3DHAA

An ultral high resolution structure of n-acyl homoserine lactone hydrolase with the product n-hexanoyl-l-homoserine bound at an alternative site
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
254
structure length
254
Chain Sequence
GRISMTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIETEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of the quorum-quenching lactonase (AiiA) from Bacillus thuringiensis. 1. Product-bound structures.
pubmed doi rcsb
source organism Bacillus thuringiensis serovar kurstaki
molecule tags Hydrolase
molecule keywords N-Acyl Homoserine Lactone Hydrolase
total genus 80
structure length 254
sequence length 254
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2008-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3dhaA01
4WD6A 1X8HA 1A8TA 2I7XA 1M2XA 1ZKPA 1DDKA 3SBLA 5EWAA 4TZBA 4U4LA 4UWRB 3ADRA 4V0HA 5B1UA 5K4MA 2UYXA 1JT1A 2QDSA 4C1HA 5ACWA 4DIKA 1YCGA 2R2DA 1WUOA 4D1WA 4EXSA 2NZFA 1SMLA 5EW0A 1E5DA 2ZZIA 3RKJA 5FQAA 1L9YA 5ACRA 3RKKA 4DILA 4UWPB 3BK1A 4YSLA 4H0DA 1VGNA 5FQBA 3IE1A 1XTOA 1VMEA 3IELA 5K4KA 1QH3A 2BG8B 3I13A 5HH4A 2QEDA 4UAMA 5AEBA 4C1GA 3F9OA 3X2XA 3QH8A 3DHBA 2Q0JA 2GKLA 5ACQA 5HISA 2BC2A 2WYLA 5EVDA 4Z5ZA 2P1EA 2XR1A 4AX0B 3AF5A 2WYMC 4RAMA 4UWSB 5EH9A 4EYFA 3IOFA 3DH8A 5B15A 2YCBA 5A5ZA 2BGAA 4CHLA 4GYQA 3I15A 5AYAA 1QH5A 2XF4A 4TZFA 2WYMA 1XM8A 1WRAA 3X2ZA 4P62A 2Q0IA 4FEKA 4XUKA 3JXPA 4FSBA 5AXRA 2AIOA 4RBSA 5HIQA 2YNVB 3T9MA 2BFZB 3T3OA 2BG6A 5IQKA 4TZ9A 4RL2A 5KILA 5HIPA 1KO2A 5LCFA 2P18A 4D1VA 4TYTA 4BP0A 3LVZA 2AZ4A 2BR6A 3P2UA 1ZTCA 4FR7A 4TZEA 2FU9A 4PVOA 3T3NA 3ESHA 4ZNBA 4NQ6A 4Z7RA 5K4NA 2I7TA 2NYPA 4C09A 5HH5A 3BK2A 2Y8AA 5EV6A 2GFKA 3BV6A 2BIBA 2BFZA 4J5FA 3SD9A 5LS3A 4Z60A 3H3EA 1VJNA 4ZO3A 2Y87A 1YCFA 4C1FA 5ACUA 1X8IA 5LM6A 3TP9A 2FU8A 2Q9UA 5LCAA 1BMCA 3KNSA 3SPUA 1P9EA 5AHOA 2ZNBA 3IE2A 5ACSA 5K0WA 3IOGA 2E7YA 2BG8A 5A0TA 2BFLA 2FHXB 2ZO4A 4ZEJA 5ACVA 2FHXA 3ZR9A 4UWOB 4BZ3A 4RM5A 3X30A 2OHIA 2Q42A 4EY2A 3G1PA 5EV8A 4EFZA 3KNRA 1JJEA 2FM6A 4UBQA 4XWWA 3BC2A 4GYUA 3IEMA 4NQ2A 5HIOA 2OHJA 4AD9A 5LLDA 2YNVA 2QDTA 2FK6A 5LSCA 4Z5YA 2HB9A 4RAWA 3S0ZA 4HL2A 3IE0A 4GCWA 1KR3A 1DXKA 1KO3A 1HLKA 2WHGA 2YZ3A 1WW1A 3ZNBA 2BMIA 3R2UA 3DHAA 1WUPA 4KEQA 4HL1A 1K07A 2FU7A 1BVTA 5AHRA 5DPXA 3IDZA 2YNTB 5B3RA 4EYBA 2DKFA 2NXAA 4AWZA 4JO0A 5HH6A 3I14A 4TYFA 4NQ5A 4O98A 3DHCA 1YCHA 4Z6XA 4ZO2A 2QINA 3MD7A 3FAIA 5A0VA 3PY5A 1ZNBA 2YNTA 1BC2A 5EVKA 3AJ3A 5A87A 5LCHA 4AWYB 2A7MA 4HKYA 5KIKA 2GCUA 3A4YA 4XWTA 1MQOA 4F6ZA 2BG2A 4C1EA 5EHTA 4RL0A 3VQZA 4D1UA 1Y44A 4B87A 5ACPA 1X8GA 2P4ZA 2BTNA 4EXYA 3FCZA 3I11A 1DD6A 4D02A 5LMCA 4F6HA 3PY6A 3X2YA 4Z67A 4PVTA 2BFKA 3IEKA 2M5DA 5AXOA 3KL7A 5FQCA 4J5HA 2FU6A 2DOOA 2BG7A 2M5CA 4D1TA 2P97A 3Q6VA 5EVBA 2YNWA 4LE6A 3PG4A 5ACXA 3ZQ4A 5ACTA 2GMNA 2VW8A 2WRSA 2NZEA 3WXCA 3AF6A 4YSKA 3L6NA 2OHHA 3RPCA 4UA4A 4AX1B 2Y8BA 3SRXA 3SFPA 2CBNA 4YSBA 2GFJA 1JJTA 2QJSA 4C1CA 2ZWRA 3I0VA 3VPEA 4EYLA 5LE1A 3ZWFA 2I7VA 2YNUA 4NQ4A 2H6AA 4C1DA 1A7TA 4KEPA 3SW3A
chains in the Genus database with same CATH superfamily
4WD6A 1X8HA 1A8TA 2I7XA 1M2XA 1ZKPA 1DDKA 3SBLA 5EWAA 4TZBA 4U4LA 4UWRB 3ADRA 4V0HA 5B1UA 5K4MA 2UYXA 1JT1A 2QDSA 4C1HA 5ACWA 4DIKA 1YCGA 2R2DA 1WUOA 4D1WA 4EXSA 2NZFA 1SMLA 5EW0A 1E5DA 2ZZIA 3RKJA 4NURA 5FQAA 1L9YA 5ACRA 3RKKA 4DILA 4UWPB 5AJLA 3BK1A 4YSLA 4H0DA 1VGNA 5FQBA 3IE1A 1XTOA 1VMEA 3IELA 5K4KA 1QH3A 2BG8B 3I13A 5HH4A 2QEDA 4UAMA 5AEBA 4C1GA 3F9OA 3X2XA 3QH8A 3DHBA 2Q0JA 2GKLA 5ACQA 5HISA 2BC2A 2WYLA 5EVDA 4Z5ZA 2P1EA 2XR1A 4AX0B 3AF5A 2WYMC 4RAMA 4UWSB 5EH9A 4EYFA 3IOFA 3DH8A 5B15A 2YCBA 5A5ZA 2BGAA 4CHLA 4GYQA 3I15A 5AYAA 1QH5A 2XF4A 5A23A 4TZFA 2WYMA 1XM8A 1WRAA 3X2ZA 4P62A 2Q0IA 4FEKA 4XUKA 3JXPA 4FSBA 5AXRA 2AIOA 4RBSA 5HIQA 2YNVB 3T9MA 2BFZB 3T3OA 2BG6A 5IQKA 4TZ9A 4RL2A 5KILA 5HIPA 1KO2A 5LCFA 2CG2A 5AIJA 2P18A 4D1VA 4TYTA 4BP0A 3LVZA 2AZ4A 2BR6A 3P2UA 1ZTCA 4FR7A 4TZEA 2FU9A 4PVOA 3T3NA 3ESHA 4ZNBA 4NQ6A 4Z7RA 2CG3A 5K4NA 2I7TA 2NYPA 4C09A 5HH5A 3BK2A 2Y8AA 5EV6A 2GFKA 2YHEA 3BV6A 2BIBA 2BFZA 4J5FA 3SD9A 5LS3A 4Z60A 3H3EA 1VJNA 4ZO3A 2Y87A 4PDXA 1YCFA 4C1FA 5ACUA 1X8IA 5LM6A 3TP9A 2FU8A 2Q9UA 5LCAA 1BMCA 3KNSA 3SPUA 1P9EA 5AHOA 2ZNBA 3IE2A 5ACSA 5K0WA 3IOGA 2E7YA 2BG8A 5A0TA 2BFLA 2FHXB 2ZO4A 4ZEJA 5ACVA 2FHXA 3ZR9A 4UWOB 4AXHA 4BZ3A 4RM5A 3X30A 2OHIA 2Q42A 4EY2A 3G1PA 5EV8A 4EFZA 3KNRA 1JJEA 2FM6A 4UBQA 4XWWA 3BC2A 4GYUA 3IEMA 4NQ2A 5HIOA 2OHJA 4AD9A 5LLDA 2YNVA 2QDTA 2FK6A 5LSCA 4Z5YA 2HB9A 4RAWA 3S0ZA 4HL2A 3IE0A 4GCWA 1KR3A 1DXKA 1KO3A 1HLKA 2WHGA 2YZ3A 1WW1A 3ZNBA 2BMIA 3R2UA 3DHAA 1WUPA 4KEQA 4HL1A 1K07A 2FU7A 1BVTA 5AHRA 5DPXA 3IDZA 2YNTB 5B3RA 4EYBA 2DKFA 2NXAA 4AWZA 4JO0A 5HH6A 3I14A 4TYFA 4NQ5A 4O98A 3DHCA 1YCHA 4Z6XA 4ZO2A 2QINA 3MD7A 3FAIA 5A0VA 3PY5A 1ZNBA 2YNTA 1BC2A 5EVKA 3AJ3A 5A87A 5LCHA 4AWYB 2A7MA 4HKYA 5KIKA 2GCUA 3A4YA 4XWTA 1MQOA 4F6ZA 2BG2A 4C1EA 5EHTA 4RL0A 3VQZA 4D1UA 1Y44A 4B87A 5ACPA 1X8GA 2P4ZA 2BTNA 4EXYA 3FCZA 3I11A 1DD6A 4D02A 5LMCA 4F6HA 3PY6A 3X2YA 4AV7A 4Z67A 4PVTA 2BFKA 3IEKA 2M5DA 5AXOA 3KL7A 5FQCA 4J5HA 2FU6A 2DOOA 2BG7A 2M5CA 4D1TA 2P97A 3Q6VA 5EVBA 2YNWA 4LE6A 3PG4A 5ACXA 3ZQ4A 5ACTA 2GMNA 2VW8A 2WRSA 2NZEA 3WXCA 3AF6A 4YSKA 3L6NA 2OHHA 3RPCA 4UA4A 4AX1B 2Y8BA 3SRXA 3SFPA 2CBNA 4YSBA 2GFJA 4C1CA 1JJTA 2CFZA 2QJSA 2ZWRA 3I0VA 3VPEA 4EYLA 5LE1A 3ZWFA 2I7VA 2CFUA 2YNUA 4NQ4A 2H6AA 4C1DA 1A7TA 4KEPA 3SW3A
chains in the Genus database with same CATH topology
4WD6A 1X8HA 1A8TA 2I7XA 1M2XA 1ZKPA 1DDKA 3SBLA 5EWAA 4TZBA 4U4LA 4UWRB 3ADRA 4V0HA 5B1UA 5K4MA 2UYXA 1JT1A 2QDSA 4C1HA 5ACWA 4DIKA 1YCGA 2R2DA 1WUOA 4D1WA 4EXSA 2NZFA 1SMLA 5EW0A 1E5DA 2ZZIA 3RKJA 5FQAA 1L9YA 5ACRA 3RKKA 4DILA 4UWPB 3BK1A 4YSLA 4H0DA 1VGNA 5FQBA 3IE1A 1XTOA 1VMEA 3IELA 5K4KA 1QH3A 2BG8B 3I13A 5HH4A 2QEDA 4UAMA 5AEBA 4C1GA 3F9OA 3X2XA 3QH8A 3DHBA 2Q0JA 2GKLA 5ACQA 5HISA 2BC2A 2WYLA 5EVDA 4Z5ZA 2P1EA 2XR1A 4AX0B 3AF5A 2WYMC 4RAMA 4UWSB 5EH9A 4EYFA 3IOFA 3DH8A 5B15A 2YCBA 5A5ZA 2BGAA 4CHLA 4GYQA 3I15A 5AYAA 1QH5A 2XF4A 4TZFA 2WYMA 1XM8A 1WRAA 3X2ZA 4P62A 2Q0IA 4FEKA 4XUKA 3JXPA 4FSBA 5AXRA 2AIOA 4RBSA 5HIQA 2YNVB 3T9MA 2BFZB 3T3OA 2BG6A 5IQKA 4TZ9A 4RL2A 5KILA 5HIPA 1KO2A 5LCFA 2P18A 4D1VA 4TYTA 4BP0A 3LVZA 2AZ4A 2BR6A 3P2UA 1ZTCA 4FR7A 4TZEA 2FU9A 4PVOA 3T3NA 3ESHA 4ZNBA 4NQ6A 4Z7RA 5K4NA 2I7TA 2NYPA 4C09A 5HH5A 3BK2A 2Y8AA 5EV6A 2GFKA 3BV6A 2BIBA 2BFZA 4J5FA 3SD9A 5LS3A 4Z60A 3H3EA 1VJNA 4ZO3A 2Y87A 1YCFA 4C1FA 5ACUA 1X8IA 5LM6A 3TP9A 2FU8A 2Q9UA 5LCAA 1BMCA 3KNSA 3SPUA 1P9EA 5AHOA 2ZNBA 3IE2A 5ACSA 5K0WA 3IOGA 2E7YA 2BG8A 5A0TA 2BFLA 2FHXB 2ZO4A 4ZEJA 5ACVA 2FHXA 3ZR9A 4UWOB 4BZ3A 4RM5A 3X30A 2OHIA 2Q42A 4EY2A 3G1PA 5EV8A 4EFZA 3KNRA 1JJEA 2FM6A 4UBQA 4XWWA 3BC2A 4GYUA 3IEMA 4NQ2A 5HIOA 2OHJA 4AD9A 5LLDA 2YNVA 2QDTA 2FK6A 5LSCA 4Z5YA 2HB9A 4RAWA 3S0ZA 4HL2A 3IE0A 4GCWA 1KR3A 1DXKA 1KO3A 1HLKA 2WHGA 2YZ3A 1WW1A 3ZNBA 2BMIA 3R2UA 3DHAA 1WUPA 4KEQA 4HL1A 1K07A 2FU7A 1BVTA 5AHRA 5DPXA 3IDZA 2YNTB 5B3RA 4EYBA 2DKFA 2NXAA 4AWZA 4JO0A 5HH6A 3I14A 4TYFA 4NQ5A 4O98A 3DHCA 1YCHA 4Z6XA 4ZO2A 2QINA 3MD7A 3FAIA 5A0VA 3PY5A 1ZNBA 2YNTA 1BC2A 5EVKA 3AJ3A 5A87A 5LCHA 4AWYB 2A7MA 4HKYA 5KIKA 2GCUA 3A4YA 4XWTA 1MQOA 4F6ZA 2BG2A 4C1EA 5EHTA 4RL0A 3VQZA 4D1UA 1Y44A 4B87A 5ACPA 1X8GA 2P4ZA 2BTNA 4EXYA 3FCZA 3I11A 1DD6A 4D02A 5LMCA 4F6HA 3PY6A 3X2YA 4Z67A 4PVTA 2BFKA 3IEKA 2M5DA 5AXOA 3KL7A 5FQCA 4J5HA 2FU6A 2DOOA 2BG7A 2M5CA 4D1TA 2P97A 3Q6VA 5EVBA 2YNWA 4LE6A 3PG4A 5ACXA 3ZQ4A 5ACTA 2GMNA 2VW8A 2WRSA 2NZEA 3WXCA 3AF6A 4YSKA 3L6NA 2OHHA 3RPCA 4UA4A 4AX1B 2Y8BA 3SRXA 3SFPA 2CBNA 4YSBA 2GFJA 1JJTA 2QJSA 4C1CA 2ZWRA 3I0VA 3VPEA 4EYLA 5LE1A 3ZWFA 2I7VA 2YNUA 4NQ4A 2H6AA 4C1DA 1A7TA 4KEPA 3SW3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WD6 A;  1X8H A;  1A8T A;  2I7X A;  1M2X A;  1ZKP A;  1DDK A;  3SBL A;  5EWA A;  4TZB A;  4U4L A;  4UWR B;  3ADR A;  4V0H A;  5B1U A;  5K4M A;  2UYX A;  1JT1 A;  2QDS A;  4C1H A;  5ACW A;  4DIK A;  1YCG A;  2R2D A;  1WUO A;  4D1W A;  4EXS A;  2NZF A;  1SML A;  5EW0 A;  1E5D A;  2ZZI A;  3RKJ A;  5FQA A;  1L9Y A;  5ACR A;  3RKK A;  4DIL A;  4UWP B;  3BK1 A;  4YSL A;  4H0D A;  1VGN A;  5FQB A;  3IE1 A;  1XTO A;  1VME A;  3IEL A;  5K4K A;  1QH3 A;  2BG8 B;  3I13 A;  5HH4 A;  2QED A;  4UAM A;  5AEB A;  4C1G A;  3F9O A;  3X2X A;  3QH8 A;  3DHB A;  2Q0J A;  2GKL A;  5ACQ A;  5HIS A;  2BC2 A;  2WYL A;  5EVD A;  4Z5Z A;  2P1E A;  2XR1 A;  4AX0 B;  3AF5 A;  2WYM C;  4RAM A;  4UWS B;  5EH9 A;  4EYF A;  3IOF A;  3DH8 A;  5B15 A;  2YCB A;  5A5Z A;  2BGA A;  4CHL A;  4GYQ A;  3I15 A;  5AYA A;  1QH5 A;  2XF4 A;  4TZF A;  2WYM A;  1XM8 A;  1WRA A;  3X2Z A;  4P62 A;  2Q0I A;  4FEK A;  4XUK A;  3JXP A;  4FSB A;  5AXR A;  2AIO A;  4RBS A;  5HIQ A;  2YNV B;  3T9M A;  2BFZ B;  3T3O A;  2BG6 A;  5IQK A;  4TZ9 A;  4RL2 A;  5KIL A;  5HIP A;  1KO2 A;  5LCF A;  2P18 A;  4D1V A;  4TYT A;  4BP0 A;  3LVZ A;  2AZ4 A;  2BR6 A;  3P2U A;  1ZTC A;  4FR7 A;  4TZE A;  2FU9 A;  4PVO A;  3T3N A;  3ESH A;  4ZNB A;  4NQ6 A;  4Z7R A;  5K4N A;  2I7T A;  2NYP A;  4C09 A;  5HH5 A;  3BK2 A;  2Y8A A;  5EV6 A;  2GFK A;  3BV6 A;  2BIB A;  2BFZ A;  4J5F A;  3SD9 A;  5LS3 A;  4Z60 A;  3H3E A;  1VJN A;  4ZO3 A;  2Y87 A;  1YCF A;  4C1F A;  5ACU A;  1X8I A;  5LM6 A;  3TP9 A;  2FU8 A;  2Q9U A;  5LCA A;  1BMC A;  3KNS A;  3SPU A;  1P9E A;  5AHO A;  2ZNB A;  3IE2 A;  5ACS A;  5K0W A;  3IOG A;  2E7Y A;  2BG8 A;  5A0T A;  2BFL A;  2FHX B;  2ZO4 A;  4ZEJ A;  5ACV A;  2FHX A;  3ZR9 A;  4UWO B;  4BZ3 A;  4RM5 A;  3X30 A;  2OHI A;  2Q42 A;  4EY2 A;  3G1P A;  5EV8 A;  4EFZ A;  3KNR A;  1JJE A;  2FM6 A;  4UBQ A;  4XWW A;  3BC2 A;  4GYU A;  3IEM A;  4NQ2 A;  5HIO A;  2OHJ A;  4AD9 A;  5LLD A;  2YNV A;  2QDT A;  2FK6 A;  5LSC A;  4Z5Y A;  2HB9 A;  4RAW A;  3S0Z A;  4HL2 A;  3IE0 A;  4GCW A;  1KR3 A;  1DXK A;  1KO3 A;  1HLK A;  2WHG A;  2YZ3 A;  1WW1 A;  3ZNB A;  2BMI A;  3R2U A;  3DHA A;  1WUP A;  4KEQ A;  4HL1 A;  1K07 A;  2FU7 A;  1BVT A;  5AHR A;  5DPX A;  3IDZ A;  2YNT B;  5B3R A;  4EYB A;  2DKF A;  2NXA A;  4AWZ A;  4JO0 A;  5HH6 A;  3I14 A;  4TYF A;  4NQ5 A;  4O98 A;  3DHC A;  1YCH A;  4Z6X A;  4ZO2 A;  2QIN A;  3MD7 A;  3FAI A;  5A0V A;  3PY5 A;  1ZNB A;  2YNT A;  1BC2 A;  5EVK A;  3AJ3 A;  5A87 A;  5LCH A;  4AWY B;  2A7M A;  4HKY A;  5KIK A;  2GCU A;  3A4Y A;  4XWT A;  1MQO A;  4F6Z A;  2BG2 A;  4C1E A;  5EHT A;  4RL0 A;  3VQZ A;  4D1U A;  1Y44 A;  4B87 A;  5ACP A;  1X8G A;  2P4Z A;  2BTN A;  4EXY A;  3FCZ A;  3I11 A;  1DD6 A;  4D02 A;  5LMC A;  4F6H A;  3PY6 A;  3X2Y A;  4Z67 A;  4PVT A;  2BFK A;  3IEK A;  2M5D A;  5AXO A;  3KL7 A;  5FQC A;  4J5H A;  2FU6 A;  2DOO A;  2BG7 A;  2M5C A;  4D1T A;  2P97 A;  3Q6V A;  5EVB A;  2YNW A;  4LE6 A;  3PG4 A;  5ACX A;  3ZQ4 A;  5ACT A;  2GMN A;  2VW8 A;  2WRS A;  2NZE A;  3WXC A;  3AF6 A;  4YSK A;  3L6N A;  2OHH A;  3RPC A;  4UA4 A;  4AX1 B;  2Y8B A;  3SRX A;  3SFP A;  2CBN A;  4YSB A;  2GFJ A;  1JJT A;  2QJS A;  4C1C A;  2ZWR A;  3I0V A;  3VPE A;  4EYL A;  5LE1 A;  3ZWF A;  2I7V A;  2YNU A;  4NQ4 A;  2H6A A;  4C1D A;  1A7T A;  4KEP A;  3SW3 A; 
#chains in the Genus database with same CATH topology
 4WD6 A;  1X8H A;  1A8T A;  2I7X A;  1M2X A;  1ZKP A;  1DDK A;  3SBL A;  5EWA A;  4TZB A;  4U4L A;  4UWR B;  3ADR A;  4V0H A;  5B1U A;  5K4M A;  2UYX A;  1JT1 A;  2QDS A;  4C1H A;  5ACW A;  4DIK A;  1YCG A;  2R2D A;  1WUO A;  4D1W A;  4EXS A;  2NZF A;  1SML A;  5EW0 A;  1E5D A;  2ZZI A;  3RKJ A;  4NUR A;  5FQA A;  1L9Y A;  5ACR A;  3RKK A;  4DIL A;  4UWP B;  5AJL A;  3BK1 A;  4YSL A;  4H0D A;  1VGN A;  5FQB A;  3IE1 A;  1XTO A;  1VME A;  3IEL A;  5K4K A;  1QH3 A;  2BG8 B;  3I13 A;  5HH4 A;  2QED A;  4UAM A;  5AEB A;  4C1G A;  3F9O A;  3X2X A;  3QH8 A;  3DHB A;  2Q0J A;  2GKL A;  5ACQ A;  5HIS A;  2BC2 A;  2WYL A;  5EVD A;  4Z5Z A;  2P1E A;  2XR1 A;  4AX0 B;  3AF5 A;  2WYM C;  4RAM A;  4UWS B;  5EH9 A;  4EYF A;  3IOF A;  3DH8 A;  5B15 A;  2YCB A;  5A5Z A;  2BGA A;  4CHL A;  4GYQ A;  3I15 A;  5AYA A;  1QH5 A;  2XF4 A;  5A23 A;  4TZF A;  2WYM A;  1XM8 A;  1WRA A;  3X2Z A;  4P62 A;  2Q0I A;  4FEK A;  4XUK A;  3JXP A;  4FSB A;  5AXR A;  2AIO A;  4RBS A;  5HIQ A;  2YNV B;  3T9M A;  2BFZ B;  3T3O A;  2BG6 A;  5IQK A;  4TZ9 A;  4RL2 A;  5KIL A;  5HIP A;  1KO2 A;  5LCF A;  2CG2 A;  5AIJ A;  2P18 A;  4D1V A;  4TYT A;  4BP0 A;  3LVZ A;  2AZ4 A;  2BR6 A;  3P2U A;  1ZTC A;  4FR7 A;  4TZE A;  2FU9 A;  4PVO A;  3T3N A;  3ESH A;  4ZNB A;  4NQ6 A;  4Z7R A;  2CG3 A;  5K4N A;  2I7T A;  2NYP A;  4C09 A;  5HH5 A;  3BK2 A;  2Y8A A;  5EV6 A;  2GFK A;  2YHE A;  3BV6 A;  2BIB A;  2BFZ A;  4J5F A;  3SD9 A;  5LS3 A;  4Z60 A;  3H3E A;  1VJN A;  4ZO3 A;  2Y87 A;  4PDX A;  1YCF A;  4C1F A;  5ACU A;  1X8I A;  5LM6 A;  3TP9 A;  2FU8 A;  2Q9U A;  5LCA A;  1BMC A;  3KNS A;  3SPU A;  1P9E A;  5AHO A;  2ZNB A;  3IE2 A;  5ACS A;  5K0W A;  3IOG A;  2E7Y A;  2BG8 A;  5A0T A;  2BFL A;  2FHX B;  2ZO4 A;  4ZEJ A;  5ACV A;  2FHX A;  3ZR9 A;  4UWO B;  4AXH A;  4BZ3 A;  4RM5 A;  3X30 A;  2OHI A;  2Q42 A;  4EY2 A;  3G1P A;  5EV8 A;  4EFZ A;  3KNR A;  1JJE A;  2FM6 A;  4UBQ A;  4XWW A;  3BC2 A;  4GYU A;  3IEM A;  4NQ2 A;  5HIO A;  2OHJ A;  4AD9 A;  5LLD A;  2YNV A;  2QDT A;  2FK6 A;  5LSC A;  4Z5Y A;  2HB9 A;  4RAW A;  3S0Z A;  4HL2 A;  3IE0 A;  4GCW A;  1KR3 A;  1DXK A;  1KO3 A;  1HLK A;  2WHG A;  2YZ3 A;  1WW1 A;  3ZNB A;  2BMI A;  3R2U A;  3DHA A;  1WUP A;  4KEQ A;  4HL1 A;  1K07 A;  2FU7 A;  1BVT A;  5AHR A;  5DPX A;  3IDZ A;  2YNT B;  5B3R A;  4EYB A;  2DKF A;  2NXA A;  4AWZ A;  4JO0 A;  5HH6 A;  3I14 A;  4TYF A;  4NQ5 A;  4O98 A;  3DHC A;  1YCH A;  4Z6X A;  4ZO2 A;  2QIN A;  3MD7 A;  3FAI A;  5A0V A;  3PY5 A;  1ZNB A;  2YNT A;  1BC2 A;  5EVK A;  3AJ3 A;  5A87 A;  5LCH A;  4AWY B;  2A7M A;  4HKY A;  5KIK A;  2GCU A;  3A4Y A;  4XWT A;  1MQO A;  4F6Z A;  2BG2 A;  4C1E A;  5EHT A;  4RL0 A;  3VQZ A;  4D1U A;  1Y44 A;  4B87 A;  5ACP A;  1X8G A;  2P4Z A;  2BTN A;  4EXY A;  3FCZ A;  3I11 A;  1DD6 A;  4D02 A;  5LMC A;  4F6H A;  3PY6 A;  3X2Y A;  4AV7 A;  4Z67 A;  4PVT A;  2BFK A;  3IEK A;  2M5D A;  5AXO A;  3KL7 A;  5FQC A;  4J5H A;  2FU6 A;  2DOO A;  2BG7 A;  2M5C A;  4D1T A;  2P97 A;  3Q6V A;  5EVB A;  2YNW A;  4LE6 A;  3PG4 A;  5ACX A;  3ZQ4 A;  5ACT A;  2GMN A;  2VW8 A;  2WRS A;  2NZE A;  3WXC A;  3AF6 A;  4YSK A;  3L6N A;  2OHH A;  3RPC A;  4UA4 A;  4AX1 B;  2Y8B A;  3SRX A;  3SFP A;  2CBN A;  4YSB A;  2GFJ A;  4C1C A;  1JJT A;  2CFZ A;  2QJS A;  2ZWR A;  3I0V A;  3VPE A;  4EYL A;  5LE1 A;  3ZWF A;  2I7V A;  2CFU A;  2YNU A;  4NQ4 A;  2H6A A;  4C1D A;  1A7T A;  4KEP A;  3SW3 A; 
#chains in the Genus database with same CATH homology
 4WD6 A;  1X8H A;  1A8T A;  2I7X A;  1M2X A;  1ZKP A;  1DDK A;  3SBL A;  5EWA A;  4TZB A;  4U4L A;  4UWR B;  3ADR A;  4V0H A;  5B1U A;  5K4M A;  2UYX A;  1JT1 A;  2QDS A;  4C1H A;  5ACW A;  4DIK A;  1YCG A;  2R2D A;  1WUO A;  4D1W A;  4EXS A;  2NZF A;  1SML A;  5EW0 A;  1E5D A;  2ZZI A;  3RKJ A;  5FQA A;  1L9Y A;  5ACR A;  3RKK A;  4DIL A;  4UWP B;  3BK1 A;  4YSL A;  4H0D A;  1VGN A;  5FQB A;  3IE1 A;  1XTO A;  1VME A;  3IEL A;  5K4K A;  1QH3 A;  2BG8 B;  3I13 A;  5HH4 A;  2QED A;  4UAM A;  5AEB A;  4C1G A;  3F9O A;  3X2X A;  3QH8 A;  3DHB A;  2Q0J A;  2GKL A;  5ACQ A;  5HIS A;  2BC2 A;  2WYL A;  5EVD A;  4Z5Z A;  2P1E A;  2XR1 A;  4AX0 B;  3AF5 A;  2WYM C;  4RAM A;  4UWS B;  5EH9 A;  4EYF A;  3IOF A;  3DH8 A;  5B15 A;  2YCB A;  5A5Z A;  2BGA A;  4CHL A;  4GYQ A;  3I15 A;  5AYA A;  1QH5 A;  2XF4 A;  4TZF A;  2WYM A;  1XM8 A;  1WRA A;  3X2Z A;  4P62 A;  2Q0I A;  4FEK A;  4XUK A;  3JXP A;  4FSB A;  5AXR A;  2AIO A;  4RBS A;  5HIQ A;  2YNV B;  3T9M A;  2BFZ B;  3T3O A;  2BG6 A;  5IQK A;  4TZ9 A;  4RL2 A;  5KIL A;  5HIP A;  1KO2 A;  5LCF A;  2P18 A;  4D1V A;  4TYT A;  4BP0 A;  3LVZ A;  2AZ4 A;  2BR6 A;  3P2U A;  1ZTC A;  4FR7 A;  4TZE A;  2FU9 A;  4PVO A;  3T3N A;  3ESH A;  4ZNB A;  4NQ6 A;  4Z7R A;  5K4N A;  2I7T A;  2NYP A;  4C09 A;  5HH5 A;  3BK2 A;  2Y8A A;  5EV6 A;  2GFK A;  3BV6 A;  2BIB A;  2BFZ A;  4J5F A;  3SD9 A;  5LS3 A;  4Z60 A;  3H3E A;  1VJN A;  4ZO3 A;  2Y87 A;  1YCF A;  4C1F A;  5ACU A;  1X8I A;  5LM6 A;  3TP9 A;  2FU8 A;  2Q9U A;  5LCA A;  1BMC A;  3KNS A;  3SPU A;  1P9E A;  5AHO A;  2ZNB A;  3IE2 A;  5ACS A;  5K0W A;  3IOG A;  2E7Y A;  2BG8 A;  5A0T A;  2BFL A;  2FHX B;  2ZO4 A;  4ZEJ A;  5ACV A;  2FHX A;  3ZR9 A;  4UWO B;  4BZ3 A;  4RM5 A;  3X30 A;  2OHI A;  2Q42 A;  4EY2 A;  3G1P A;  5EV8 A;  4EFZ A;  3KNR A;  1JJE A;  2FM6 A;  4UBQ A;  4XWW A;  3BC2 A;  4GYU A;  3IEM A;  4NQ2 A;  5HIO A;  2OHJ A;  4AD9 A;  5LLD A;  2YNV A;  2QDT A;  2FK6 A;  5LSC A;  4Z5Y A;  2HB9 A;  4RAW A;  3S0Z A;  4HL2 A;  3IE0 A;  4GCW A;  1KR3 A;  1DXK A;  1KO3 A;  1HLK A;  2WHG A;  2YZ3 A;  1WW1 A;  3ZNB A;  2BMI A;  3R2U A;  3DHA A;  1WUP A;  4KEQ A;  4HL1 A;  1K07 A;  2FU7 A;  1BVT A;  5AHR A;  5DPX A;  3IDZ A;  2YNT B;  5B3R A;  4EYB A;  2DKF A;  2NXA A;  4AWZ A;  4JO0 A;  5HH6 A;  3I14 A;  4TYF A;  4NQ5 A;  4O98 A;  3DHC A;  1YCH A;  4Z6X A;  4ZO2 A;  2QIN A;  3MD7 A;  3FAI A;  5A0V A;  3PY5 A;  1ZNB A;  2YNT A;  1BC2 A;  5EVK A;  3AJ3 A;  5A87 A;  5LCH A;  4AWY B;  2A7M A;  4HKY A;  5KIK A;  2GCU A;  3A4Y A;  4XWT A;  1MQO A;  4F6Z A;  2BG2 A;  4C1E A;  5EHT A;  4RL0 A;  3VQZ A;  4D1U A;  1Y44 A;  4B87 A;  5ACP A;  1X8G A;  2P4Z A;  2BTN A;  4EXY A;  3FCZ A;  3I11 A;  1DD6 A;  4D02 A;  5LMC A;  4F6H A;  3PY6 A;  3X2Y A;  4Z67 A;  4PVT A;  2BFK A;  3IEK A;  2M5D A;  5AXO A;  3KL7 A;  5FQC A;  4J5H A;  2FU6 A;  2DOO A;  2BG7 A;  2M5C A;  4D1T A;  2P97 A;  3Q6V A;  5EVB A;  2YNW A;  4LE6 A;  3PG4 A;  5ACX A;  3ZQ4 A;  5ACT A;  2GMN A;  2VW8 A;  2WRS A;  2NZE A;  3WXC A;  3AF6 A;  4YSK A;  3L6N A;  2OHH A;  3RPC A;  4UA4 A;  4AX1 B;  2Y8B A;  3SRX A;  3SFP A;  2CBN A;  4YSB A;  2GFJ A;  1JJT A;  2QJS A;  4C1C A;  2ZWR A;  3I0V A;  3VPE A;  4EYL A;  5LE1 A;  3ZWF A;  2I7V A;  2YNU A;  4NQ4 A;  2H6A A;  4C1D A;  1A7T A;  4KEP A;  3SW3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...