  2DOO A;  4ZNB A;  4NQ4 A;  3DH8 A;  4Z67 A;  3BK2 A;  5EWA A;  2P97 A;  5EH9 A;  2FHX A;  5B1U A;  3SBL A;  5FQA A;  4RAW A;  2GKL A;  1WW1 A;  3KL7 A;  5B3R A;  1ZNB A;  3I13 A;  3SPU A;  4KEP A;  1L9Y A;  2YHE A;  2R2D A;  1DD6 A;  4UWR B;  3R2U A;  1WUO A;  4J5F A;  2WYM C;  5A23 A;  2DKF A;  2BFK A;  3SFP A;  2WYM A;  3SRX A;  5ACX A;  4C1C A;  2BGA A;  5ACU A;  2Y8B A;  5AHR A;  5EVB A;  5AHO A;  2XF4 A;  5HH4 A;  5LCA A;  5ACR A;  4AWY B;  5AEB A;  2ZZI A;  4HL2 A;  2CFZ A;  4HKY A;  1SML A;  3BV6 A;  3DHA A;  4UWP B;  3IOF A;  1ZTC A;  2QDS A;  3IDZ A;  2FHX B;  1VJN A;  2Y87 A;  2M5C A;  2WHG A;  2BG6 A;  5AYA A;  5K0W A;  2OHI A;  3JXP A;  3I0V A;  1HLK A;  1X8H A;  5LSC A;  4YSB A;  3SD9 A;  2E7Y A;  4EFZ A;  3X2Y A;  3IE0 A;  3WXC A;  3IEM A;  1BVT A;  4C1H A;  2AZ4 A;  1P9E A;  2H6A A;  3ZNB A;  2YNW A;  4KEQ A;  5IQK A;  4GYQ A;  5EVK A;  1ZKP A;  3TP9 A;  5B15 A;  1KR3 A;  2CFU A;  2Q0I A;  2BG2 A;  3P2U A;  5HIP A;  4RL0 A;  4Z5Z A;  1X8I A;  3LVZ A;  5KIL A;  3IE2 A;  2BFL A;  3X30 A;  3ADR A;  3ZQ4 A;  1WRA A;  5LCH A;  4EXS A;  4UWO B;  2VW8 A;  4P62 A;  3MD7 A;  1YCH A;  2OHJ A;  4YSK A;  4JO0 A;  2BG8 A;  4C1D A;  1XM8 A;  2FU7 A;  3X2Z A;  1KO2 A;  2YNT B;  3H3E A;  2FU6 A;  3L6N A;  2NZE A;  1YCF A;  4PVT A;  4UWS B;  3I11 A;  3Q6V A;  4Z7R A;  5K4K A;  5ACP A;  3F9O A;  5AJL A;  3RPC A;  2Q9U A;  5HH6 A;  4C1F A;  5HIO A;  2BFZ A;  3RKK A;  4BP0 A;  3DHB A;  1XTO A;  3RKJ A;  5AIJ A;  4D1T A;  4Z6X A;  4NQ2 A;  2M5D A;  2OHH A;  2YNU A;  2YZ3 A;  3T3N A;  3VQZ A;  4DIK A;  2UYX A;  4Z5Y A;  4C1E A;  2AIO A;  2NZF A;  2GMN A;  4EY2 A;  4U4L A;  4XWW A;  4UA4 A;  5K4N A;  3S0Z A;  4AWZ A;  3IEK A;  2P18 A;  4LE6 A;  2A7M A;  4B87 A;  2BG8 B;  2QED A;  4GYU A;  2Q42 A;  1A7T A;  4UBQ A;  4XWT A;  2WYL A;  4V0H A;  4ZO3 A;  2CBN A;  4NUR A;  2YCB A;  1JJE A;  2FM6 A;  4EYL A;  4TZ9 A;  2FK6 A;  3G1P A;  2BG7 A;  1X8G A;  5ACV A;  1K07 A;  1KO3 A;  3AJ3 A;  4D1U A;  3BK1 A;  2FU9 A;  3KNS A;  4H0D A;  4DIL A;  4RL2 A;  2BFZ B;  1JT1 A;  5EV8 A;  5KIK A;  3ZR9 A;  3ESH A;  4WD6 A;  1JJT A;  5LCF A;  5AXR A;  3DHC A;  2BR6 A;  2BTN A;  2WRS A;  2QDT A;  4D1V A;  4FEK A;  4TZE A;  3T3O A;  2BC2 A;  4TZB A;  5FQC A;  2CG3 A;  5AXO A;  3AF5 A;  3VPE A;  3I15 A;  3QH8 A;  3SW3 A;  4D1W A;  4F6Z A;  1QH3 A;  3FAI A;  3KNR A;  5A5Z A;  4AV7 A;  4EYB A;  2GFJ A;  4F6H A;  4Z60 A;  4EXY A;  4FR7 A;  1Y44 A;  5FQB A;  1A8T A;  4AX0 B;  3BC2 A;  5LM6 A;  3A4Y A;  3PG4 A;  5ACS A;  1M2X A;  4AD9 A;  2YNV A;  1QH5 A;  2I7V A;  4TYT A;  5LE1 A;  4XUK A;  3IEL A;  1YCG A;  3I14 A;  5LLD A;  4PVO A;  4BZ3 A;  1VGN A;  2QJS A;  1E5D A;  3IOG A;  3PY5 A;  2NXA A;  4O98 A;  5LS3 A;  4NQ5 A;  5EVD A;  2CG2 A;  5K4M A;  4HL1 A;  4NQ6 A;  5DPX A;  3IE1 A;  2P1E A;  1BC2 A;  4AXH A;  4YSL A;  4AX1 B;  3PY6 A;  2BIB A;  3X2X A;  4ZEJ A;  5HIS A;  3AF6 A;  2I7T A;  4J5H A;  2I7X A;  2QIN A;  2HB9 A; 
#chains in the Genus database with same CATH homology
 3T9M A;  5HIQ A;  5A0V A;  4RBS A;  2ZWR A;  5ACW A;  5ACQ A;  4UAM A;  2GCU A;  2YNT A;  3FCZ A;  2XR1 A;  1WUP A;  5EV6 A;  4C09 A;  2ZNB A;  2FU8 A;  5A0T A;  3ZWF A;  2YNV B;  4RM5 A;  4EYF A;  2GFK A;  4C1G A;  2Q0J A;  1DXK A;  4ZO2 A;  1MQO A;  5ACT A;  4TZF A;  5EW0 A;  4D02 A;  4CHL A;  2ZO4 A;  5LMC A;  4GCW A;  5A87 A;  1BMC A;  2BMI A;  4TYF A;  5EHT A;  2Y8A A;  1DDK A;  2NYP A;  4FSB A;  2P4Z A;  5HH5 A;  4RAM A;  1VME A;  2DOO A;  4ZNB A;  4NQ4 A;  3DH8 A;  4Z67 A;  3BK2 A;  5EWA A;  2P97 A;  5EH9 A;  2FHX A;  5B1U A;  3SBL A;  5FQA A;  4RAW A;  2GKL A;  1WW1 A;  3KL7 A;  5B3R A;  1ZNB A;  3I13 A;  3SPU A;  4KEP A;  1L9Y A;  2R2D A;  1DD6 A;  4UWR B;  3R2U A;  1WUO A;  4J5F A;  2WYM C;  2DKF A;  2BFK A;  3SFP A;  2WYM A;  3SRX A;  5ACX A;  4C1C A;  2BGA A;  5ACU A;  2Y8B A;  5AHR A;  5EVB A;  5AHO A;  2XF4 A;  5HH4 A;  5LCA A;  5ACR A;  4AWY B;  5AEB A;  2ZZI A;  4HL2 A;  4HKY A;  1SML A;  3BV6 A;  3DHA A;  4UWP B;  3IOF A;  1ZTC A;  2QDS A;  3IDZ A;  2FHX B;  1VJN A;  2Y87 A;  2M5C A;  2WHG A;  2BG6 A;  5AYA A;  5K0W A;  2OHI A;  3JXP A;  3I0V A;  1HLK A;  1X8H A;  5LSC A;  4YSB A;  3SD9 A;  2E7Y A;  4EFZ A;  3X2Y A;  3IE0 A;  3WXC A;  3IEM A;  1BVT A;  4C1H A;  2AZ4 A;  1P9E A;  2H6A A;  3ZNB A;  2YNW A;  4KEQ A;  5IQK A;  4GYQ A;  5EVK A;  1ZKP A;  3TP9 A;  5B15 A;  1KR3 A;  2Q0I A;  2BG2 A;  3P2U A;  5HIP A;  4RL0 A;  4Z5Z A;  1X8I A;  3LVZ A;  5KIL A;  3IE2 A;  2BFL A;  3X30 A;  3ADR A;  3ZQ4 A;  1WRA A;  5LCH A;  4EXS A;  4UWO B;  2VW8 A;  4P62 A;  3MD7 A;  1YCH A;  2OHJ A;  4YSK A;  4JO0 A;  2BG8 A;  4C1D A;  1XM8 A;  2FU7 A;  3X2Z A;  1KO2 A;  2YNT B;  3H3E A;  2FU6 A;  3L6N A;  2NZE A;  1YCF A;  4PVT A;  4UWS B;  3I11 A;  3Q6V A;  4Z7R A;  5K4K A;  5ACP A;  3F9O A;  3RPC A;  2Q9U A;  5HH6 A;  4C1F A;  5HIO A;  2BFZ A;  3RKK A;  4BP0 A;  3DHB A;  1XTO A;  3RKJ A;  4D1T A;  4Z6X A;  4NQ2 A;  2M5D A;  2OHH A;  2YNU A;  2YZ3 A;  3T3N A;  3VQZ A;  4DIK A;  2UYX A;  4Z5Y A;  4C1E A;  2AIO A;  2NZF A;  2GMN A;  4EY2 A;  4U4L A;  4XWW A;  4UA4 A;  5K4N A;  3S0Z A;  4AWZ A;  3IEK A;  2P18 A;  4LE6 A;  2A7M A;  4B87 A;  2BG8 B;  2QED A;  4GYU A;  2Q42 A;  1A7T A;  4UBQ A;  4XWT A;  2WYL A;  4V0H A;  4ZO3 A;  2CBN A;  2YCB A;  1JJE A;  2FM6 A;  4EYL A;  4TZ9 A;  2FK6 A;  3G1P A;  2BG7 A;  1X8G A;  5ACV A;  1K07 A;  1KO3 A;  3AJ3 A;  4D1U A;  3BK1 A;  2FU9 A;  3KNS A;  4DIL A;  4H0D A;  4RL2 A;  2BFZ B;  1JT1 A;  5EV8 A;  5KIK A;  3ZR9 A;  3ESH A;  4WD6 A;  1JJT A;  5LCF A;  5AXR A;  3DHC A;  2BR6 A;  2BTN A;  2WRS A;  2QDT A;  4D1V A;  4FEK A;  4TZE A;  3T3O A;  2BC2 A;  4TZB A;  5FQC A;  5AXO A;  3AF5 A;  3VPE A;  3I15 A;  3QH8 A;  3SW3 A;  4D1W A;  4F6Z A;  1QH3 A;  3FAI A;  3KNR A;  5A5Z A;  4EYB A;  2GFJ A;  4F6H A;  4Z60 A;  4EXY A;  4FR7 A;  1Y44 A;  5FQB A;  1A8T A;  4AX0 B;  3BC2 A;  5LM6 A;  3A4Y A;  3PG4 A;  5ACS A;  1M2X A;  4AD9 A;  2YNV A;  1QH5 A;  2I7V A;  4TYT A;  5LE1 A;  4XUK A;  3IEL A;  1YCG A;  3I14 A;  5LLD A;  4PVO A;  4BZ3 A;  1VGN A;  2QJS A;  1E5D A;  3IOG A;  3PY5 A;  2NXA A;  4O98 A;  5LS3 A;  4NQ5 A;  5EVD A;  5K4M A;  4HL1 A;  4NQ6 A;  5DPX A;  3IE1 A;  2P1E A;  1BC2 A;  4YSL A;  4AX1 B;  3PY6 A;  2BIB A;  3X2X A;  4ZEJ A;  5HIS A;  3AF6 A;  2I7T A;  4J5H A;  2I7X A;  2QIN A;  2HB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...