5A0VA

Catalysis and 5' end sensing by ribonuclease rnase j of the metallo- beta-lactamase family
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
454
structure length
454
Chain Sequence
b'SHPHPELGRPPALPKGGLRVTPLGGLGEIGRNMTVFEYGGRLLIVDCGVLFPEEEQPGIDLILPDFTSIRDRLDDIEGIVLTHGHEDHIGGVPFLLREKPDIPLIGSKLTLALIEAKLQEHRIRPYTLEVAEGHRERVGPFDCEFVAVNHSIPDALAVAIRTPAGMVVHTGDFKMDQLPLDGRLTDLHAFARLSEEGIDLLLADSTNAEVPGFVPPERDISNVLRQVFANARKRIIVASFASHVHRIQQILDAAHEYGRRVAFVGRSMVRNMGIARDLGYLKVPPGLVVDVKTLDDLPDSEVVLVCTGSQGEPMAALSRMANRDHQIRIVNGDTVILASSLIPGNENAVYRVINGLTRWGANVVHKGNAKVHVSGHASAGELLYFYNICRPKNLMPVHGEWRHLRANAELGALTGVPHDRIVIAEDGVVVDLVEGKAKITGKVQAGYVYVDGLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE J
publication title Linkage of Catalysis and 5' End Recognition in Ribonuclease Rnase J
pubmed doi rcsb
source organism Streptomyces coelicolor a3(2)
molecule tags Hydrolase/rna
total genus 149
structure length 454
sequence length 454
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 5a0vA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5a0vA01
2BC2A 4ZO3A 3JXPA 4J5FA 5ACQA 2Q42A 3I11A 4UWSB 1XTOA 5LCFA 1X8GA 1WUPA 2BMIA 4ZEJA 3TP9A 2FU7A 2GKLA 4P62A 3FCZA 1ZKPA 5K4KA 3A4YA 5B1UA 4KEQA 3IE1A 5LLDA 1YCGA 1WRAA 4B87A 5EVDA 3IELA 2Q0JA 4UA4A 5KIKA 3KL7A 2FM6A 3X30A 3SBLA 5KILA 3DH8A 4TZ9A 4XUKA 5EH9A 2GMNA 2BFKA 2YNVB 3DHAA 2XF4A 4AD9A 4EXSA 4C1DA 4DIKA 2H6AA 2FU9A 5IQKA 2HB9A 3X2ZA 4CHLA 3KNRA 5LM6A 4Z5YA 1KO2A 1VJNA 1M2XA 4GYUA 3AF6A 2WYMA 5ACUA 3S0ZA 3I0VA 5ACWA 4FEKA 4Z6XA 2M5CA 4ZNBA 2QEDA 3ZWFA 4PVTA 4TYFA 1QH3A 1QH5A 3T3OA 2VW8A 4RL0A 4C1FA 4F6ZA 2I7VA 5EW0A 4YSBA 3X2YA 5EVBA 5FQBA 1DDKA 2QDSA 5FQAA 2R2DA 5HH5A 4D1WA 2OHIA 3H3EA 2OHJA 3PY5A 2YNVA 4V0HA 3SRXA 1WUOA 2Q9UA 4XWWA 2BFZB 4GYQA 4AX1B 5ACRA 3IEKA 3P2UA 4LE6A 5AXRA 5AHRA 1VGNA 5EVKA 1BC2A 2WRSA 3RKKA 2BGAA 2XR1A 4HL2A 4EYFA 2BFLA 2OHHA 3BK2A 5EV6A 4AX0B 5A0VA 3IEMA 4YSKA 5A5ZA 4RAMA 1P9EA 3PG4A 2WHGA 3BK1A 3T3NA 4JO0A 1XM8A 3Q6VA 2BFZA 3AJ3A 3IOGA 4UWRB 5LS3A 4RM5A 5AEBA 5AXOA 1X8HA 1KR3A 5LCAA 2NYPA 1MQOA 4AWZA 3MD7A 3R2UA 1JJTA 2I7XA 2Y87A 5HIOA 5ACTA 1DD6A 2Y8AA 4TYTA 2GFKA 2ZWRA 3PY6A 2QJSA 2BG7A 4C09A 4Z67A 3IE2A 3KNSA 2Q0IA 4U4LA 4YSLA 1JJEA 2YNWA 5B15A 4PVOA 5ACSA 2FU8A 3VQZA 2GCUA 5ACPA 2AZ4A 4Z60A 5HIPA 4TZBA 4UBQA 5K4NA 4NQ4A 4TZEA 3G1PA 4D1VA 4EYLA 5AYAA 1KO3A 5K0WA 1A8TA 4WD6A 5LMCA 4AWYB 4UAMA 4HKYA 5LSCA 2GFJA 2QDTA 4UWOB 4NQ5A 5FQCA 4DILA 4EXYA 2YCBA 4Z7RA 1YCFA 1YCHA 3SPUA 2P4ZA 3RPCA 3SFPA 1ZTCA 2UYXA 5ACVA 2WYLA 3BV6A 2NZFA 3ZNBA 3SW3A 3FAIA 2DOOA 2E7YA 4RBSA 1BVTA 1Y44A 5A87A 2P97A 2NZEA 2I7TA 4D1UA 4EYBA 5EV8A 1WW1A 3IE0A 1DXKA 5AHOA 4KEPA 2FU6A 4FR7A 3T9MA 5HH6A 2P18A 3BC2A 2WYMC 2ZNBA 5DPXA 4ZO2A 4GCWA 4EY2A 5LCHA 1ZNBA 3F9OA 2YNTB 5HIQA 4F6HA 4BZ3A 2ZZIA 1VMEA 4TZFA 1JT1A 1BMCA 2DKFA 4NQ6A 3RKJA 2CBNA 4Z5ZA 4HL1A 2AIOA 3I15A 1HLKA 1K07A 4C1GA 5HH4A 4BP0A 2FHXB 2NXAA 3LVZA 3AF5A 3ZQ4A 2P1EA 4D02A 2QINA 3ZR9A 4RL2A 2BTNA 3VPEA 4UWPB 2BG8B 2BR6A 4H0DA 4FSBA 5HISA 2YNUA 2Y8BA 2BG6A 1SMLA 4RAWA 1A7TA 3I13A 2YZ3A 3I14A 5K4MA 2FK6A 3X2XA 3DHCA 3L6NA 4XWTA 3ESHA 4D1TA 5LE1A 2YNTA 5B3RA 2BG2A 3SD9A 2M5DA 4J5HA 4NQ2A 4C1CA 1X8IA 3QH8A 2ZO4A 3WXCA 4C1EA 4O98A 5A0TA 2FHXA 3IOFA 3ADRA 4C1HA 5EWAA 5EHTA 1L9YA 5ACXA 2A7MA 2BG8A 1E5DA 2BIBA 4EFZA 3DHBA 3IDZA
chains in the Genus database with same CATH superfamily
1OZAA 1KFCB 2ST1A 2AFHE 2Q6VA 2Z0MA 3I0NA 3N2IA 5AM1A 5PNTA 2WU3A 4I4NA 1O94D 4H16A 4J49A 1J2TA 3ZDDA 1G20B 3L0ZA 1JKJB 4P58A 4RK4A 3Q6MA 3K15A 5L4NA 3FPGA 3A1DA 4E2WA 1ZQ9A 3L41A 4OQ4A 3K70B 1ECPA 2IUSA 3L4EA 2I4NA 4FILA 4R4JA 2BFBB 2AC7A 1NXVA 3KV1A 4Q1CA 3WMXA 5JQGF 4JJ4A 3STTA 4UJ5A 3AM1A 4REOA 1NUQA 2EP5A 4ZEJA 1PK9A 1J8FA 4LXTA 3BA6A 1LLUA 3GMSA 3TO5A 4M0CA 3TYXA 2O8DA 2I1VB 4MUEA 4KITB 2QRHA 3EUAA 2A8YA 2JAXA 1ULAA 1M8FA 2QR2A 4Y2XA 1AUVA 1HORA 1X0VA 1Y1PA 3I2KA 3KJHA 3GLQA 1MVNA 3FKSA 2GJ9A 2SHKA 3HHPA 3OHSX 4OJNA 4GE3A 2FJUA 1IHXA 2QXUA 4UW9A 5FX2A 1G2PA 4Y9DA 5F7XA 4C22A 4DFDA 3SDSA 5D87A 5BP7A 3R75A 4CDMA 5BPHA 1MA3A 4BAUA 2PH5A 1I4EB 1J1IA 1SUEA 2GD0A 4RF4A 2VHXA 3U7IA 1ZR4A 5CFRA 5IC4A 5BWLA 1GUAA 4MUJA 1KEUA 2HYIC 4R3UC 4BUCA 1ODTC 4R9VA 1P5ZB 1O94C 1GQRA 1I3NA 1GPBA 3W5JA 2I71A 2IYTA 2PJZA 3IUEA 3MWLA 5MFPA 4U7WA 3FHCB 3H83A 3PPIA 5TQJA 5IKMA 1E20A 4HVAA 4RTQA 1LSUA 5KVSA 5E7MA 4J07A 3QVGB 3T1NA 3TLCA 5CB4B 4PSDA 4Q7EA 2DY0A 1GU1A 3HJAA 3VDXA 2CD9A 2QJWA 3CW2A 4FHGA 4KGZA 3F9RA 3QWAA 5FI5A 3T35A 4L7VA 2CYAA 3AEZA 1YH3A 5CLFA 4Y98A 1QAMA 3SNHA 5IQKA 1ZZGA 2TMDA 4H1TA 4Q3LA 5I7VA 1Y6ZA 1NR7A 1RTTA 4OLFA 4W5JA 3ENQA 2FOLA 2W6PA 4GX1A 1KPGA 4OB7A 3UY4A 5BOSA 1UJMA 2GI4A 2CG2A 1DJMA 1WB6A 4HH4A 1GARA 1S1MA 2PHZA 5KVQA 1A0OA 3A7EA 4EVQA 4YT8A 1GRVA 1RS0A 1N3YA 3BM5A 3L0SA 4ZYUA 3MJVA 3T7TA 3MJSA 1NIJA 2M5CA 4EHKA 3VTZA 3F47A 1W6UA 1WP9A 4M0PA 1U0LA 3OP1A 3MOIA 1DPGA 1G21B 1W88B 4WXMA 2WSMA 4XRGA 1IN8A 1T5SA 3K9WA 5IBCA 4HHEA 4ZEOA 4YCAA 3VNRA 5KYUA 4AN0A 3ZE9A 4HDRA 1FQOA 1M2VA 4PHTA 4FEAA 3RRMA 1XA0A 4K3VA 1PW5A 4DUGD 4LX8A 1KPHA 3K0CC 3FD8A 4XYBA 5FJJA 3EZ6A 1SKYE 1HL7A 1UKYA 4FCWA 5I4CA 3K32A 5FV7A 2VHCA 1ZG3A 1QIEA 4FMCF 2ZIGA 2JIBA 3GDOA 4J2OA 4NJOA 5EVBA 1D07A 4ZEWA 2HSGA 1DDKA 3JR7A 3WISA 2H18A 4UNPA 1YZYA 3MHPA 5EP2A 1Y0BA 3EUEA 4LF9B 1B00A 1EFTA 1A4UA 4FNAA 4QSMA 4C0QC 3MLEA 1JHQA 1T36A 1QS0B 1ZNYA 3M1IA 4EGCB 4S1OA 5CLJA 3H3EA 2QUBA 3ESDA 4FKMA 4GMXA 4K8RB 1PJAA 3JZAA 1SC6A 1LVUA 2FHSA 3AUUA 3I1YA 4WOKA 5EMNA 4CM6A 4ETWA 2YNVA 3PY5A 3SZ3A 3QVOA 2FDXA 1SZJG 4WOCA 3G5TA 1S8FA 2FR8A 2VAPA 4ZIRA 4Z53A 1DL5A 1WA5A 1X3SA 3G9XA 4LVUA 3CLHA 5C4IA 3S81A 1DU4A 1OH6A 4EFDA 3FSJX 4X20B 5EIAA 4XYGA 2D2FA 3CRMA 5C1OA 1Q7TA 3P2UA 1LTQA 1OFVA 1MQAA 2HLDA 2ZUWA 3IO5A 3KZ1E 4HFRA 4MITA 2PX2A 1J5XA 3VAZA 5TVKA 5E0OA 1J5PA 1XVVA 5AHRA 1UMBA 1GIAA 1XMPA 1TIBA 2VPYA 3F5DA 2DWQA 3QPCA 4OAOA 4LRTB 2YFKA 1BRMA 3IHWA 5IG2A 1CR0A 2WRSA 1U7ZA 2CVFA 4CF4A 4OFBA 2V7QA 4UATA 3KHSA 1ZESA 2OHXA 1US8A 2I4IA 1M5RA 2Q4BA 1ZM2A 4FWIB 3E7WA 4NV1A 1U6IA 2BFLA 1SULA 5CVVA 1WMEA 5A3JA 3O1IC 1LV8A 3DE1X 2IUUA 4CV3A 1QGDA 3D4NA 4FGUA 2ZUCA 4X95A 3H5LA 1YVRA 4MJ3A 1WWKA 4IMRA 4D0LB 4N18A 4RORA 1JQBA 1P7WA 1P74A 2HJWA 3M4ZA 4BC1A 3K8ZA 3CN9A 3KIPA 4WLOA 4ERNA 5JADA 4Z9FA 4G4GA 5LQCA 3AR7A 4EHNA 2HIMA 1WDMA 3KXLA 4GC9A 4ARVA 3JZMA 1TZCA 2WT8A 3L1HA 1DC8A 1IXRC 2A1TR 1EX9A 4QAJA 2HDWA 4TSKA 4CM9A 3I2HA 3W6UA 3PQ2A 3PNYA 4EECA 3HRIA 3L1VA 1K75A 3LBYA 1JF8A 2BTOA 4EHJA 4LBZA 4RTMA 1KU0A 3LKZA 4KNWA 2QWXA 3ZI0A 3R41A 2B3DA 1V45E 1GL7A 2QM0A 4P4NA 2PZAA 1JL3A 3P97A 5HMMA 2Q6TA 5SYMA 4WQMA 1FFGA 1RMTA 1OW3B 3F71A 4LCBA 2VP5A 4AT1A 4C3OB 1USVA 1DAKA 1U2GC 3QM1A 2VCEA 1Z4PX 2QENA 2WMYA 4RQBA 5L3ZA 3AVUA 5AXOA 1QLJA 3DULA 1A96A 4MKXA 4JBNA 4KO4S 4DCNA 4MGYR 3D9QX 4L85A 1GCGA 5TGDA 2JBWA 4GI1A 2N0SA 4KYIB 2L42A 3AV0B 1QSGA 3GYGA 3NM4A 4U9IS 2G9ZA 4BNMA 1R0BA 1K92A 3DEJA 2C9OA 4IIDA 5GONA 4A5OA 5BW4A 3HLYA 2A9PA 2GN4A 4NU8X 3Q6NA 4G9BA 1L7RA 2P78A 2ZI7A 3G82C 1SD5A 3T1OA 3TR6A 5AVJA 2I03A 3FAKA 1TYEB 3WE7A 5BUSA 2YV3A 4JVLA 2ZAOA 1C0PA 5B6JA 2VUSA 5FOSA 4MUBA 4W1RA 1A76A 2LNDA 2ZCVA 4Z2YA 5IN5A 4DUYB 2H4YA 1KEWA 1H6AA 4UMEA 3CRVA 2B30A 1ORRA 4ND3A 5AMXA 3OM8A 4B47A 2JNWA 3ZX5A 3NP7A 4IOKA 1CX9B 2JBAA 5CUQA 1BE8A 4C3VA 3O7WA 5E6SA 5KTOA 3RYCA 2MIIA 1R10A 4I9NA 4O4HB 4TKMA 5K09A 1C8LA 3VKFA 1PG0A 2WY2D 3UJPA 2PLNA 2IOFK 3FKSD 2AN9A 4CM3A 2GTPA 1YQUA 1M6NA 4NCAA 4NQ4A 5HK9A 1YVDA 3BH0A 3P8ZA 3PUWA 3GNTA 2R48A 3E05A 4F46A 3ER6A 2ANBA 4JJZA 1F4VA 1PRYA 4A2PA 4J9UE 5AW3A 2BI7A 2Y0EA 1XRJA 3B1YA 4KQHA 5L3QB 3CG4A 4FI3C 4NJEB 4CTKA 1I01A 1U1EA 3CNOA 2QIOA 3QVWA 4V0KA 2EJCA 4CU5A 1EGAA 3H7IA 3AEQB 4AZ3B 5A9SA 1V4BA 5C4GB 3O8OB 2X9LA 3P71T 4FFBA 3RYIB 3T7IA 2D74A 5L3RA 1DWPA 1E9DA 4TLMB 4XWOA 3S2IA 3MQ2A 3KOOA 4EDFA 5JSUA 2H5LA 1CQIA 3DKKA 1V37A 5LSCA 2IWRA 1SHUX 3D3WB 3T7JA 5F1OA 1AZSC 1ULSA 3JZFA 4RXTA 2V6BA 5EOVA 2VNAA 2WSYB 4K6MA 3VI3B 3MAJA 2O8CB 3ZCUA 1NOJA 2I67A 3QHQA 1V1RB 4TMZA 3MG9A 3K1JA 4R7GA 2QUKA 5EKSA 1M7HA 1U9IC 3JQAD 4GOMD 4G36A 4QU5A 1K86A 1ODKA 3KD2A 3V4SA 5J47A 2V59A 3M2TA 1EB8A 2NQ8A 3FRHA 4U8GA 3HADA 5IBQA 3RV4A 4LMBA 2P4ZA 1P5HA 4Z4FA 1AQLA 1PF7E 5A6SA 4LDQA 5EWJA 1J5EB 4ZDIA 2N42A 4G97A 4KN9S 3FNIA 2Y68A 3SE7A 1U0BB 3CX7A 3OP4A 4LSGA 3HI6A 1XZHA 3BICA 3G0OA 3Q0TA 4UM7A 5LXTF 1NU6A 3VSAA 2AG0A 4RDCA 2PZEA 3X1ZA 2ZUEA 1MQSA 3EVEA 5BN3A 1HE8B 1E9RA 2Q2NA 2BEVB 4WFJA 5IVPA 1ZSVA 3K6SB 2ZRLA 3NXKA 4FHCA 5AW8A 1XTTA 2J9ZB 3R2UA 1UQRA 2O7NA 4L3OA 3MW8A 4KH1A 3TZLA 2C4WA 3BXOA 3HG7A 4HXYA 2PAAA 3K0FB 4UTPA 2D4HA 3G0BA 3M9XA 5LA6B 4ENUA 2QBYB 5TPZA 4RKYA 2WU4A 1TPYA 2I6TA 3EOBI 1ONSA 1T6NA 3EULA 1BAPA 4U0KA 1I5EA 4PX3A 4B75A 2JATA 4BMXA 3IHLA 4JN6B 3SR3A 1CW2B 3IPXA 3FSRA 3DG9A 2QT1A 4IV0A 4WK2B 4YEDA 5DEIA 5B36A 3DL7A 2XAAA 4Y1EA 2Q5QA 4F2WA 2VS1A 2Y1FA 5KPDA 1FSSA 3Q5EA 5K0NA 1V8ZA 2PO5A 2ZATA 1WOYA 4LI0A 3T3MB 1S2OA 3JQEA 3N3AC 5J2TB 2QJTA 4A2CA 2Z4SA 5FUYA 5HH6A 4HDSB 2GN9A 3RG2A 1DDIA 3R0VA 2BFMA 2ZULA 3UT5A 3FCOA 3O8QB 5FAKA 1XO1A 1P2SA 1J2RA 2C9CA 2QTBA 2WPDA 4FZJA 4G89A 4B7UA 1Z0SA 2DT5A 4ENTA 4J0HA 4AMYA 2I62A 2PGLA 2C3OA 3DE2X 3WB2A 4E5NA 3L7IA 1Q1BA 3I05A 3ELUA 4HOYA 4LNHA 4N8DA 2CXXA 4U2GA 4ILKA 2SBTA 4W99A 2X40A 3B70A 2I99A 1LU9A 3DWFA 4BVFA 4IDBA 1FIUA 1OZ0A 2OT3B 2VQEB 2FZ4A 4DQLA 4BBPA 4YRAA 4D25A 1X80A 2V7VA 3AOGA 4Z4IA 1Y8RA 4IINA 3H9GA 4GX0A 1UEXC 1UDRA 1ZRSA 2JLAA 2V7QD 1T0IA 3AYZB 1H6DA 1SBYA 3KD3A 3LZ6A 4E5KA 1X87A 4KKVA 3GRZA 1BMFD 3N76A 4ZHSA 4DV0B 4ZV9A 4C7OB 2HB6A 2OYSA 4MB0A 2CBNA 3U7RA 4Z5ZA 3HWSA 4FT2A 4KR2A 3ZYCA 1ZOSA 3DMNA 4ZPJA 1SWVA 5ADWA 1YQEA 2FPPB 3ESQA 4MV9A 2XYGA 2YV4A 4HAXA 1IOLA 1QX4A 4LRYA 5FFNA 2XITA 2XNCA 3S6JA 5IM4F 1K07A 1PNTA 3HJGA 2GZSA 3LU1A 4FHZA 1IN5A 1EK2A 1F20A 1XVTA 2EJWA 5FPPA 9ATCA 1LZLA 1K5PA 2BEWB 1EZ4A 1SK9A 3DZDA 3PFBA 3WBFA 5B1EA 3G0HA 3MBIA 1QQ7A 1PVDA 4WXYB 3TW4A 1PNOA 2I1LA 4ZMBA 1YU6A 1JTFA 1SM4A 2R2AA 2ONKA 1CS0A 3G5MA 4R9RA 4G5GA 1T5DX 1T4GA 3OPMA 5KTPA 10MHA 5D85A 1TO2E 2IE0A 4O2AA 1BS2A 2YUTA 4M0UA 2Q50A 3TPCA 2OGUA 1PLJA 4R0VA 4QAQA 3AHCA 3VNAA 1M2KA 2Z4RA 4EAQA 4JBLA 4XR4A 5IJ0A 2R6FA 3CH4B 2GRUA 2ODPA 3U0VA 1FFYA 2ZJAA 2IXDA 4YRTA 3M1LA 4EDHA 3QUQA 4Z51A 3I13A 3CRRA 4LE1A 1N92A 2BGGA 2NO0A 2QM7A 5JEEA 1JJVA 2IHBA 2G06A 4C5CA 2O2XA 2RAUA 3P4XA 2A14A 2FLKA 1QLHA 3M6IA 4RGBA 1JJIA 2O5VA 5BQOA 3RD5A 2ZYHA 4R7ZA 2CJPA 2QAGA 3UUFA 5A9RA 5A2QA 4ERXA 3MELA 6REQA 5ER9A 1E79A 3DLBA 3EJWA 3V1UA 3D64A 1SXPA 2C97A 1J9ZA 1WCYA 3ZTYA 5EI5A 5IT9A 2XUJA 3CGWA 5JTUA 3K92A 4JODA 3WL3A 3I9LA 1C9MA 4LOHA 2WWWA 1KDRA 3QLUA 1KJ9A 4RW0A 2V4MA 1GGKA 1KK2A 4MW4A 3VZPA 1UIRA 2OMEA 3G8BA 4N5DA 4NAUA 3QKRA 4M55A 3RK4A 1H1LB 5K8LA 5HF5A 4MRSA 4BO3A 4HEJA 1CRZA 4NPCA 2ZO4A 1HPLA 5L7TA 5BMVA 5JNWA 3IL2A 1ISFA 4MV8A 3L18A 3TB4A 1MW8X 4ZOAA 3ECAA 4BTVA 5FFMA 1A4RA 1X1DA 3HTXA 2XNDA 3ZE0B 1T9GS 3F1KA 1T1EA 1ESNA 3GRVA 2A9QA 3MD9A 2OORC 4KHZA 3V2GA 4IVPA 4LECA 4XIYA 3OG9A 4I1IA 4X6LA 3NBXX 5IMBA 2BG8A 3SS7X 5L45A 5KYWB 4R40A 5KTNA 4HAZA 1WQ4A 4UHJA 3RYCB 2YVUA 1BVRA 5G3YA 1KNXA 1Z2NX 1TPZA 2NSHA 3EHDA 3JXPA 3WTBA 1RAHA 2Q0HA 4BMDA 2GCOA 4J5FA 5ACQA 1HUQA 2QZZA 3W2FA 4RKFA 4FKZA 2WIJA 3NJRA 1L5RA 4J91A 3A32A 3E8SA 1L4FA 1GQ2A 5K8JB 4MQEA 5JATA 5IEJA 2Q7DA 1QH0A 3F6YA 4QOHA 5JCXA 1CJMA 1Z2EA 1Z4NA 1VG0B 1UK6A 2BLLA 4F0JA 4O2LA 1FRZA 3MT0A 4MP3A 4ARAA 2OXEA 4S05A 1NAIA 4JL8A 3VR4A 2IHVA 4YDSA 2FU7A 4U4AA 1G5FA 4AIIA 3EZ7A 2YHIA 4R1SA 5IABA 4UUAA 1ZRNA 1R0CA 5L53A 1XPOA 1ZONA 4E1AA 4YRRA 5F2OA 2POQX 4LJ4A 4B4DA 2FZVA 2R1VB 4QOJA 5C35A 1AA9A 2YXEA 1VRCA 4MVJF 4CKEA 1JYFA 2XUDA 4MYCA 2VZLA 1JQEA 3AK4A 3VTAA 5A2GA 5CGQB 3BTSA 1S2DA 4ZREA 2LD4A 4Y6OA 3R7SA 3HCCA 2NNWB 1NE7A 3F1LA 2FPRA 2HQSA 3IQXA 4P7BA 3RIEA 2JJ1A 3KDPA 3L7DA 1WXGA 5TQ0B 2F62A 1XRRA 1IQPA 3NO4A 3WIUA 1KIFA 2JIMA 4M54A 4XWYA 4RKWA 4D2IA 3L7MA 5JXHA 4L8LA 1E7WA 1JQ5A 3T3PB 1AXRA 2OPHA 4DNFA 2VJNA 1KHTA 3Q3EA 3S2GA 3T5MA 1Z5WA 4IS2A 1P2GA 1OE0A 1SD2A 3E23A 2VCHA 3ONDA 3PL1A 1PX0A 3C8ZA 4MR9B 4NZZA 5TQVA 4KIWA 2CNLA 4RSRA 4O5AA 2D3TA 5TPZD 5JCJD 3N74A 2ZRKA 4BUJA 4AD9A 2X41A 1ZGAA 3QF4B 2DQZA 2YW9A 4L57A 1OBVA 4RJJA 4NF2A 5KVVA 1B6TA 4PF1A 3VR6D 4OHKA 3ZY6A 4O4JF 3R7BA 3IR7A 2BKEA 4CI0B 2QQFA 1DLIA 4OUDA 3RVJA 1RWMA 1N2OA 4KAAA 1KAEA 5BURA 4DLXA 2O8BB 5EIHA 4CHLA 1TAHA 4MS4A 3HC7A 4QTXA 4IZ6A 2PL9A 3R9KA 3UCFA 2R44A 3EXIA 4FCVA 3SX2A 2EGGA 3MYYA 1IZYA 4PLCA 4QQ8A 1KGSA 2B1IA 2AOUB 1P1BA 4QXPA 3WGMA 4AZSA 4CE6A 3NHKA 1WJGA 4ZAVA 3BXXA 2GO7A 5EE5B 3UENA 1QTIA 2HF2A 4ZGWA 4EZIA 2J46A 2FPUA 3BZUA 1FLNA 4GW3A 3CR8A 1JPVA 3PHGA 3K0HA 4KUHA 1HQCA 3RUCA 4AF6A 5IVDA 4D79A 2X0DA 4ZJZA 4RCZA 1BDMA 3L92A 4J4TA 2FWRA 1L3BA 4TTIA 3MCZA 2H2WA 3N8HA 1XCBA 3HY3A 4HR7A 1SR8A 3U16A 3KQYA 3UGJA 2AMYA 5CTAA 2ATXA 4FYKA 1XHFA 4LHSA 3U17A 3MUFA 2WYOA 2PZ8A 1CUHA 1UH5A 4YSBA 5FFFA 1R6UA 3BMCB 1EMDA 1Y7PA 3U5TA 2W6ID 4R5MA 5AVWA 2A4MA 5EIFA 1Q44A 1BJTA 2P9GA 5JCPA 1FYVA 3I42A 2WAOA 4IEIA 5AICA 3GELA 3TCKA 1U6JA 2J6BA 1U3CA 3BE4A 1QK3A 3MLAA 5LZ7A 4K9DA 4WCVA 5L7YA 2BM0A 4JI0B 2IXAA 2IZ5A 4V0HA 1N8NA 4KJXA 4UKDA 5DM0A 3KPVA 4OPMA 5I9MA 4TX1A 4YAOA 1WZUA 1KOFA 1ZMBA 3N8KA 1CERA 1J6UA 4XWWA 1EUZA 2QNRA 1PG5A 2BFCA 1BX3A 1R18A 3EASA 3LBNA 1Z0KA 2ZW9A 3IEKA 3JQBC 5K6RA 4YGXB 2IZOA 2FWMX 1IHOA 3IDSA 3W2EA 1WB4A 1X39A 3RYFB 3SC2B 4TXLA 3TDKA 1K5HA 4DR1B 4OKIA 4TMFA 3WHPA 3I61A 2Z3WA 2R4TA 3PXEA 4JUBA 2VJDA 3LQ1A 1ZIDA 3DUFA 4JJIA 2BGAA 2A7XA 3LTEA 2WFZA 5E3IA 1EFHA 3SIRA 3SIXA 3WGVA 1GM5A 4NURA 3K8OE 2GK4A 4AJLA 1NM5C 3CVYA 2TSYB 1K6EA 1KI6A 1L8QA 1E2MA 1AUXA 3WNDA 3PC4A 1ZMOA 1SPXA 3FROA 2ZS7A 1FL9A 2ZRMA 3BK2A 3DTVB 4P9NA 5H81A 1KQNA 4HQNA 5CITA 4Q1DA 1QU3A 2SKCA 5IT0A 1HQYE 3RVRA 2LCQA 2PV0A 3QPBA 2WWVD 4BWYA 1F8FA 5CIQA 4G4SP 3AETA 1RLMA 2PMKA 1QIDA 4YCCA 5JO9A 4BGDA 3O75A 4B73A 4QEDA 4ZTBA 1XBTA 3HKDB 4HLNA 1T9CA 4K46A 2CHGA 1XM8A 2W6NA 1NASA 4D80A 4RD1A 1WP4A 1W8DA 3GLVA 4B44A 4F21A 2OCXA 2J5BA 4TWRA 1CJBA 1Y1LA 4I5IA 5CVEA 4F9GA 3N0TA 5KTRA 5J23A 5B1DA 3C3WA 2NO7A 2BI4A 3N28A 1IN6A 3WXBA 4KI7A 4E5UA 2XNDD 1MAVA 5CXXA 4RM5A 3T9CA 2P3LA 1KMNA 3RABA 4EUNA 6YASA 1SVMA 3C8HA 3GL9A 5JDCA 3AVWA 2RCYA 2DBZA 2WIBA 1T34A 1DINA 4PINA 3GHHA 4RM2A 1JQLB 2JVKA 2ZVQX 2VUTA 1QDLB 4RDIA 1Q95A 4CKXA 4PR0A 3UQZA 2QAGC 3TAXA 3ZJ5A 2DKOA 2D1FA 1Q57A 4TV9B 2EJBA 5MN5A 1QVZA 3VV2A 1GGMA 4YN3A 2A58A 2K87A 3BXZA 1DIOB 2IOHA 2AI1A 3TSZA 3ZNOA 3C5HA 3E1GA 4EY6A 2O59A 5D5QA 5E6UB 5SY9A 3RJTA 3T12A 5E8RA 2VBIA 2IS4A 3QLUC 3AXSA 4IFIA 1W7AA 5A9TA 1A3CA 3IUNA 3TRJA 5H3HA 3BAFA 3COYA 1YHNA 1I5OA 3HJTA 3PL5A 1U7WA 3NLLA 1XK6A 4PW0A 2VAXA 4IV5A 1R8QA 3GJXC 3LH5A 4FMDB 2G9VA 4JC0A 1CRQA 1GV0A 1LKZA 1MB9A 3DOIA 2TMGA 3LY8A 4IOLA 4LHYA 4PLVA 4BDTA 1OH7A 1TJ4A 1DFHA 3DVAB 1L4HA 2VDKB 2D2VA 2GEJA 2PYZA 3K8YA 3V7YA 1YOBA 1WLSA 1B73A 3PVSA 3RNOA 3UA3A 4UNRA 2HSEA 5JROA 2VPQA 4MLCA 3BWDD 1P29A 2P7HA 2PIDA 2YS7A 3VR3A 5CDUA 1KJJA 2P9JA 3LZDA 1ZVQA 2JIZA 3WMWA 1WNTA 1QYXA 2D0IA 2JFBA 4U7TB 4AO8A 1Q21A 4G24A 2Q3BA 2PKRA 2PA3A 3IC5A 3PPYA 1T1GA 1BYIA 1N6KA 4MYSA 4CKBA 5BSWA 3O0TA 1K66A 2ZFUA 3LHSA 4WD3A 1SUPA 3TZHA 4YC7A 3PD7A 4EX7A 4HXEB 2WABA 5LP6A 3MJTA 1CDOA 3RSQA 2H54A 2H1HA 2F3UA 1FS5A 2YWRA 1AUPA 2GAFA 2W70A 2J9YB 2MYPA 4OXIA 1SXQA 3E4DA 2GFJA 3P9XA 4MUFA 2A3RA 5J40A 5JAQA 1J06A 2V5UA 5B2EA 1HDCA 1RM3A 3ETCA 2VAVA 4EI9A 4XWKA 4NQ5A 3KHKA 2WUFA 3BDVA 3LQ2A 4EXYA 3T9EA 2VJYA 4ER0A 3L43A 3ZU6A 3K1TA 2COEA 1NN0A 1PT7A 4ZDWA 2J07A 2VYVD 4MARA 4X8HA 4Y8VA 2F3TA 1X0XA 2B99A 1G2IA 3OPYA 4INAA 4D9BA 3I8XA 2UXDB 3IXQA 5B1IA 2WJVA 5CCXA 2WOJA 2VHVA 5EQFA 1W44A 4WI1A 2IX3A 3Q6IA 4ND7A 1A4IA 2RAPA 2E18A 4YGYA 4MHOA 1DC7A 3UPTA 1NYLA 1DKLA 5LMZA 4B82A 2YYAA 2IELA 1XMOB 2AJBA 1Y89A 2BBTA 1KO5A 3LTNC 3H75A 3QHAA 3DOHA 5FLYA 4RPGA 3FAZA 2I2CA 4EG3A 2ECOA 3A14A 1GILA 3A37A 4KGXA 3L8HA 4RBSA 2UUBB 3ACBA 4NOJA 4A7PA 4XX1A 2HHHB 4YASA 4B71A 2ACWA 4AURA 4ED9A 4M6WA 2E2WA 4JJGA 3S3TA 1NRXA 4N5LA 3K4QA 2IUTA 2YINC 4H7KA 3ZZ1A 2F1OA 3U44A 2I7TA 4DLTA 1MR3F 4PRZA 4RTNA 2HF9A 5K8UA 4CMGA 2PNJA 2DUWA 4UZEA 3T15A 2HMVA 2ORWA 5D6OA 2AXEA 3NG1A 2FFHA 3NTQA 1RHRA 3I45A 2E4UA 3C15C 4ESOA 5IAKA 2QTVB 3G8CA 1VKJA 2B98A 4HNQA 5F73A 3VNBA 1KP9A 5FHRA 4GGPA 2GN1A 2O2EA 3LBAA 3JW8A 2ABWA 4LRWA 2G9NA 1U2DC 1FMCA 4QKQA 5C8XA 4KRYA 3AHHA 1J0AA 1EM8B 2WE8A 4F86A 2JLVA 2XTAA 5T4EA 2P0EA 2EWWA 3O84A 5TT1A 1H66A 2GMWA 1HDIA 2MYNA 1ECCA 1I80A 5HIIA 1TMGE 3K5PA 5DHFA 4DLSA 4FGJA 1CUCA 1MO6A 3FZQA 1AQJA 2ZNBA 1PIWA 4Q37A 2O7QA 1ETUA 4X97A 4JLJA 1I4OA 2IDJA 4NQZA 5E1DA 2PNFA 5JSQA 1DUVG 2CVPA 3VA7A 4Y2QA 2TRSB 4I14A 3LKDA 3ESYA 1I2MA 1SN7A 2WP0A 2Y27A 4Y2RA 3D7MA 1ZNZA 4EW2A 1HT1E 2WTNA 3PDJA 2NIPA 8ABPA 2IH4A 1EYZA 2CEKA 5LPNA 2Q1XA 2X8LA 3Q7IA 2BKXA 3EPLA 3GLGE 1BIFA 2C8LA 1Y6FA 1I0ZA 2C2MA 1KY2A 2IYXA 3R0IA 1VJGA 2PJRA 3PRYA 1H42A 3WLSA 3Q3VA 4NE7A 4YB8A 3MM4A 2B7BA 1ZI8A 4HY3A 5KI6A 1NVFA 3IOYA 3EK2A 1GYRA 2G17A 1PFWA 6LDHA 3MS2A 4DW8A 1KVRA 4X1IB 1JJFA 2W2NA 1QG6A 4MQ5A 5DDIP 2FPWA 4BKUA 4C4YA 1N2CA 2FFAA 1Q7RA 1C0EA 2C5LA 1JZQA 3ROMA 4Z1OA 3V32A 3E1KA 2WAMA 3U09A 1VMKA 1N9ZA 1PGOA 4ZT7A 5EYPB 4HXGA 4BWVA 3AGPA 3BL5A 4BP0A 4K03A 1VGVA 5U4QA 1D4ZA 1ODIA 3JAWA 1TQ6A 5FUVA 4XW2A 3R9IA 1FQJA 2FN4A 4YVFA 1NDQA 4RA6B 3WNQA 2OCIA 2PT6A 1GDTA 1GPMA 3DB1A 1K2WA 3ZGXA 3AU8A 3KPUA 1CF2O 4QXRA 3R7NA 3REOA 4KPGA 3WRVA 3LMKA 1N4AA 5K4HA 3WB9A 4UVEA 5IAGA 3FYDA 4MUKA 4DCGA 3THWA 4KPUB 2HMTA 1SMLA 4UHDA 1E5TA 5BT8A 1FX1A 2HUPA 3NW9A 4HDNA 4RU1A 1M1YE 3ZIUA 1ULUA 1Z37A 2IPLA 2Z9BA 3WBKA 5DXJA 3ZHTA 3V7UA 2FRVA 1Z15A 4D8XA 3UM9A 2QYOA 4H6PA 2H48A 3L6NA 4FOLA 1EP3B 2XRMA 2HWWA 3B8HA 3TLJA 2A5FA 2X77A 3GCXA 2H0AA 3AZOA 1JW9B 3K1AB 3MILA 3MTQA 4RYLA 5F5NA 1HRDA 1VDMA 1E94E 3HRKA 4HKTA 4X7MA 4NRDA 4CU2A 5CT4A 1E2BA 3HVJA 2GA8A 1E5XA 2ZWPA 3VYSB 1N77A 5FAXA 1HTTA 1NRIA 2VA8A 3QELB 4MUIA 3PWZA 5AWFC 4EK9A 621PA 3OCJA 4II3A 4CUZA 1H23A 3MLBA 3SIWA 1RJ9A 2X2OA 3HO6A 2DPXA 4H0NA 2O8EB 4LZWA 3CKKA 1ZNWA 1V16A 1J39A 1VMIA 1UJ2A 1UPTA 1NJSA 2B1GA 1R6VA 5BNFA 5COAA 2FX2A 2I8AA 1RWVA 1GNSA 1E2FA 3JQQA 3KVVA 3KYDA 1GLVA 3OIWA 4IJWA 3EWNA 4S24A 5E7IA 3KUCA 3I01A 4CL8A 1T15A 3OM0A 4IDEA 5A05A 4A8JB 3GLFE 1JIKA 1PJ4A 1XRQA 5MGBA 1GZUA 4G5SA 4NC9A 2CK3A 3I01M 2FPIB 3C5EA 1NVAA 3TZEA 3LVRE 5EZ6B 5JYDA 5AW5A 2V9ZA 2WM2A 4N3CA 5JU6A 4L4RA 4B7XA 3A0RB 2WFAA 4YALA 5HDQA 1JQKA 4HEHA 1JR6A 3LGAA 3OKCA 3B6EA 5H70A 5CA1A 4URFA 3EVFA 3DO6A 2OFPA 2YY7A 2JAOA 3NH9A 4J29A 3IDQA 3PHHA 5FWDA 4JJ8A 3PE6A 4TOIA 2CMDA 4EFZA 2WIDA 5EEHA 5ETJA 4CWAA 1U8TA 3KQQA 3GYBA 1T8UA 4RS3A 4X1YA 3GUUA 3SZLA 2D54A 5F77A 3H2ZA 4JVSB 1R0SA 2XJ4A 2QNIA 2WYHA 4H3SA 3SFZA 4LAFA 4JC5A 6ADHA 3QSYA 4N9WA 3RIMA 2BE9A 2PS3A 2GVZC 1SVSA 5JSZA 5KQLA 2P5TB 2RK4A 4J9VA 3NC4A 3ZD6A 3CXUA 4F11A 4X91A 3TLYA 5E7QA 2GDJA 1JEQA 2QY9A 5FNZA 3VZRA 5AUQA 4BV3A 5CVJA 3RC8A 1Y3BE 1NY6A 2RB4A 4OHWA 4BLWA 3A4TA 2YBDA 1BD3A 1Q16A 3E2MA 1CR4A 1FU7A 4BNWA 4TRJA 2Y6VA 1HZJA 3WJ7A 2VCYA 4P0QB 1M7GA 2IYAA 1E9VA 4HLDA 2VJQA 4AD8A 4Y1RB 3QWFA 4B45A 4M21A 5ITZA 3VH3A 3EFOA 1SG6A 3N2YA 4FKBA 4LKRA 1BXGB 4GZLA 4REQB 2HQ1A 4LDRA 1WPQA 1YQGA 2B8WA 2GKGA 2ZRIA 3HSYA 4RHYA 3VJLA 5M7EA 2B36A 2Q6IA 1IG0A 1YJ8A 3FFXA 3P9PA 4GFDA 4DCSA 4HQRA 4Q01A 1J56A 3A2MA 2OLKA 2WVAA 1UFKA 5BYAA 5LYJB 3CLTD 1V5FA 1ILEA 5ED4A 1N0HA 3DBLB 1R27A 5C53B 1ENYA 1L4BA 3NHYA 3QWIA 5DCUA 1GY8A 1JHVA 1DUSA 2VP9A 4OQMA 3UOWA 3O21A 1ZOIA 3OE4A 2JBHA 2W2QA 3ZCXA 1I7QB 4L4YA 3SBLA 3EPRA 2A92A 3FMFA 5EH9A 1BU8A 1XZGA 2ACEA 3K0BA 3O3MB 2AOTB 3KVOA 1PZGA 2DPMA 1FDVA 3MF4A 2GMNA 5EKUA 5C1BA 3QOYA 2GJSA 4ZAWA 1EP2B 1P91A 2GBLA 1R4NB 3NNSA 2HFKA 4JCOA 4BRUA 3CSSA 4II7A 1K2VN 4ZU3A 4ZO9A 1NUSA 4I9HA 5DLDA 3WLLA 5KOJA 4ABTA 3EXHB 1T4DA 2DFVA 4U7FA 5BVGB 3Q41A 5FTKA 3G85A 3UGTA 3X2ZA 4PRKA 3RUPA 5EESA 2V8OA 2GILA 3K0EA 4L4SA 1SHJA 3ITEA 4V38A 3UKJA 1NXPA 4RIEA 4Z5YA 1E6WA 2UUPA 3CR3C 3NBQA 5GJCA 3P5SA 1JAXA 2XVZA 4FC7A 4L2IB 5KVAA 2PEYA 1ISMA 3AUFA 3DHNA 5ACWA 4R2JA 4XD7D 1AN0A 1RLIA 4INJA 4BMVA 3QEMB 2XE4A 1TKBA 4UHCA 5AP9A 3HGQA 3GFQA 4ZNBA 1N5RA 2JF0A 3CLTC 4FQ7A 1ZCFA 3HUTA 1PZNA 5IYZA 3OSUA 1TO1E 3NHSA 2AA3A 5KO2A 5GP1A 4KMRA 4RE5A 3GLGA 3OQBA 5B3JC 5TJ9A 1UOQA 2XT0A 1FUUA 2UV8A 1YZNA 5CD1A 1ZM3A 5CT6A 5K5EA 3A1TA 4K26A 2OA0A 4GWGA 3NBKA 4RY9A 2YBEA 3QPWA 3R7AA 5AM3A 3JAMA 4U39A 1XZIA 3PC8A 1KEVA 4KR0A 3GDFA 4ICIA 4YS6A 3N0VA 5IMSA 4RIFA 5HNKA 5C9ZA 4YJ3F 5LLTA 1X7XA 2YXDA 4WHMA 5FR2A 4RTLA 2BIFA 1OXMA 2XYVA 3FX2A 1JMKC 4TKUA 1J23A 2JDIA 3W5HA 1A1VA 1XAJA 5JQGB 4RA9A 5B7QA 1KYWA 4RIHA 1PWXA 2Q9UA 4URZR 4U6QA 1DI0A 3PKIA 1TCBA 4O4IA 4PX9A 1U7UA 2IT1A 4PPNA 1H9AA 4WKBA 3RVQA 4I4TA 4WADA 3ZWWA 1S3IA 1U0OC 1C1XB 3NIFB 4AX1B 4DV5B 1IM8A 2WV7A 4R0MA 1T5BA 3ES9A 1FK8A 2NZUG 4M1ZA 2VPPA 1EVZA 1MQ8B 1AGXA 4Q9HA 1O03A 1U4NA 1XYGA 4UMFA 1U0TA 2WB2A 5K3FB 1M1YA 4URXR 4IJKA 3RG8A 3T9BA 4BCDA 3KL2A 4P5EA 3SSOA 2JGDB 2VJMA 4ALNA 1VPLA 1QFJA 4WZBE 5KSYA 4JA0A 2E1RA 4HGNA 4W8OA 3CPSA 4NHOA 4QPCA 2P27A 3OO0A 2RGUA 3W05A 1YUMA 4B3BA 1XLTA 3AY3A 3DBIA 4WBNF 1VCOA 2CXOA 1J00A 3KL4A 4F6CA 3EPKA 3A3OA 3PX7A 3SEAA 4BJ5A 4YXFA 4DSAA 2B37A 3D5TA 2UYHA 3PJRA 2ZTSA 3TLBA 3HO8A 2LDBA 3QXSA 2Q46A 4F04A 2ZJ5A 3AUYA 1TK3A 3BH6A 3EDCA 3ND6A 3VR2A 1TA4A 1JQJC 3W8NA 4P93A 4CEHB 5L6LB 5CA0A 1NVGA 3O82A 5J5AA 3R9WA 5REQA 2XUKA 1ATIA 3ANXA 3RRNA 3ZBPA 2IK8A 1JH9A 3N2GA 4E3WA 2F90A 4NJMA 1J4AA 3OQ1A 4JI5B 5BV2P 3QUBA 4YP5A 3KYCA 3WMFA 1OWLA 4X3PA 1VE1A 2VO1A 3GLFA 2CXPA 3WNBA 2CUKA 4UXIA 5ANRB 1RACA 3QFRA 1N8SA 4PSKA 1WCWA 4YFVA 3H5TA 2HXYA 2PRYA 2WP8J 1T13A 2ZI4A 3PFIA 4B85A 3AIKA 1SOAA 1LTHR 3RUIA 3BERA 3OWXA 4JIGA 3QTLA 4FSHA 4NWIA 4NE2A 2QZPA 4Q4DA 3I34X 3TDMA 2QMEA 4C7BA 3FTDA 2C0QA 1I1OA 3ANNA 2C78A 3IERA 4YQZA 1WXIA 2ESRA 3N0XA 4R2LA 3CZAA 1V11B 3O1JC 1BCRB 3DVSX 1JHYA 3CJQA 4DM4A 4AIRA 3V6MA 2LR0A 4PIMA 3L8DA 1KO4A 1QUEA 2XDAA 4ARZB 1M2OB 4TL7A 4QO8A 1L6IA 2PU5A 3TVYA 3IQIX 4CRWB 1W36B 2BP7B 3ETJA 4Q47A 2F8TA 3HFRA 4LGVA 4J2TA 4NOLA 4YLGA 1N5KA 4B4KA 2Y87A 1DBSA 3HEMA 2KBEA 1EXNA 1C1DA 1VYVA 5CNJA 2A1UB 2Y8AA 3OIYA 1PLKA 3EIXA 1PJQA 4C76A 5MHTA 4L75A 1ZVMA 2EJTA 4FMCB 1SCJA 1UK8A 4PZAA 5TQ2B 2P4HX 1KMIY 1ONPA 2VSNA 4JBHA 1JHXA 1N2HA 1OLOA 2O57A 1P2TA 1I4DD 3FYUB 4K6GA 1TCCA 1U7TA 1AB6A 5EN4A 3GFPA 4GNKA 4TS3A 1RZ3A 2EQAA 4KXLA 4QDKA 4XQEA 2R8XA 1NKVA 1YZLA 3ZU4A 2XZOA 4GZ3A 1Y81A 3JQ8B 3RJZA 3DP9A 4KLZA 3EQ6A 5IRCD 1ZA1A 3WL4A 3DFZA 1ZN7A 4HPWA 1R5NA 1O58A 5ACPA 2CF6A 2QZ9A 3P9NA 3HXMA 1QP0A 4DBLC 2Y1GA 4WA7A 1CUJA 1JALA 3M3DA 2BFNA 2UUCB 5I7HA 4RLQA 2CBGA 2Z1DA 1Q20A 3PE4A 3OQVA 3TX6A 2ZUTA 1YIAA 2X0NA 3DOOA 2DTEA 1XVLA 721PA 4Q7KA 4ISBA 4MVWA 2GCNA 5CK5A 1K27A 1NJ5A 4P3XA 1I30A 2PL3A 1QQTA 3FWYA 3IIKA 4JWKA 1M76A 1BN7A 1ECLA 4N5MA 4CBVA 1U8EA 2FSPA 3FTQA 5D3MA 3UGQA 4JVNA 121PA 2ZSDA 3A05A 1DX9A 4D8VA 3DUWA 4JQCA 1BXRB 1NW7A 1P9RA 4V39A 4BO1A 1V9LA 1YV9A 2IU3A 2VZEA 2J3MA 1OVMA 2UKDA 4XPIA 4ALKA 4MR8B 4TQGA 3P45A 2P30A 4UBNA 5IWAB 2FB9A 1M8KA 2IGTA 4E4TA 2CFRA 1OV6A 2HBRA 3OOHA 1SK8A 4GIBA 3ZJYA 4HF7A 4Q0MA 3MT7A 4NR0A 1A88A 1MHPA 1UJ6A 4NK5A 2RH9B 2QPAA 1Z5GA 4DIEA 5FQCA 2Z2KA 1QHGA 2X1VA 4IHJA 4C4TA 5A04A 3PXDA 2ZRJA 3LI2A 4PYNA 1YKFA 4GMFA 5GV8A 2GXSA 5KHOC 2FUG1 5CT8A 4ZV7A 2IV7A 2MSLA 3MRSA 3OCWA 4JT9A 4PZYA 4OJYA 1DC3A 5EMHA 2RHBA 5KNDD 2OOSA 1Z25A 2B9EA 3FNQA 3O0DA 4KW7A 4LNUA 3MTJA 4ZVNA 4S2EA 2Q07A 3ILYA 3U9TA 1O6BA 2Z30A 3PFCA 3QWBA 4RK7A 4IPTA 3WRXA 3LY9A 5AXAA 1T0BA 4CHTA 3QA3E 4RPKA 3WYDA 1V8PA 3UK2A 5DN9A 4Z4GA 3MMSA 3QE3A 4XVRA 1G6OA 2W6OA 3ZDCA 1M34E 2P4SA 4IXWA 4UTZA 5LB4A 2I3ZA 2XWJI 3CE9A 4ZMSA 2BGMA 3BAZA 2I7CA 4CF5A 4BJHB 2R8RA 3F46A 4JLNA 4DT1B 2QXYA 1XVUA 1NX6A 5JIBA 3IV6A 3TDNA 4OF4A 1WXWA 2UZAA 3IB6A 3LLMA 4UPDA 2A9FA 4Y9RA 2QMHA 2GPNA 4BMOB 2NZEA 3KKNA 3RW9A 5EUMA 2VDRB 2X23A 4PYIA 4YJHA 2FE1A 5I51A 2EP8A 4E6PA 1CYDA 3GUYA 1J2JA 4WN9A 4BRZA 4RK6A 1NP6A 3KQKA 3JWPA 4JLBA 2IH5A 3JARB 3FTCA 3WHKA 2XDWA 3BBLA 3O8BA 1TT5A 4DBZA 1GUDA 1WW3A 2LBPA 1U28C 1KVQA 1UZMA 1FF9A 1Z0IA 2JDID 4LYYA 3AJ9A 4LEIA 2JK0A 1BZYA 4PFQA 2WLSA 1BOFA 1FTGA 3W6NA 4ZZ1A 2XBMA 1MJGA 4JVMA 1TEXA 2VYFA 5GADl 3EDYA 5AJXA 2O1EA 1DTEA 3ZEAA 4GVPA 1Y1SA 2VKQA 1KR2A 4EL5A 3AI2A 3FDXA 4LVNA 1R50A 5JC8A 4GKKB 4KXNA 5K0JA 3G9QA 4GCWA 1JU3A 1LXCA 3ESZA 3SVTA 5TMDA 3HKBA 5CX1B 1JEYB 1VE9A 2C4HA 4WZBA 2AD5A 4Z0PA 1XK7A 4UHFA 1KIMA 1Q0QA 5BQPA 3DP7A 3EWIA 4F45A 3TZBA 5JASA 1E6UA 5DYNA 5JARA 3OOWA 4Q9KA 2XA9A 4V0OA 3GQVA 2JH3A 4M8IA 1VSUA 3LS2A 3KQTA 2XI4A 4HNRA 1ZCBA 2WHXA 5E4FA 2PMEA 3ZWVA 3KC2A 4TZFA 3GJ8A 3NV9A 2ACVA 2CF5A 3CRNA 2RHMA 4A92A 1F4PA 3N75A 2F1IA 4NQ6A 1OMOA 2GYUA 2P67A 3F3KA 3K9NA 3JASA 4I8DA 4Q4JB 2A5JA 3QPUA 3SFVA 3DLCA 1M2NA 3NNNA 4KXFB 1EDOA 4K9KA 4X54A 5C8YA 3RT7A 1MX9A 3ORYA 3ZY4A 1GAJA 2D0OB 2VHJA 3TRDA 1W581 3EC1A 3FNFA 1FFDA 1Z73A 3IBYA 3IRVA 3WYNA 1Z2DA 4P6VF 5IPFA 1OWNA 4IDCA 1GCUA 4IVRA 3C7KA 4R69A 4X92A 2QUHA 3H8VA 3ZVRA 4B3MB 2UYCA 1F2TB 2JFWA 1XMSA 4Q9JA 3FGNA 3AFOA 1NAHA 1AUQA 2ARKA 2SCUB 4DAEA 3HDVA 1FJHA 2WHQA 4BVLA 1E1DA 2ORIA 4BN5A 1JU9A 1UMCA 2R751 4MYTA 1AVTA 3RIHA 4EFNA 4P92A 2JGRA 3PTLA 4XSHA 2BR6A 1MH9A 2QP3A 1YI0A 4B2IA 4XQCA 4QOFA 1KAMA 5CIYA 1INLA 4BVKA 3AO0B 1I7SB 4UULA 2XCTB 3I2GA 1YZ3A 4PG8A 3NHBA 4YRCA 3BWXA 3U7GA 4KPYA 4JASB 1JG1A 1W4LA 5LXTB 1B0UA 5ERGB 2PRKA 3F5QA 3UMCA 2XXAB 3I14A 1Z7BA 1E8NA 2MSWA 2YZNA 3ANMA 4YJDA 5DWDA 2ZZNA 1VCMA 5CDSA 4CCSA 2HOQA 3D7KA 3OA2A 4MRVA 4MI6A 1PT5A 4XM0A 1HDOA 2ZB7A 1Z28A 2IIVA 2W2LD 2Y1OA 2C9BA 2YQ4A 3AXTA 3FCEA 3IVCA 3LA6A 4FYHA 3KB6A 4JZYA 2J85A 4FGWA 4PFSA 1OB2A 1V5IA 1YJBA 3VMFA 4TMVA 4I99A 2EKDA 3PDIB 3C7CB 4JUAA 1CUIA 5B57C 3BB1A 4RQAA 1ZSYA 4QFDA 2GUWA 2UZ1B 4PVCA 1W5BA 2JFPA 2NVUA 4NQ2A 2JS7A 4U0JA 1VA5A 4R84A 2FQXA 3FB4A 1I2CA 1UEIA 5BN5A 1DIAA 3V00A 1MX5A 2FZGA 3D6AA 3FCUB 2J9RA 4DWVA 3FBWA 8LDHA 4LF8B 3IVAA 2WFLA 4I46A 4EF6A 4ER6A 2MINA 1NW8A 1N75A 1HF3A 1K8XB 2VP4A 2ZTVA 1Z7GA 4XIIA 4NNOA 3WL6A 3FPLA 4OMFG 2Z6QA 3GA7A 1LPBB 2B7LA 3N1UA 1QFXA 2VPXA 1BDHA 1T9BA 2PZBA 3L79A 4FW9A 4CFYA 4CT5A 2G08A 2OE2A 2XYQA 1RYNA 4PR3A 2AF3C 1G3RA 3E15A 1Q2UA 2C2ZA 3DDCA 1VJ1A 1L4YA 5AKHA 2DB3A 1Z08A 2PQ6A 4AS2A 3GR6A 4MJXA 4BNTA 1DPFA 2EQBA 3C6YA 4XEUA 2NM0A 2BGNA 3UYLA 1SKUA 1NBOA 1ZM9A 4LK3A 2JLXA 4ZO3A 3F4LA 4JOSA 3V7WA 3NHAA 2XOKD 4YO8A 3VVBA 4NESA 2E4XA 3D6MA 4M49A 4UWSB 1NVVR 1M8GA 2JEOA 2NTNA 1ZEJA 1QHHB 1V7ZA 2OHVA 3PNOA 1QHXA 4HLUC 4IILA 3VR0A 7ADHA 4U00A 2FA9A 1UJCA 4Q4LA 2FFRA 4Q82A 4D42A 3REGA 4DV6B 1G8GA 1WUPA 4GZ5A 5MFZA 4MICA 5DK6A 2ZIXB 3C85A 4JEMA 4O1HA 1GKLA 4AI6A 4KBGA 1X1AA 1Z7EA 4Z3KA 1C8VB 1RIFA 1Z4OA 2VVTA 3TLKA 1OFHA 3GJTA 1G9XA 3IP9A 4LDJA 1P2VA 3OZSA 1YR3A 3FUWA 2E4WA 3CTMA 2OZKA 3SNKA 2CCJA 4QODA 1DIHA 3AFHA 4ENSA 1JPJA 3NB0A 3OSZA 4IIJA 4KEQA 2EYUA 2EERA 2VR1A 4BJ1A 2WG0A 1JR3D 1WRAA 1QC5A 3K9GA 4ZALA 5GONF 2ZE8A 3OC6A 1OA0A 1DX4A 4GOKA 4PYRA 2FU5C 1M34A 1WDTA 5PGMA 1I2BA 4Y6RA 5C37A 5IFLA 4OXYA 4KRXA 5JMOA 4LTNA 2RKOA 4RESA 3OT1B 3LCJA 1P9NA 3SOZA 5IN4A 3A1SA 3M4JA 3X30A 1JGTA 2VWPA 1HGXA 2FGKA 3L4SO 4WRRA 2YMMA 5KILA 3OQIB 3KKEA 1TQ4A 3R0XA 4AK9A 1YGYA 4J1SA 1FDSA 1JEAA 5CH3A 2CL6X 1AGYA 1Y4ZA 1G7TA 4BNGA 5KU7A 2YZ2A 1OI3A 3DXXA 3ONWA 4YHBA 2HTFA 2PLAA 2YH2A 1C7ZA 1QMPA 1Y1KE 1OC2A 4RCYA 1GQOA 3HCPA 1ZCZA 1CUVA 1GFSA 3CUVA 3EGCA 4F6RB 1CR2A 1FFXA 1XZMA 3FW1A 4B17A 3L4KA 5JS1A 1BHSA 1KGDA 1U4OA 1P0PA 2ATCA 3QX8A 4NCNA 3HFJA 4FR2A 5TX7A 1VG8A 4Q9IA 4A16A 3G88A 3VO1A 5BSGA 1X7GA 5TS3A 5TSDA 2WSBA 3MGAA 4H08A 3DZ8A 3RS2A 2P5UA 3IVMA 3HLTA 1QOZA 2VHZA 2GN0A 4BO0A 4JYZA 2XAUA 1P72A 6NULA 4IMPA 2PLWA 3L1IA 3WRXC 4H1WA 4ZQGA 3VM6A 3G68A 4XTRA 2WJGA 5D7BA 5D86A 4C43A 3KETA 2P5YA 3JRNA 4JI7B 1N8KA 1A9XA 1D4OA 4RHCA 4R83A 1ECBA 1STOA 2C9DA 5BORA 5KUTA 4L9SA 4PVTA 1Q1ZA 4O4LA 2QRUA 5K20A 1QH3A 4X8MA 3DQZA 3D2CA 4X7PA 1VSBA 3EIOA 5F52A 2RCNA 3CUSA 3HA5A 1F7VA 4FU0A 3VDMA 3TRKA 1O96A 2WJ6A 4CKWA 1T8SA 4RWEA 2CDCA 3H0EA 2KS6A 3QLTA 1SUDA 1VP3A 4CN9A 3BE8A 2YWBA 4YMUA 1XMXA 2FK8A 1Y3CE 3KR9A 1W30A 1WZCA 5LBIA 4DJDC 1ZS9A 2P0YA 4G01B 3ROXA 1O4WA 4OK5A 1I6LA 5KVCA 5CM9C 3VR5D 3E8MA 1DT3A 3AY0A 4Y18A 4BFYA 2GOYA 1PVVA 3LWBA 1KEKA 2FF5A 3CF0A 5HH5A 1SVWA 4I1YA 4D1WA 3WKCA 5I5EA 5D3QA 1TOAA 3GFRA 2OHJA 2ZWOA 5DEOA 5BN4A 2GNPA 2WHYA 1MZVA 2C59A 2C77A 1U7HA 4C6HA 4NYMR 3R6LA 1QF7A 3C2QA 1VYHA 3GXBA 2HBYA 4W63A 3U4MA 1OBCA 3JYLA 2OBBA 2MMGA 2IDZA 2YV2A 1ST3A 4K6FA 4P7KA 2AJDA 1VLVA 3IEUA 4MP8A 4YCBA 1HDZA 4WZAB 3MNFA 2NLOA 1Y37A 4BTEA 5CYGA 3VUFA 3UMYA 1U6KA 1J97A 3H16A 4IDOA 1N5IA 2ATEA 2JIDA 4MZDA 3S8MA 1HK7A 5HHTA 1Y8QB 2Q0XA 2X3UA 4ALJA 3I3SR 3HDJA 1X1RA 1OFIA 3HJFA 3ZCVA 2A30A 1WV0A 3DNPA 2A0UA 3LQYA 4GEGA 3ACCA 4RJLA 4PC6A 1N36B 2FX3A 2F8MA 2I34A 2FLWA 2ZP1A 4F3TA 2DH5A 4DCUA 5LM3A 2C00A 2AYXA 2MJLA 4QM6A 3P5BA 2HGSA 3DMHA 5EPUA 2OGZA 3QE2A 1F8UA 1V4NA 4B9EA 1EVIA 4PRYA 4EKGA 2TMYA 4KYVA 2YTZA 4I3GA 3EYWA 2A84A 3CBQA 4EYEA 3GEMA 4U7PB 1YS6A 3A9VA 2ZQZA 1EVKA 5FIUA 4LTMA 2OQIA 3A6HA 3NBAA 4JV5B 1CK4A 2I6QA 1RJFA 5CGZA 1FDWA 4HUQB 4KPFC 3OD1A 1ZHFA 2VP6A 4RH3A 2O7VA 4LY6A 4C0JA 2AEEA 1CC1S 1BE0A 2DR0A 2DWOA 1FYFA 3NV7A 3QK7A 5IXYA 1WB5A 3PQ4A 2XKAA 4OA5A 5EZYA 4IM7A 1G38A 1WMAA 3PWSA 3BK1A 2V6JA 4JBXA 4M98A 5F4BA 4S1NA 1B76A 3BXFA 3PC6A 5DTQA 5HTKA 2CFCA 1MENA 2XE7A 5FI1B 4W9MC 5EWMB 4A91A 3CLRD 2K2WA 4BEWA 3GLIE 1N1MA 1QH8B 5J58A 4MB2A 3JYNA 4UNNA 4B1FA 6PFKA 2BFZA 3LUGA 1VPTA 4PC2A 3NTLA 4E3ZA 2NUPB 1IVNA 3VHXA 3DE0X 3TL3A 3CXRA 4DVJA 4LJ7A 2OXIA 5KNBD 3FCYA 3OIDA 1CRLA 2N1MA 3WLHA 5KYVA 5KKNB 13PKA 1B14A 1S8AA 4NU0A 3OQNA 1X8HA 2CBXA 3ORFA 5L95A 2BM1A 1USWA 4LC1A 5IVHA 4K81B 1FS4A 2CDRA 1KZ4A 3ER9A 4BFXA 1NQXA 3KZCA 1KR3A 2DPGA 2BHTA 2CGEA 1CP2A 3G2HA 3ANYB 1R37A 3RRYA 1YOVB 5JYBA 4DWWA 3COJA 4BKOA 4K87A 1RE0A 1F0PA 4YMWA 5DHAA 4FE4A 5IDYA 1E4OA 4YACA 3V34A 1YKGA 3CVOA 5C80A 2YFHA 2ISQA 2EW8A 4F97A 3CU5A 1JMVA 1RPTA 1T2AA 2DWUA 4JOCA 1RRVA 4ND2A 1QR2A 4Q3BA 3HB1A 4XA8A 4X9XA 3WLRA 3PY6A 4K0RA 1IUPA 3GUZA 2ZIFA 2ZBQA 2O3RA 1VE6A 4QG7A 4D6PA 2Q7OE 2IHNA 4O2AF 1OAOA 4C9BA 3RB8A 5JR3A 2AQHA 1P18A 4U4LA 4OB6A 2GHTA 2AH5A 1V2HE 4OCZA 1C3EA 3UMFA 1AU9A 2V4ZA 4YK7A 1BOOA 3CLRC 1EZZA 1FUEA 4I19A 4POAA 4TWBA 4COOA 3L0PA 4Y0AA 1JYSA 2C4NA 2QZJA 1WXDA 2GCUA 1VPEA 2H4WA 1Z39A 3QJYA 2GXQA 2BRUA 3IEVA 1NXSA 3LQQA 1PTJA 2IQ5A 1IY8A 3CUUA 1A8QA 1P8AA 5EE1A 2GCIA 2OPBA 3U26A 4CEIB 1AXEA 2PS0A 4RF5A 5JC1A 3DW1X 5FADA 1R8SA 2BEUB 2BJHA 1XMQB 5AYAA 1IEXA 3EQZA 4MYUA 4ZO6A 3CE6A 1Z34A 4EY7A 2Q5OA 2GAAA 2Y0DA 5CDFE 4B79A 1J33A 3BGDA 1UQUA 1TRHA 2A5YB 4YCJA 5JCOA 2OZLB 1QKJA 4HX2A 3BKWA 1EFKA 1N2JA 1NBHA 2BHLA 4B6JA 4J76A 4HRVA 3D8UA 4QFBA 3D43A 5LCXA 4HDMB 1CNEA 1Z6ZA 3B2QA 3OEEA 1XTZA 5JRZA 1EVYA 5JD3A 3RR2A 2JAPA 4BDSA 2NZ2A 4HDCA 2JLCA 5IAAA 4HWPA 3V4PB 4A9AA 1RAIA 2IP1A 3SJCA 4M2LA 3V97A 4DIOA 3UJ6A 3UKDA 4CMIA 5HJ2A 5M5BA 2AFIB 4D9HA 4DDHA 3WWPA 5BMVF 1K7YA 1OXXK 2WWHA 2ZAMA 1VGRA 2IYNA 1BG6A 3NOOA 1QOQB 4EI2A 3TLGB 3DD5A 3OLXA 2O5RA 3DEHA 2VDWA 1HR0B 6AT1A 4O6VA 3ZU3A 4DPMA 3IAXA 4AULA 2DFNA 2COUA 1SCNE 2H1CA 3LNTA 1RIIA 1U98A 1GG9A 1P4HA 5MF6A 1Q1NA 3RTCA 5AIJA 1SOMA 4B7CA 5E38A 4DE5A 3RAJA 1C3VA 4DANA 1MO5A 2ZYVX 3G8YA 2YMPA 3QX3A 1CEXA 3V4ZA 1XYYA 3WJAA 4MS1A 1ZO8A 5E2IA 4JH0A 3VU9A 4D4LA 2PSEA 5G1OA 4NP6A 4UM9B 1PE0A 3UO8B 4MW0A 4ZN6A 3N87A 5I9IA 1NZDA 4CCYA 1FSPA 1J0EA 1TYZA 2Y1DA 1XZNA 3IQDB 3DDWA 4P3OA 5HDBB 1DFGA 1L5MA 3N7AA 3D4OA 4CLRA 1U7OA 1E3LA 2AZDA 2DQYA 2VQ6A 3OTHA 1XHLA 1R00A 5JS7A 4PLTA 5FOVA 5L8VA 3M9LA 4FCTA 4WXPA 2OV6A 3KQNA 4CIBA 4CN8A 1XRPA 2DBRA 3OMLA 4FFOA 4QO7A 2J3KA 5CH8A 3ZU2A 4DCPA 2PDAA 3OAAA 3TLAA 3M6FA 4BLRA 1AK2A 1O6CA 3T52A 4MQFA 1RC0A 1JDPA 1F5SA 2ZCJA 3C43A 4GUDA 3FMIA 5BO5A 5JPIA 4ZFNA 5JCZA 3EF3A 2XB2A 2MYUA 2EDCA 3I73A 3OQHA 3B1KA 3WL7A 1W5FA 4UVHA 5B58C 4F6LA 4AMZA 5I45A 3WWZA 4KEPA 1UBEA 1RLJA 2WHEA 3DVRX 2B4YA 2ZI9A 1K1EA 4MRAA 4FR7A 2AZMA 2R1ZA 3JVVA 1DADA 3S28A 2IBMA 1MB4A 2ZR9A 1SQ5A 3I23A 2G4LA 2C88A 4J90A 1G5TA 4U7JA 5JI2E 5DN6A 3CKYA 4LYAA 1FSZA 3A31A 5H68A 1MXFA 3R3VA 3AR5A 1ZISA 2H2HA 2X4DA 3BEDA 3MWJA 3UAVA 2CMHA 2VTBA 2PZFA 5FR1A 4ZO2A 3DPIA 4FE7A 2Z9CA 3WS7A 2AKAB 1NSYA 3UG6A 4LJRA 2OFOA 1F60A 3PITA 2WIKA 5TB5A 1ZNBA 2I2FA 3E9YA 2QRNA 1W96A 1X9GA 2A5DA 3Q3HA 4FDAA 4HX5A 2NUAB 1TMOA 2BFPA 3R44A 3LG2A 4FCCA 1T91A 2OCGA 3D7NA 5TRTA 1V0JA 1XTJA 1FUYB 4KQFA 1XCOA 5H82A 4G67A 4HJXA 1OKKD 4IDPA 3ZWQA 4AFNA 2V9PA 1Y3HA 2G72A 3PX2A 1VDZA 4MNTA 1U90A 2BSXA 3HH8A 3L6UA 3MMPA 3RS3A 1SUIA 4AWAA 4JP5A 4CM5A 3QXHA 3CVUA 2H2IA 3DMTA 3EIFA 2C7QA 5K4GA 5TMBA 5KOHA 1Q7EA 1I51A 2Q9BA 3HU2A 4YX9A 3NOVA 3KE8A 2CW5A 4BNDB 2I2AA 5HKOA 1U31A 2FN8A 2RGWA 2GFIA 1Z5OA 3AF5A 1WDWB 3F8SA 3NHUA 3VV3A 5JBNA 1OXTA 2OXTA 1OAAA 4HWSA 3IJPA 1D6NA 2OK7A 1LBIA 1SA0A 2YXLA 2XZPA 3GLIA 2AJCA 5EZQA 2PX6A 5KNCD 4GXTA 3O6VA 1CKEA 3TOZA 4BJ3A 3ZDRA 1JR4A 1LC3A 2P9HA 4L8FA 2PX0A 1J0BA 2IV2X 3T5AA 1Z12A 2ALJA 1ZCAA 4KB5A 4V02A 4RAWA 1GZVA 1T2DA 2HU5A 5KEIA 3SZMA 1IN1A 2GBIA 3BF8A 4AZ0A 4RLFA 4GZ6A 4HGRA 4BFUA 1W1WA 3ROGA 2WVJA 3KS9A 4QFCA 2YRXA 4Q4AA 1HNNA 3A0UA 1P4SA 3H6GA 1Y6JA 3LC1O 2Z43A 1X7HA 1HQDA 5HF9A 4OGWA 4DLZA 1A5TA 3UPUA 5ER6A 3PX3A 2YNTA 3GD5A 1NJ6A 2RI1A 3L5KA 3F6EX 4M9QA 1DHRA 4NOMA 4YAWA 4EMBA 3KP1A 2R47A 4WCFA 3GA5A 1YTUA 1K9VF 2OR3A 4LBWA 5A4AA 2HRDA 4KMMA 3YASA 5BNWA 2QYTA 3HN7A 2CT8A 1QJCA 3WWCA 1MIOB 1A7UA 2F4NA 3NYQA 4BO2A 1JHZA 5AYVA 2CLMB 3I9OA 3OEWA 5F5LA 4CT4B 4L5JA 5D2CA 3RSLA 4O2RA 1RI5A 2DUMA 3C8UA 4R2IA 3TBKA 1L0BA 5HR5A 1H4QA 1SKQA 1QVVA 4PXAA 3W5VA 2PLFA 2B0JA 3SG0A 3B51X 4E7PA 4DR7B 5HZGA 1RJEA 4TSFD 1MAAA 4YWJA 4YYZA 3ZR9A 2GEDA 3ZG6A 3OIVA 1PJBA 4QHYA 1H8HA 4H9GA 4WJZA 4AJOA 5DULA 5FYDA 3EQ7A 3NGLA 1J25A 3GDGA 3DAOA 4NYJR 2OC4A 3LSTA 4PO9A 3V1NA 1LF5A 2X14A 4Y7DA 4P7FA 2F43A 4FGSA 2BUCA 4H6VA 4QTUB 4JT8A 3WAJA 3FOFC 2JLQA 3U80A 4HQ0A 4GRIA 1SC9A 1S0UA 4I55A 1DXHA 3IEIA 3U4QB 2CJWA 2WR8A 2GBFA 1R7RA 3MRXA 4M9XA 4OEHA 4CLRB 4EJSC 5BXYA 2I3DA 1N7IA 1X92A 4NDZA 1X6VA 4CCAA 1QO7A 4R1NA 3A9UA 3SJBA 4ZD6A 1JILA 3AW9A 1GZ5A 4HGPA 1XTOA 3QKWA 4JYPA 3A6ZA 4I6GA 3H4MA 3JWGA 1FMFA 4TL6A 1GR1A 3KSBC 1NFRA 3DM9B 3LT4A 1ECGA 1SHKA 4BGIA 3AX6A 3P2OA 4V0RA 2ASVA 3CTPA 1KKMA 5IM5A 1G5HA 3EOZA 4Q1AA 2OBYA 3B2EA 1W1UA 5L7WA 2MCFA 1OXVA 3KT8A 3FFWA 3W90A 3LL4A 5K4KA 4YUZA 3LVBA 1E3QA 1PTJC 3G8AA 4OGKA 4NE9A 3P0FA 4UOEA 3B36A 2ONYA 2PXXA 3ID6C 4UFPA 3ND9A 4U2CA 2DPLA 3FPEA 2I54A 2Y77A 4O2BA 1C7EA 5DCWA 2GPYA 2G1JA 3IELA 5FWYB 3E9DA 1HLPA 4I5FA 1HYGA 4JLUA 3OQ6A 4UA4A 3RVMA 1CCWA 1TCUA 1WUTA 3I1JA 4IQ4A 5FBZA 1N5LA 3BPSA 1Z2OX 4Y30A 1O5OA 4MVJP 4RGVA 3KL7A 3PNQA 3MSXA 4OP1A 4IWNA 5THKA 4PAQA 4D8UA 4ESHA 5ESDA 1GN9A 1YZTA 1CNFA 4ALMA 2BH2A 4D4GA 4BPRA 3S2UA 1MAWA 2WNIA 3F7NA 3KYJB 2NZWA 1QYCA 3TVTA 4PANA 1J7JA 3BFJA 4ENQA 4UEWA 1NURA 3PNLA 1EFPA 4GLLA 3ZE2B 5JT1A 3AL0C 2OQRA 3QLVA 3VVLA 2A35A 2AHRA 3THRA 4WN3A 1IEVA 1B8VA 2G25A 3GB9A 3KB2A 4KQ9A 1N33B 4QECA 3UAOA 4ESVA 1F4LA 3OECA 4P3KA 2JCXA 2PUFA 4I1SA 4U6SA 5DHTA 4DC1A 3UJBA 3A3PA 4GMKA 5CH5A 2GWHA 5LBUA 2RHGB 3SXJA 2R6DA 4B6GA 5KQPA 5AM2A 221PA 1JX6A 1ADGA 1OLUB 1GAEO 2J31A 3CO5A 4UAGA 2J67A 2B3TA 3FNHA 4PGAA 1E1QD 2B5VA 5ALTA 5C8VA 3AF6A 4OK3A 1HOXA 3ZWDA 4JUCA 2Q3CA 2OCKA 4U02A 3E27A 3TUJC 2OVFA 2RGEA 2X22A 3GROA 3EXAA 1IXZA 1OX4A 2Q29A 3WI7A 2ZCUA 3IAFA 4Q5IA 4AQDA 4B2YA 5LP6F 1JDJA 3TQSA 1RFGE 3QEKA 4NNPA 2W43A 2IZ1A 1Z47A 1UT6A 2C1ZA 2R3SA 3EQ2A 3LP8A 4G5XA 1GGFA 4BNYA 1VL8A 2K4MA 2JHPA 3AF0A 3H5VA 2ZBPA 2XKBA 2C1XA 5GGYA 2XVMA 3O03A 4D5GA 4OX9B 2C7PA 4DY6A 4JOQA 4UMDA 3A1VA 2R97A 2P90A 2WJIA 2XGOA 1P5RA 4FXPA 4IWXA 4LXUA 2DWCA 4ADSG 1GPNA 4MPRA 4U9UA 4ZXFA 4R1LA 2I7VA 5KOIA 1U9CA 4MIEA 3UW3A 1QO9A 2HU2A 3GVCA 3RU3A 2O4CA 1XX6A 3NIBA 3MGKA 4EYQA 3E22B 1T5TA 1ONBA 4ITVA 5FQAA 2F67A 4P3PA 821PA 4OHVA 1BA2A 1EJ0A 1XCLA 4DLAA 2B8NA 4LXXA 1H85A 3TLXA 1JLHA 4NFSA 2QRZA 2OGSA 4IYRA 3NI2A 1KEEA 2AUTA 2EEZA 1URPA 4PYLA 4JI1B 4E33A 1RRGA 1PEAA 2XNKA 3DEFA 3E9MA 3D3QA 2EHJA 4YMHA 1E2PA 1UKBA 3AEYA 4M8LA 5FLEX 2D0PB 5TGTA 3RKRA 3W9UA 2B1JA 2EG5A 3WGZA 3S2FA 2C7GA 3WRYC 3ABSB 1CF4A 1PLLA 4DCCA 2WF9A 3OJFA 3JQGA 1SBHA 3SGLA 4S2UA 5H59A 2W2OA 3RTBA 2JH8A 4B74A 4D6XA 3N2ZB 2ERXA 3B6ZA 3ZI7A 3RTGA 4JJ7A 4ZVPA 1RI1A 2ZK7A 5AI4A 1Z5PA 4RMNA 2FAXA 5LYYA 3F3SA 4MAAA 3TSYA 4YRBA 3BRCA 4OYRA 4AJ4A 2ZBRA 4R2HA 2EFDB 3TD2A 3SZUA 3MJFA 1JA0A 2B20A 3IXMA 4HTAA 5IDXA 3D8HA 4NDAA 1X7DA 3UUGA 2Q5CA 4WESA 1T6XA 5CPFA 5LIRA 1MIHA 4ARSA 3BYZA 3D5EA 1RXIA 1OIWA 3MINB 2FKNA 1NV8A 1PR9A 1W2HA 2FZLA 1KP2A 1T2FA 2BY4A 2W48A 3GV0A 2GERA 3AU9A 3NAGA 4J3JA 4V0NA 3HUDA 3QKIA 4B3IA 1E4EB 3DXZA 1L3IA 3TW6A 3ZYZA 1CFJA 1YJXA 4H7PA 4PN7A 1TXGA 3EEIA 5A3VA 4GLFA 4BIMA 3GRPA 4DIUA 5BWCA 3KTFA 4YUWA 1HM5A 2O0LA 1WG8A 4ZGBA 5CCDA 5A4FS 1ZNXA 2XH8A 1R8JA 4E1VA 2A9RA 4P7GA 5I8PA 1HETA 1PJSA 1GITA 3CMCO 3LBHA 2OQ2A 2PVSA 3JVIA 5THQA 2E37A 1XEXB 4LY0A 4MEAA 5G4KA 4QUJA 1AX9A 2ZJ3A 3EGXA 4H4EA 4QBFA 1LI5A 2FQ1A 2XECA 1T9DA 1WSBA 1AKYA 3NAQA 1XXLA 4HAYA 3UFXA 5KYYB 5DHSA 3N39C 2FRDA 3QITA 1W46A 2YWXA 3L84A 5G40A 4QJ4A 1RC1A 4F1WA 1Z7WA 3B5IA 1CUWA 2Q4OA 2ZREA 1T4BA 5IP5A 4R81A 3V9PA 2YVLA 3CWQA 2QN7A 1RVDA 4D9GA 1TYCA 3VPBA 1HYBA 1GXSB 4TTJA 2FMXA 3EX7C 2PANA 4X7BA 1PNRA 2WJYA 4KBFA 1GTG1 3VYUB 3FJ1A 3K6JA 3VOTA 1E60A 4AC9A 3V4OA 5UKDA 2AD1A 2ZWVA 4H7EA 3DONA 4ON9A 2NU9B 1TAUA 1E0DA 2YS6A 4QLOA 4RZ2A 1UXKA 1JWAB 3T8YA 3WLTA 4Y6SA 2HPZA 1EINA 1JKJA 1P1RA 1H0SA 5G0WA 5T3YA 5AW4A 1PG2A 4G4IA 2CFSA 4KDFA 1U0NA 4BFZA 1E6KA 2JFZA 3GT7A 4KO2S 4TT3D 2IH2A 5L40A 1DKOA 1DUIA 2CFIA 2NT3A 1PQYA 3GPBA 4RMJA 1N6HA 1G66A 1CE8A 2X86A 2YIVX 3FE2A 3R7WB 3A4NA 3U4AA 2J48A 3CNEA 4G1UC 5CRIA 2HN9A 3T7EA 1HDGO 4YJ3B 1LI4A 4WXRA 2PD6A 4Q15A 5JYCA 2Y76A 5D1NA 1NBAA 1JG7A 2NACA 2QX7A 5HBGA 5B55A 4ZA2A 1QH1B 4P4LA 3KWFA 4UPEA 3D6JA 2Z2JA 2BFFA 3CKMA 3TAUA 1E9SA 1V25A 2OO5C 4IRXA 1M9NA 3MRVA 4ZCSA 3GT0A 2PWBA 2YJ6A 4UBQA 1K68A 3K2IA 2G1AA 1OR8A 3B7PA 3D59A 3EGIA 1WBBA 4TZEA 4OHFA 1RADA 4XTCS 5F2NA 3PNPA 2FWJA 1K4MA 3SU8A 5BSUA 5A62A 4HFNA 3MWEA 3ZI4A 4CEJA 1G5PA 3IVGA 1QYWA 3JVDA 1RJDA 5K0WA 3HE3A 4GM1A 5DYIA 1G16A 5LMCA 3G2OA 1BNCA 3BMOB 3PDWA 3SK0A 1L2TA 4TROA 3V1LA 3ZNPA 1V1JA 3CMMA 2VJOA 1K98A 2XUZA 3T7SA 1R0KA 2WICA 2CLLB 4DMCA 5JS8A 3VISA 4HN2A 2BDEA 4OH1A 1WBJB 1JIUA 3SJAA 4WBNB 2I9KA 3BUSA 2X15A 1SUWA 4P3YA 4ZARA 3VDNB 5JJKA 3VR1A 5BQXA 4EO7A 5CB4A 2ZE7A 5B58T 1RNLA 1Z56C 1JFLA 4UM5A 1TVKA 4RVNA 1HDRA 1T0HB 3I3OA 3EEQA 4GKJB 3DM5A 1MD9A 4F2HA 3NHLA 1R5BA 1L7NA 4CLHA 4F85A 4II2A 3TEJA 4A15A 1W5TA 1N1DA 1M1XB 3I8SA 5BR1A 4B09A 1T2VA 1NBMD 4WKNA 4BKRA 3PD1A 3CR7A 1CD5A 2X7XA 4NFHA 4C14A 5CA1F 3LUBA 3D54D 4LVOA 5U1PA 1E0SA 2P40A 3AB3A 1BW9B 3CO0S 3QUAA 4FP9A 3D8RA 3MWYW 4ZVTA 3WHIA 5HYVA 3BV6A 3G3EA 4E5VA 1P61B 5H0IA 3V3TA 4GP7A 1ZEMA 4KN8A 3KU1A 1FFSA 1WXEA 2C9ZA 5AKXA 1OLSA 4BLTA 4AM8A 4WY8A 1M0TA 4FZRA 4QTTB 4QU8A 1U0JA 1ENPA 2VNSA 4FX2A 1MRSA 2EATA 5A7HA 2PMWB 4A73A 2OM2A 2JJQA 5BRNA 3AF2A 2PV7A 3DCIA 1JNYA 1KDPA 2W90A 1PNQA 3LGXA 1U2RA 2V7PA 5ESRA 1ZA2A 2BZGA 4LRXA 1X7WA 4UM8B 3LLUA 3DFUA 2PUCA 3EFEA 2JK1A 1UF9A 1EBFA 4OY3A 2BKUA 2UYOA 1SOWA 3OY7A 2X7JA 2PX3A 1T8PA 2C4MA 4MVCA 3OC0A 3R5TA 1IBMB 1KI9A 1N7HA 2YXNA 3BXPA 2V7TA 2OG2A 4MV4A 1TCVA 4LHVA 4UTXA 1F51E 4BEBA 3RDPA 3ZBQA 2HQOA 3UN1A 3CM0A 4B5LA 4UBLA 1XT6A 2ZSFA 3NKLA 3UQYS 1G6Q1 1TNDA 2WJWA 2XWPA 3TPFA 1TIKA 1COZA 1LSOA 4EA9A 2R65A 4IQFA 3EZXA 1WCIB 3AOEC 3R7FA 1ACMA 5ICFA 4DQXA 1B4DA 3FN4A 1YQQA 3I76A 3TEFA 2ERCA 4RZIA 5G53C 1G5QA 4MUYA 4EKNB 1LFDB 3LNCA 4P53A 4ND1A 1XEAA 1DKUA 4FGKA 4QZVA 4I7EA 4UNQA 1KVUA 3A9SA 4MDHA 3UTDA 4YQFA 2VHYA 3M70A 2CCKA 1AS2A 3OZAA 4M1KA 5IXSA 4TXHA 2AEFA 3PGJA 3DBHB 1ARZA 4G09A 3ZCTA 2P2LA 5JDIC 5ITWA 3F9OA 3HDHA 2EJUA 2H65A 1DXQA 3NWPA 4CLDA 3D3EA 3QW4B 5IEBA 3DTNA 2Q41A 4Y9SA 1TEHA 2AW5A 1Q77A 2BN4A 4GLBA 5F2KA 2JAWA 1W4BA 2WDPA 3FYHA 1TZBA 3I9FA 4HQ6A 1T26A 3LW8A 1CVIA 4IJ5A 4MA4A 3ZV6A 2REOA 4OHBA 4YRZA 3ZWNA 3TQHA 5BPFA 5FWXB 2OBFA 5DLPA 5B3AA 1D5CA 2A0FA 3TNJA 1W85B 4KODA 3IXLA 4O3MA 1JRLA 1VZ2A 1GLNA 2A9KA 3LA8A 4XDZA 4IDAA 3NEJA 1KJNA 1YR8A 2DWPA 4FOOA 4CT0A 5DJ5A 1NGSA 4R8LA 2W98A 3HB7A 1WUOA 3MWDB 2C5AA 5JHHB 5H4GA 3PLAE 2NXAA 1M2GA 1NJFA 2BGRA 3TQCA 5LNK1 1XQXA 3HVRA 1SXJE 2Q49A 4ZZ2A 1XKTA 4EYKA 1NQTA 3I6BA 5IYZF 2WDZA 4CQMB 4PO1A 3BD8A 2J0QA 4DY4A 2I2DA 2XUQA 4JB8A 4D02A 1L4LA 1XA4A 4IIFA 3WIVA 2NZYA 4AUEA 1P60A 4UWPB 2Q2OA 3IILA 4BHTA 4EJ6A 2UZ4A 3F5FA 2CNBA 3ILHA 4TTAA 3X1MA 4C2TA 3AVYA 3LXRA 5HISA 4IUDS 2J0EA 1EAYA 3BGSA 5FV4A 2ZBUA 4DNXA 2BG6A 3TVDA 4JI2B 2EDAA 2V8BA 3S7ZA 2VDQB 1MRZA 2VH5R 4JOBA 1IEWA 2W71A 4O63O 3T06B 3ETGA 1T6ZA 3HXKA 1C81A 2XMSA 3O8LA 5I4KA 4LZJA 1JLMA 3FSGA 2QN8A 3F6BX 1C4KA 1Z6PA 3KOYA 2C29D 3I37X 3V9AA 3LF1A 3W1VA 2JGNA 4X44A 2QPLA 2FFQA 4QD3A 4AZTA 2OCBA 4CIXA 5LE1A 5T5QA 1DBVO 4KGVA 2QROA 4O4IF 3TOCA 3VZQA 2E4ZA 4MCAA 1M10A 1ZDMA 2ZYAA 1XF9A 4I4TF 4AWXA 4L0DA 3LUHA 1ZKMA 4B6QA 1HYQA 2Y1CA 4KIJA 2E85A 1J2EA 3N0RA 3VR6H 4AXXA 4D0SA 1PL8A 4LOJA 3K70D 2FFJA 4KG7A 4AJ2A 2P5SA 1D04A 2QRJA 5FI0B 3WK8A 4FFPA 4RSGA 1E89A 1XRNA 2FR1A 2C3PA 5LBTA 5NULA 1V48A 3M81A 3ZLTA 2YWFA 2G70A 5KSPA 3IMEA 4FFWA 3T3IA 3LVFO 4JBWA 3H2HA 5BQFA 2DJIA 1YB1A 1E6MA 4FJ0A 1KAHA 1JT2A 1AQ6A 2O2GA 5HFJA 5HF8A 4PLWA 2VZ0A 4OJQA 4DLVA 2D5BA 3NDIA 1YSCA 4BWFB 3QU7A 4JXJA 1GHTA 1P4RA 2LPMA 3UJ8A 3FHOA 1B41A 2JPDA 3SS9X 2GNOA 3KUUA 5CA0F 3GC6A 4DA7A 1QANA 3T9FA 4J03A 5E9JA 1DSSG 4BMPB 4F5DA 5LDDC 2BC2A 3HDGA 4K1LA 2IY9A 3WWDA 2OFXA