5A0VA

Catalysis and 5' end sensing by ribonuclease rnase j of the metallo- beta-lactamase family
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
454
structure length
454
Chain Sequence
SHPHPELGRPPALPKGGLRVTPLGGLGEIGRNMTVFEYGGRLLIVDCGVLFPEEEQPGIDLILPDFTSIRDRLDDIEGIVLTHGHEDHIGGVPFLLREKPDIPLIGSKLTLALIEAKLQEHRIRPYTLEVAEGHRERVGPFDCEFVAVNHSIPDALAVAIRTPAGMVVHTGDFKMDQLPLDGRLTDLHAFARLSEEGIDLLLADSTNAEVPGFVPPERDISNVLRQVFANARKRIIVASFASHVHRIQQILDAAHEYGRRVAFVGRSMVRNMGIARDLGYLKVPPGLVVDVKTLDDLPDSEVVLVCTGSQGEPMAALSRMANRDHQIRIVNGDTVILASSLIPGNENAVYRVINGLTRWGANVVHKGNAKVHVSGHASAGELLYFYNICRPKNLMPVHGEWRHLRANAELGALTGVPHDRIVIAEDGVVVDLVEGKAKITGKVQAGYVYVDGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE J
publication title Linkage of Catalysis and 5' End Recognition in Ribonuclease Rnase J
pubmed doi rcsb
source organism Streptomyces coelicolor a3(2)
molecule tags Hydrolase/rna
total genus 149
structure length 454
sequence length 454
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 5a0vA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5a0vA01
4C1FA 2P97A 4GCWA 2I7TA 4AX1B 4C09A 4ZO3A 4UWPB 5ACUA 2QJSA 2Q0JA 4XUKA 1DDKA 4TZEA 1K07A 3I0VA 3IOGA 3AF5A 5KIKA 2OHIA 4HKYA 5K4KA 1VJNA 3VQZA 5FQAA 4Z7RA 2FK6A 5AEBA 4DIKA 4RM5A 2R2DA 3PG4A 2GMNA 3KNRA 3X2YA 5B3RA 4FEKA 5K4NA 2H6AA 4D1UA 4J5HA 2FHXA 3L6NA 4HL1A 4ZO2A 5EH9A 2BMIA 4PVTA 3S0ZA 3I14A 5EWAA 4WD6A 5B1UA 4RL2A 2CBNA 5DPXA 4RAWA 2WRSA 2ZZIA 2UYXA 2ZWRA 4UAMA 2BFKA 4KEPA 5AHOA 4TYFA 4BP0A 4CHLA 2P18A 4EYBA 5EVBA 1X8GA 5ACQA 2YNUA 4NQ4A 4YSBA 1A8TA 2FHXB 4XWTA 2AIOA 5A0TA 1A7TA 2Y8AA 2FM6A 3DHBA 4C1CA 2BR6A 3G1PA 4D02A 2WYMC 2BG2A 2VW8A 5AYAA 5LS3A 2YNVA 2BC2A 3ADRA 4TZFA 5ACRA 3IE0A 1Y44A 5LCFA 3ZR9A 4Z5ZA 4C1DA 1KO2A 2BG7A 4NQ2A 1WUPA 2NZFA 2DKFA 2NXAA 3T9MA 4H0DA 2BGAA 3ZQ4A 1JJTA 4C1HA 3PY6A 1YCFA 3SBLA 4D1TA 4EFZA 5LCAA 5LE1A 5AXRA 3RKJA 5HH6A 5K0WA 3DHCA 3IEMA 1X8HA 4AX0B 2YNVB 4NQ5A 2GKLA 4EXSA 5FQCA 3KL7A 2QEDA 3BV6A 3MD7A 4C1GA 2BFLA 4UWOB 4AD9A 1JJEA 4JO0A 2P4ZA 4F6ZA 4YSLA 3X30A 3H3EA 3KNSA 3FAIA 3QH8A 4D1WA 5LSCA 4YSKA 2Q0IA 2Q9UA 3Q6VA 1QH3A 1DXKA 5A5ZA 3VPEA 3WXCA 2NYPA 5KILA 1WW1A 2DOOA 5ACTA 3BK2A 2M5CA 5EVKA 3JXPA 2GFKA 2BFZA 3I11A 2Y8BA 4C1EA 5ACVA 5EHTA 5LLDA 4UA4A 3F9OA 4LE6A 4Z60A 2AZ4A 2Q42A 4RAMA 5ACWA 4UWRB 3IE1A 4D1VA 2HB9A 2ZNBA 3ESHA 2QINA 2YZ3A 4F6HA 4EY2A 5IQKA 3LVZA 4NQ6A 2Y87A 3I13A 4UWSB 5LCHA 3RPCA 3I15A 4EXYA 4XWWA 2BFZB 4UBQA 5FQBA 1MQOA 1BMCA 3AJ3A 4V0HA 2WHGA 3SFPA 1VMEA 2GCUA 5LMCA 5LM6A 4TZ9A 2WYMA 3T3NA 4U4LA 1KO3A 2I7VA 2GFJA 5A0VA 3PY5A 3ZWFA 5ACXA 1X8IA 3T3OA 2BIBA 4B87A 4Z6XA 2YNTA 2QDTA 3BK1A 4GYQA 1HLKA 1JT1A 4DILA 1XTOA 5EV6A 5ACSA 5HISA 3IDZA 2FU8A 3IOFA 5HIOA 2QDSA 2FU9A 1YCGA 2BG6A 3R2UA 1L9YA 1DD6A 3BC2A 5AHRA 1WRAA 2FU6A 4FR7A 2FU7A 5EV8A 2OHJA 3X2XA 2E7YA 1XM8A 4ZEJA 1BC2A 2BG8A 1KR3A 2YNTB 5B15A 1SMLA 5HIQA 4AWZA 4KEQA 2YCBA 4RL0A 4O98A 3P2UA 4FSBA 5AXOA 2A7MA 5HH4A 5A87A 3SRXA 1ZNBA 2WYLA 1QH5A 4BZ3A 1M2XA 4TYTA 3RKKA 2P1EA 1YCHA 4PVOA 5EW0A 2NZEA 4RBSA 1P9EA 2OHHA 3X2ZA 5ACPA 2BG8B 3IELA 3SW3A 3IEKA 3SD9A 4ZNBA 5K4MA 4Z5YA 3AF6A 1ZKPA 3A4YA 2YNWA 1BVTA 2BTNA 4EYFA 2ZO4A 1E5DA 1ZTCA 3SPUA 4GYUA 2XF4A 5EVDA 3FCZA 2I7XA 1VGNA 3TP9A 3DHAA 5HIPA 4J5FA 3DH8A 5HH5A 4Z67A 1WUOA 3IE2A 4AWYB 4TZBA 4P62A 4HL2A 4EYLA 2XR1A 3ZNBA 2M5DA
chains in the Genus database with same CATH superfamily
1TU3A 3NHKA 1Z68A 2C2KA 1K89A 1O1YA 4L4ZA 5HUHA 1FK8A 3C6ZA 1GARA 4M0FA 5JTUA 1YBMA 1RT9A 1M34A 2RIRA 1QPZA 1ID1A 2AJBA 2HDWA 4DCUA 2BHNA 4BVAA 3AZOA 3C3JA 3DB2A 4RK6A 3KYCB 1HORA 3K09A 1YIDA 1OX6A 1SJ9A 2RHJA 4KBGA 3HB7A 1Y7HA 4OB8A 2P79A 4BVJA 4BGDA 3W9BA 3EEQA 2Q5IA 4GF5A 3RJ9A 1F6BA 3TBFA 5IKXA 3U39A 1AXEA 2PZGA 3HNOA 5B7PA 1Z4JA 5HUJA 2I6XA 4UFOA 2I4MA 5MN6A 4UM5A 2QLJA 4QUIA 3GNTA 3PQFA 4QJBA 1HSOA 4QWMA 5TT1A 1FRZA 4BNZA 4RZ3A 4O4JB 3GC6A 4MLZA 2FQYA 1YI0A 1LFDB 3KC2A 3LDGA 4HLCA 4DLTA 5F7OA 2R2DA 5KYUA 1ZXXA 4YDSA 3SXJA 1NYQA 3DEYX 2AQ8A 4X93A 3DBVO 3I0NA 1XWIA 3O0DA 4J2OA 4A2WA 4X3PA 2L69A 2MIIA 5J5AA 2WPNA 5CEJA 3MOSA 1D3AA 4R2MA 4TQ9A 1XAIA 1I6MA 4X1IB 5BSMA 3WYDA 1JE0A 5ITZB 1QU3A 1W4AA 3QLVC 3A4MA 5I7EA 5CHYA 3VV2A 1EP2B 4NYJQ 4UJ5A 5KC8A 5FL7A 1A72A 1JIJA 1T4CB 2FSVA 2WAOA 1KL7A 2GN0A 3Q72A 5EWLB 5F7JA 4BKRA 3BJIC 1Z38A 2FPGB 3J7AC 2FWPA 3NB0A 1JLLA 5AKIA 3HCAA 2C2WA 1L8XA 2WM3A 2RHMA 5REQA 3T5BA 2VPIA 1EBBA 4YAOA 1YR9A 4JKYA 3IPCA 3WXMA 1WWKA 1YBFA 2PKEA 1WXQA 2MYTA 3I5MA 2P4UA 2X5KO 3OJEA 1NYLA 1KI6A 3SFTA 2XVZA 4MV1A 4UNRA 2FWMX 4RL2A 4QEKA 3RSFA 2EW8A 4FFDA 5AXAA 3S2ZA 1MJNA 1YU9A 2J59A 4UNNA 3UTDA 3BMQB 3PPVA 3UWKA 2YJZA 1V9CA 3DF7A 4IOKA 1W93A 1YRYE 1QHGA 2IZ5A 2PX5A 3MWGA 2VHVA 4JGGA 4MEJA 4PG6A 3UY4A 4CMIA 2UYXA 2ZWRA 1O95D 3EQ8A 4UAMA 4CDMA 5ALPA 3M5WA 3A3NA 3LCMA 5LOVB 4U6QA 1AN9A 3EZGA 3STHA 4JJ8A 2VYVD 1VG0B 2XZOA 3KEOA 3RUHA 2CVZA 2OD2A 4C05A 1MX3A 2C4WA 1VKHA 3N2NA 4JYCA 2WKWA 1NPTO 2QM0A 4YT5A 5HG0A 3A32A 4RWEA 4KDEA 3T7SA 3HFRA 3UJNA 2H7CA 3GEDA 1ZJ6A 5AM2A 2RDMA 2IOHA 3RNLA 2BFEB 4V0OA 4C0JA 1EA5A 1RQLA 2YYSA 3HHPA 1HRKA 1Y8ZA 2XH8A 1UBKS 1OREA 3DBLA 4CHGA 2GK3A 1C30A 1WV0A 4J8PA 3DQQA 5LXTA 3ZW9A 2B20A 1FVXA 1I01A 1PW5A 3LBYA 5G0WA 3V6LA 1E5QA 4S1PA 2O06A 4TVBA 1R0LA 1QE5A 5PGMA 3SQLA 4LWOA 3SSMA 2DB3A 1ONBA 2OCXA 1B4DA 3EGXB 3ADPA 4GPTA 4OQMA 1UZMA 1U11A 3ODGA 4WH0A 4RD3A 5DBFA 4P5PA 4W7SA 3TKAA 1HURA 3NBAA 3PXDA 2ZOSA 5AYAA 1XLVA 2ONKA 4PGHA 2IYTA 4KK3A 5ALFA 5E8JA 4B44A 2QN1A 1FYDA 5CXXA 1A2KC 3ZBPA 1T8PA 2C7PA 2JATA 4IMIB 2OFFA 2XCSB 2QG4A 4YAJA 2PZMA 4TTVA 3DOUA 2H1SA 2RIPA 1A2BA 5JAOA 1PJSA 1XRMA 5B7GA 3FNIA 2FZEA 3Q41A 1DRJA 2WOOA 4JZKA 3JQ7A 3OT4A 4H7HA 5AJWA 1RPAA 4KQ6A 4AKGA 5F2OA 1E63A 3AT1A 5DLDA 1L7NA 2H7YA 5DLYA 3VYSB 2YC4C 2H18A 3N6RA 1WULS 1SKUA 1PLLA 4G0MA 4JEIA 3PSHA 5C37A 1VE1A 2HJGA 4AKEA 1FFSA 2XNDD 1XRPA 3O8LA 4WMLA 3GCDA 1DO8A 4N39A 5L7YA 2R8XA 3W2EA 2ST1A 2TRSB 5T7BA 4EO4A 1K3UB 4R3UC 4Z53A 1KYTA 3IMCA 5DW0A 2P4EA 2OGSA 4ZQGA 3SBLA 4ZVNA 1TO1E 1BKSB 1VLVA 1GL6A 2Q6LA 2Q4EA 3T5TA 4YRKA 2OAEA 1RPJA 5HS6A 3TLXA 3V4LA 1X7YB 4C89A 1DX6A 3JQ8A 4DCJA 2AE2A 2HCBA 2O0LA 2WR8A 3AI7A 1G0NA 3KJIA 4LV5B 5FTMA 1AKRA 2M1XA 2UVPA 2AEMA 2GH1A 5I4BA 2ID7A 1KYYA 1O4VA 2ABWA 4O59O 2EG5A 3NFRA 2FWBA 4U2EA 5KKAA 5K7SA 5L53A 1ZH2A 3NTXA 3B82A 4GVXA 5FQCA 4LSZA 3VFDA 4G25A 1VJDA 3VYUB 2ZRDA 5FPQA 2FZGA 2NZ2A 1RWPA 4N8DA 1TA4A 4MUFA 4L8GA 10MHA 1NVTA 2OV4A 2BFLA 1N6OA 2M1ZA 3BWMA 4TVOA 3WIEA 1LI4A 4M6WA 1KARA 2HIGA 5K20A 4HH1A 2PT5A 1X1AA 3D6NB 2I4NA 4Z8YA 1GSAA 2PMWB 3MTDA 2VRCD 1AKTA 4HDNB 3QG5A 5EC8A 3W1VA 2DJIA 4EAAA 4MK4A 5T3YA 3ZK9A 5FYDA 4YGXB 3ER9A 4OQQA 2QRGA 4D79A 2RK4A 1Q1EA 3QBTA 2ZETA 4ZXPA 3L8MA 4OXYA 3IL2A 4I08A 5KEIA 3C1TA 1WUHS 4YX9A 1NU6A 3GAZA 3PC4A 5KKNB 2UXCB 1DC6A 3PFFA 4Y2YA 4JIMA 2C7BA 1ORTA 3OZ7A 5AWFC 5C4IA 1WBDA 3LQ1A 4KN6A 4HYTA 3GD7A 1ULTA 1XG5A 1QRUA 1OFTA 2O50A 4BJ1A 5CA0A 4U7GA 2XYVA 5G1PA 5LBUA 2EFEB 1O6FA 5JS2A 2P4HX 1M83A 4F5DA 2WABA 3GJ5A 3PC6A 3QW2A 5HKLA 1S2OA 3N2LA 2HW8A 4ECAA 1BMTA 2REQB 5L3QB 1IM8A 2FUKA 2HY7A 1RHKA 2JIQA 4W1SA 4XCVA 5FR1A 2O54A 2FSGA 3UQZA 4KMMA 1I0LA 3WAKA 4D2IA 2BMDA 2H57A 2YYZA 4PQRA 3N39C 4XGQA 4K86A 1E98A 1QF9A 4GBMA 5EUBA 2AXQA 2JFNA 3MWJA 1FL9A 1QX3A 1V5GA 1VSVA 4HUJA 3WK4A 4EVSA 2ZWAA 4GXQA 3SP1A 4XM0A 1RPNA 5CB4F 3BFJA 1C8BA 1YHNA 2F1KA 3UJBA 1TF7A 5EJ7A 2XI4A 3KRTA 2QLNA 2ZJ5A 5AXBA 3KXLA 4OJMX 5BSEA 2BZSA 3LQFA 1YRAA 5A4AA 3D1VA 1FXSA 2PD4A 4E2FA 5DF1A 2FWNA 3RUFA 3X1JA 3P9KA 5IANA 3W5AA 4A10A 2YFYA 4JLOA 3WHPA 2QBYA 1V8BA 2VA8A 3RIMA 1JDTA 1G98A 5JNWA 1T8RA 3BXPA 5H3LA 1L5VA 4MW4A 2VK8A 3WO0A 3WYNA 4LE6A 4EB6B 1VHWA 3P9QA 5ARCA 5IPFA 2VDNB 1G4HA 1Y5IA 2YWFA 2ZBUA 2QQ5A 3NETA 4FDVA 3ECSA 4HWSA 4ZAYA 1DGQA 4HYQA 1MHTA 2FQ1A 1U0NA 4IIJF 3C7AA 4OGGA 4WOJA 2YXPX 3VNBA 4LUCA 5JEEA 5JJIA 2VJCA 2QRMA 2WWXA 3KSZO 5DX1A 1SBIA 1YNSA 4I9GA 4KXXA 4BX8A 3VZBA 4GKJB 1T9CA 3VHXA 3NALA 2HB9A 1RWQA 1NF8A 4P2GA 3UHAA 1ZU5A 3W78A 1TLLA 2PXAA 2VHYA 4HLUA 1LTHR 3IJRA 3T38A 2QUAA 3T4XA 3UN1A 3P8ZA 1CB7A 1P5ZB 2JIRA 1M76A 4LBYA 4Y6GB 4REMA 4EJSA 1CNEA 3FKSD 2WIBA 3ITDA 4HDAA 1RADA 3T5AA 4JXZA 3KO8A 3K9QO 5CP8A 3WLRA 1UWKA 2XMCA 4MR7B 1GXSA 1P77A 2O4CA 1R6TA 4WQMA 3ZGXA 5JWOA 3E58A 3K70B 1MVNA 1UDRA 1ZESA 3H1GA 4Q3AA 2V6FA 2WOJA 4WN9B 3THOA 4Q9NA 4F60A 3ZGZA 2O8CA 3KEQA 4BNWA 5CDFA 4R1MA 5JRZA 4BFLA 2C7VA 5JW6A 3N2KA 5AW4A 1CPYA 5CFZA 1ODJA 3QWIA 3LVBA 3BRCA 3JWHA 2PBLA 4S1TA 1C2TA 1U4SA 4F3CA 2WHGA 4R1NA 3QFCA 4G5FA 3FTEA 5MDHA 1KAOA 5LP6B 2GCUA 1ODKA 1XJ0A 5K8TA 1P39A 2ZU6A 4MKXA 4QFBA 1RU3A 1S3IA 2NNLD 3DNMA 1T35A 3R0JA 3B8HA 3K53A 4C6HA 2P8JA 4WK6A 1BQ4A 1NRWA 3ZD9A 1HA3A 2FK8A 3VZRA 1NV9A 2VC2B 5JD6A 3LGXA 1N9GB 3MBOA 1K0FA 1OU0A 3PUHA 3X0DA 1W0KD 1D2RA 3EMKA 2B2CA 1GZ6A 4IMRA 4OQYA 1Z62A 1ZDMA 2UUOA 4RZIA 3OZIA 5CDGA 4JWKA 1NI4B 3ZJTA 1M3SA 1F2DA 1EXWA 3A36A 1MP0A 1XZLA 3DT8A 3H99A 3L6CA 3EGCA 1DADA 1ZCJA 4JR2A 4JI2B 5KO2A 3MJ4A 4EIWA 4OAQA 3AVYA 4PC7A 2OR3A 2VQFB 4J90A 1PUJA 1T3TA 3L6EA 4LCEA 1CFZA 1XMJA 2O0HA 3PFWO 4YR9A 1N5MA 2NZ8A 2WQ6A 3R5KA 3A2KA 4GYQA 2Y1DA 1ZM3A 5E4YA 4QATA 2DU8A 1LD3A 5ANRB 3KQPA 2EYUA 1XTSA 5LC1A 3KUUA 4UU8A 4ZQHA 3BKWA 1VHJA 3N76A 4E7OA 5LL6P 1K8XB 1ISJA 4NYMQ 3AZPA 1I6KA 3CF4A 4AF7A 4ND5A 3O3OB 4OV6B 3SFVA 5D85A 4BLWA 1H94A 4E2YA 4CF6A 4XJTA 3PCXA 5MN4A 1L7BA 3D4IA 3L43A 4EA7A 2AFHB 2OILA 5BQOA 1AHPA 2IEYA 1N6IA 1EE9A 1X9HA 3A3PA 2O2SA 4UCWA 9GPBA 1DCKA 3LYAA 1WTAA 2BDUA 5ADWA 4KMSA 2LZ0A 3K35A 4G1CA 4NZYA 4XWAA 5J2UB 3VR3A 4JHXA 1MRNA 1G8SA 4LGMA 1DTEA 4MMXB 1TYBE 4TWRA 2I3BA 3ZU5A 2CXXA 2ZGVA 4DJEC 1W5AA 2QZZA 4CTKA 5BYKA 4HQLA 2FRDA 2P41A 3KEGA 2JBWA 1DSSG 4P4NA 1XPOA 3M1IA 3QMPA 1LXCA 1UKBA 3O4VA 1NVMB 1UP7A 3R3XA 3V97A 4EMBA 3X2XA 3RT9A 4GVPA 2IYPA 4PC2A 1U99A 1VYTA 3F6YA 1E64A 1Y3FE 2C2XA 3QELA 4HDQB 5EFZA 3UA4A 1MD9A 4UAJA 2XGSA 3H5OA 5JDIA 1H6AA 4BB6A 1PGJA 4YYEA 4QXPA 1U1CA 2DHRA 2PRIA 2UYYA 3N07A 3O8OB 4WKPA 3IBCA 1YC5A 1E0SA 1UZUA 4Q5IA 4Q1VA 3GG9A 1Z5GA 7YASA 2JK0A 2ZYWX 4QDJA 4MVJD 3RYHB 2G1AA 3D4NA 2VDUE 2CK3D 3RIYA 4EO7A 2ZIVB 4J0CA 3SRXA 2FOXA 3HWX1 4O2BA 3QJGA 1R4MA 3LOQA 2ZUFA 3O92A 4TUYB 4BAZA 3DW1X 4A1FA 2GSWA 4BFVA 9ATCA 1KO5A 3D6VA 3O4RA 2H4XA 1JQDA 3EZ7A 3HKEB 3NBQA 3JWIA 3NNSA 3JR7A 2FW1A 4JB0A 4M98A 2R8RA 1IY0A 2QK4A 2VT6A 4HUQB 4U39A 3VSDA 5LQMA 1XPUA 5BWCA 1GVHA 3H2IA 1H0SA 2CNOA 4YJ2F 2OAP1 4Y30A 4ND7A 1YQXA 1EWTA 1KMNA 4BMYA 1MB0A 1H2RS 4PYKA 4E6EA 1P60A 3EE6A 3OZAA 4RSRA 4DLKA 4CMEC 5HNKA 3B3AA 3WBJA 3G82C 2I33A 1ML4A 3AJAA 3TNJA 3O47A 3K70D 1CUHA 3P9CA 4KXLA 3WKBA 3HBMA 3GQBA 3WWYA 3H6GA 1QBGA 1RD4A 4PYNA 2Y0PA 1VI5A 2GN6A 2XDAA 4I5GA 4Y1RA 5HTOA 3KYJB 3HV0A 4HMOA 4A1OA 4OYLA 4JB2A 4S35A 4IJWA 3F5SA 1AGPA 2YNWA 2IUFA 4M99A 5AVUA 3RWOA 5C80A 2YFQA 1KEZA 2OV1A 2QXUA 4DMKA 5TPZD 1V47A 4BXOB 1J97A 3CFYA 1XQYA 1ESDA 4RANA 3VOTA 3ZHZA 1CB0A 1VJRA 2Q4BA 2JANA 4N12A 3TBHA 5A3JA 5JUWA 1IWBB 4H0CA 1A88A 2WYUA 1IJKA 3OETA 2C4VA 3LF1A 3KB1A 3WDSA 1KAEA 1MKYA 2J87A 1VBKA 3GJTA 4WKNA 4Y18A 1HLFA 2JEZA 2YH2A 3PE4A 2GZ2A 4QEDA 4UU0A 3HWSA 2J0UB 3DVAB 3U7IA 4ZCLA 4YCMA 1QVRA 1OGJA 2R68A 3GLFB 2P2DA 1Z26A 4NSNA 4FFOA 1Z2CA 3T9CA 3DR5A 4P33A 1EHYA 4YAUA 2AEJA 3X1KA 5A1TA 2V5AA 3ZDZB 3ZI7A 4B45A 4B3RB 2Q62A 4TZKA 2NU8B 4D26A 3D7KA 3HCPA 4A6XA 1EWKA 1U0LA 1I33A 3FPKA 3I9LA 4MVWA 4Q9DA 2XOKD 4TXLA 5A6SB 1AUOA 4U7JA 1C7ZA 4JJAA 3B12A 3O8BA 4CV2A 2CSUA 5AW5A 2AWNA 4M53A 1G9XA 1MNAA 3LLCA 3NEPX 1NC3A 4HH4A 2YN2A 1Z7YA 2BFDB 4CFZA 4K03A 3TTXA 2H7XA 2C4TA 2EBWA 3AK4A 3FA2A 4HJXA 3IR5A 4WINA 2AN1A 1UC5B 1EUDA 2GDJA 1K88A 2NAFA 3R8XA 1O6GA 2I7TA 4W5TA 2Q6VA 4IV0A 4R51A 3TRKA 2RGXA 2IEBA 3BEOA 1EFUA 1O6CA 2YDXA 4YCNA 1FRNA 3VTFA 3L02A 1CQXA 2QVYX 2X0EA 1YH3A 3IV9A 2SKDA 1G38A 3QEKA 4YI3A 5BT9A 3LYLA 4LRXA 4DM3A 5A3RA 2HN9A 5K8IA 3GLGB 1WSWA 4RY2A 2ZT5A 2P75A 4YVFA 1K07A 4Q7JB 2SCUA 4IZHA 4TLDA 4KDCA 3UOWA 1CZUA 2IKQA 1LZLA 4OHKA 3RODA 1CBUA 3PXXA 4B3CA 3L7AA 4B81A 4ZMSA 1K3TA 2CXOA 3B6ZA 1JQ5A 2F43A 2Y0BA 3DG9A 4KLAA 4Q01A 4EATA 1OBCA 1KDPA 2BM8A 5AEBA 2Q3BA 2FK6A 4EPYA 4IXDA 4LRSB 4F1JA 1WO8A 3JSXA 3F6EX 1WCV1 3OA0A 3FWZA 4GKAA 4H9GA 4FN5A 4GG1A 4QYSA 5BUQA 5I5EA 5G3ZA 5IJ9B 3ILVA 1GZUA 1Q57A 1HF3A 1EVEA 1BKYA 3HKCA 3RU7A 2WF8A 4EKDA 1OH5A 1ORWA 4C4YA 4X91A 2J85A 1AQYA 3GYBA 4BMDA 1ISSA 4J6EA 3RARA 1AA6A 1TADA 1BJKA 5J40A 2B7CA 3EWAA 5DU2A 3O2NA 2XLCA 5EH9A 5F9MA 5SYNA 3T3HA 2ET6A 2VYFA 4RGYA 3TQHA 1X7XA 1JIVA 1VE9A 1WS6A 1SQ6A 4TZ6A 2N75A 3ZJYA 2PKRA 3UPUA 2VP4A 4G1MB 1J0BA 3TLCA 3OQ1A 4WZBB 5CT6A 3OE5A 2VAVA 2PS1A 5KQSA 1KZHA 4GWKA 2AGVA 1V45E 5ERYA 2F48A 2NVOA 2HRZA 3KJNA 4IJKA 2LPMA 1SRQA 4KG7A 2F55A 2HMSA 2F6RA 4P3OA 1BOOA 2ZKIA 1IG3A 2EGUA 1W581 1MO2A 1Z6YA 3PITA 1CRLA 4RPCA 1E2BA 3PXCX 4KEPA 4QTYA 5JBIA 1F6DA 3L1IA 3LHIA 5EA2A 4CQNA 3IIIA 4JXXA 3ZTWA 1NVAA 2FFAA 5DNYB 4YLYA 2C3MA 3QH4A 2GD6A 2Q3LA 2YV3A 2JFFA 3L9WA 3WKEA 3B8EA 3NXSA 2WPDD 2QHXA 2I78A 4D0RA 5JSYA 4ALMA 1JDPA 2GHRA 3NEJA 1E7RA 2H1CA 2QYHA 3X1ZA 3OQOA 4D8TA 3HXMA 1JKJA 3RLFA 2VJMB 2R85A 3HZOA 4XWTA 1QE0A 3FJYA 2EU8A 3PD1A 3SJUA 5C2JB 2JLXA 3ADCA 4EL5A 2I1QA 2F4VB 1WV1A 4RE5A 4X20A 1YB6A 2BR6A 3A9TA 2HFJA 2PGLA 1TUBA 2ZYUX 2PO7A 3AOEC 4GP9A 4Q12A 3MSCA 5CLGA 3VHLB 3QUBA 1E1QA 3TMAA 3WAJA 1XF9A 4GI5A 2XD9A 4L76A 3TLJA 4E03A 4I1PA 4EOGA 3D43A 4NOKA 1SBQA 3ZZMA 3WLLA 2XXBA 4GNRA 2QJFA 4IWXA 1HUQA 4HEHA 1I36A 2YBEA 4U9IS 1K7YA 1QYXA 2DPXA 2ODBA 5EKTA 2INGX 3CRW1 4BP3A 5AP9A 1Q95A 3DV9A 3NBFA 5CT9A 3RUCA 5EXDA 3ZXXA 4EARA 3AB3A 5K05A 4BNGA 5KJ6A 1CULC 4JLNA 4WACA 5DIFA 2ZIUB 3WDMA 1EEHA 1RXWA 2BG7A 1U1FA 3IQXA 3OCUA 4EHDA 4KO4S 4JLVA 4ZI5A 3SJZA 1CD5A 1MJFA 3H5IA 3GLHA 1LRJA 3V1KA 4CL8A 3I1FA 3E5MA 2O3QA 4TM8A 4BOYA 1KNXA 2VPZA 4WNYA 3KUXA 4MI9A 3BT7A 2ATXA 221PA 1KH1A 1G8JA 1J09A 3Q3JB 2A1IA 5FLYA 2MSLA 4PO3X 1C2YA 1QSGA 1OROA 3KNZA 3KYDB 4FEYA 5CBKA 1PF7E 2H54A 1HT2E 3LXMA 3ZG6A 3FIUA 4JJFA 3LCVB 5DYGA 3I01M 3ZUGA 5KAPA 3R3SA 3KVRA 3BL5A 2VWGA 1GFSA 5ALYA 4NS1A 5E4TA 1RMTA 1E2MA 3DTTA 3PC7A 5BQ3A 1R9MA 2I29A 3DE0X 2IH4A 2ZSUA 4B47A 1Z4OA 3PVZA 1BJTA 3PGLA 3UH0A 5AJZA 3I83A 4XGKA 2JAXA 4PRZA 4A6DA 3W5JA 2SICE 3LUCA 3CF6R 4K9NA 1E7QA 5EKXA 3F1KA 2A59A 4Y67A 1KBQA 2GWHA 2IYOA 1HMPA 3QUSA 4O2AA 4ZARA 5JAHA 1NXOA 3HDHA 2FEMA 5AIJA 4K8RB 2HLDD 4ZOEA 5JSHA 2PXHA 3WL5A 1ZVMA 4O4HA 1P0QA 2OHXA 5FA8A 4FW9A 3LLVA 4KAJA 1OX5A 4AM8A 4DIOA 2KBFA 1KYXA 1PNVA 4EUHA 1KEUA 1HQDA 1NR7A 3MUOA 4QG3A 4IPTA 3KUCA 2I5PO 1EFRD 2D74A 3B2QA 3KQVA 3BQMB 5I8WA 2H2AA 2H4JA 3JAWA 4MPPA 1O8BA 3QMVA 2H48A 1DPFA 2BISA 4IJMA 4WRRA 2BGLA 2DFTA 4H1UA 3NASA 4ZZ3A 3SM3A 3OU7A 1I0IA 2QX4A 1E18A 3N0XA 2DLDA 1SCBA 3K7EA 4B6GA 4Z4IA 4C07A 1C81A 1XNHA 2CZGA 5CU7A 2DJ5A 5HIJA 1O7JA 1JH8A 4IY1A 5IKMA 5D7BA 1F0NA 2DH5A 3K1AB 4LWQA 3BSYA 1OV4A 3RYTC 3VJLA 3WLKX 3BFXA 4FQ8A 2NZJA 2W6CX 4FD2A 1OH7A 2RARA 3ICPA 4QELA 2XZTA 3C2QA 4MWEA 4OP2A 3OX3A 4Y7DA 4K81B 4R9SA 4CV1A 1F8XA 2GYUA 4IOMA 4DLLA 3UGQA 3RUPA 4ZU6X 2WQ7A 2HBRA 3EPHA 1QH8B 1F5SA 2RHOA 3GMIA 2H9YA 4Z9BA 1GD1O 4R31A 1TF5A 4ZQEA 3V4OA 1PEDA 2OV6A 2DUUA 2C9YA 3E9EA 4FDTA 4J1NA 2CJWA 4UDOA 1NBEA 1M2VA 4B7ZA 1UJ6A 4RPIA 1WPRA 4X6YA 1UR5A 1GCIA 1T9AA 4RACA 3KHUA 5CLQA 4A92A 1PG0A 1CJBA 1EE2A 1KGSA 2X8AA 1G59A 2Q27A 3V4FA 1AM4D 3WGMA 4CN9A 1ESEA 4P5EA 4QUBA 3AEYA 1TYEB 3BRWD 2GBPA 2NOAA 3Q7SA 3A25A 4ETNA 1KMCA 3A1CA 1V4VA 3C15C 3BA1A 3M4JA 1VE7A 3CEJA 1N5JA 2RKOA 5L40A 3GRPA 1L5HA 1SZPA 3TQOA 3P2YA 4BWYA 3NC1C 1KHHA 2FZCA 4OHOA 3DHNA 1AKUA 3KAPA 2G63A 4MEBA 1JWAB 5BSFA 3K3PA 1NMSA 2HMYB 4URZR 4P32A 4PO1A 1Q77A 2WIFA 4HX2A 4YTEA 3SZGA 3VMFA 3PR1A 4BLSA 1N8KA 2O8BB 5AKXA 2FVXA 3OEWA 5DOZA 2QP4A 1OI7A 4P83A 2GVDC 3IA2A 3W5IA 3NIBA 4KWHA 3BERA 5E9WA 2XE6A 1ZBQA 4E2ZA 5AW8A 4ZYYA 4LOHA 2JHPA 3KX2A 4IDAA 5E95A 2XY4A 5SY4A 1RDFA 5DRYA 1VRWA 3U17A 4TQAA 2P7IA 1OSNA 1X7DA 1IOZA 1W34A 5K2MA 5J47A 2N42A 1G7TA 2ZEJA 2REOA 3FNRA 1IJBA 3EC1A 3KHTA 4WK4B 4QECA 2WU8A 3TG8A 5LZ9A 4XQCA 3FTNA 4NU8X 4V0HA 3SNHA 4JX8A 1U2DA 4LN1A 1OY1A 1SOAA 1YFLA 4FEEA 4ALIA 3CISA 2FE4A 2UKDA 3WWEA 1Y6RA 1XRNA 4E94A 2XDQA 2VPWA 3KCQA 1KIMA 1VDMA 1RPZA 2G71A 2RBEA 4NJOA 5A0VA 3PY5A 3JSAA 3T9AA 1WZIA 4I9NA 2I91A 3C97A 4ZO9A 4C7JA 5DP2A 5CAEA 2VDWA 1U0GA 1NFFA 3NWPA 5CNIA 1ZWLA 1JR6A 4FZVA 4F9GA 2QT1A 1PGOA 3DHYA 4JLDA 4G5XA 4PAQA 4PLGA 3UCXA 1N34B 4NFSA 1RZVA 3U9TA 5JROA 2W2OA 2JFXA 2GJKA 2F59A 3CT6A 1RPTA 3E4DA 1GG8A 4CCYA 5ACWA 5HRUA 3MN1A 3TB6A 3L0BA 1GIAA 3O8NA 5LB2A 1HFJA 2EF1A 1H23A 1HG0A 3M9WA 4LQ4A 3AVQA 1RTTA 1KA9H 2FRVA 3AFHA 3S81A 1CXZA 1SVIA 5BN3A 2FCRA 3WIUA 3PPYA 3UHPA 1HNNA 4JQCA 2JGLA 4D3XA 2JD2A 5LA6A 1OYOA 3Q6MA 5BYBA 1T24A 2OQIA 4L2IB 4XYGA 3P5SA 4DILA 1DRKA 3PB3A 2OUIA 3O73A 1MDFA 1P6XA 3D2AA 4MDYA 5FL3A 1ZXBA 4WOBA 3TWOA 2DC1A 2ILVA 3O3MB 5J2TA 2FYTA 1AD2A 3LKBA 4R83A 3CLUD 4RCZA 2ZUBA 1WDWB 3RBAA 2I2CA 1XV5A 5KCMA 3SQNA 3KWMA 1VL8A 3B85A 3EJWA 4B4OA 1YQ9A 4XQ9A 3OFKA 1Z39A 1T2AA 2EW1A 1KMHA 2JI7A 4LX8A 3I53A 3UJ8A 5IXSA 1V2HE 1SG6A 4L7QA 5D5QA 3QPUA 2VW8A 2ZRHA 4CMHA 3U44B 2AOWA 2QWXA 1S96A 4ZKDA 1EDEA 3KU4A 4UXJA 3IR6A 1SPBS 3UUGA 1U63A 2B36A 3AERA 1P33A 3AGPA 4L5YA 1UDAA 3GEIA 4PSUA 3VHRA 2BR3A 1U9CA 5L8VA 1Z2EA 1A1VA 1ZOOA 4OLBA 4ENQA 4FC7A 1EXNA 4H3KB 4MJ3A 4UCQA 1SK8A 3BZWA 3WLOA 4KI7A 3WK9A 4HRXA 3SXUA 1BAPA 1A9TA 1H0KA 1MDBA 2FN3A 2WJJA 2YXDA 3OPVA 4LY0A 5ALJA 2WJVA 3DYBA 2H9IA 5HQ3B 3E9NA 4RK0A 2OXRA 1RHQA 2GTPA 1B0UA 3KOUA 5C7YA 2IZ1A 3H87A 1WL8A 4LJKA 3ZGNA 4BY9E 2OLJA 3AVUA 4IGFA 4O98A 1Q0UA 5FNVF 1T9DA 2NVBA 2ZAOA 2XCOA 1EFTA 3ZWKA 3Q85A 1P1JA 5JSQA 4Q4DA 2VYND 1J0CA 2NXNA 3EWSA 2RKWA 1BXKA 3EGIA 5A87A 1GYQA 4JT2A 2BM9A 4W5RA 2B0JA 2ILTA 4U2KA 4B3MB 3RYFB 2IHZA 4LRTB 2Q5OA 1BX0A 3D6UA 3K6JA 5A4DA 2EG9A 2H1FA 3CSSA 1XHLA 1M2GA 3DYIA 4Z7RA 2H63A 3ETHA 1YB1A 2JBAB 4RHXA 5LB4A 421PA 4C4TA 2NGRA 3NGMA 3O91A 4OJYA 2O8DB 4L3WA 5JJLA 3QXGA 1QKKA 4EB0A 3ZLVA 2G9QA 5EW0A 2TS1A 2VCYA 1MABB 2Q1SA 3RRJA 3Q7TA 2VPTA 3WWZA 1E2IA 4DC1A 4AN0A 1T1EA 4POOA 2QTRA 4TKMA 1T0JB 4PLVA 4DIMA 4XVUA 3NKFA 5JSFA 3TQCA 5HTKA 1DHRA 1DJPA 3L6OO 3OO0A 4MIOA 4YT2A 4MVJA 2Z8ZA 5D86A 3AP2A 1T43A 4O3FA 3Q40A 4BKQA 5H70A 1WXXA 1Q19A 4BNVA 2QV0A 3ZXIA 4Q24A 3PQ4A 1FFDA 2QSUA 1QMPA 3QOWA 2AMYA 3TL3A 5HFNA 1NQAO 3FY4A 4DC9A 1EFHA 2BKLA 1N1MA 1AF4A 2BFOA 3I92A 3QA9A 4O4IF 5FI3A 4XFDA 5IJ0A 3AX6A 2IXEA 1QIMA 2VHJA 2PT9A 4PDXA 1VJGA 2EFDB 3CZQA 2GUWA 2ZIWB 3UHJA 1VJTA 3PG5A 3CPSA 1JHDA 4M8SA 2GK7A 3O75A 4XARA 1J99A 5FO0A 2V3VA 4B31A 2AJLI 4MWCA 3OM1A 4US1R 4YACA 5FP0A 4FD3A 5JI2E 3VA7A 2ATVA 1ZD3A 4H7FA 4I55B 5BMVF 2IFTA 3E18A 4LJ9A 4Y1FA 1WQ3A 3MTGA 1XGKA 4MW5A 2WF6A 4ISBA 3F96A 1NUUA 2BE7A 3SYMA 1Z0SA 3F9RA 3TO5A 5IJZA 2O8FA 2FN7A 2QRLA 3FFWA 3EZ9A 4LF6B 4DHEA 4TXNA 5HH5A 3PNPA 3MYYA 2EDCA 3CJTA 1M2JA 1GJRA 3EVNA 3OCVA 4B7UA 3QBEA 3IE2A 3IEIA 2ZREA 4RKEA 2HADA 2W6JD 4P62A 4R9NA 2O5RA 4ZICA 2PG3A 4FZJA 1FJHA 3NTQA 1V9SA 3LPLA 3TRFA 1O89A 2R4TA 5AVVA 4O8ZA 4O4LB 1O96A 2QVXX 1KZGB 2D62A 2Z2KA 5TPZA 1G3RA 4EY7A 1OH6A 3DH0A 4HL6A 3EUEA 3P5BA 1J06A 1PQYA 2BTQB 3EXG2 1EX1A 2IPAB 2VA9A 2WHXA 2OAQ1 3TLMA 1GNRA 2V98A 2GB4A 3OUUA 4GICA 4KAAA 4RS3A 1QMGA 3W6OA 4C09A 4EZEA 2FDXA 4UD6A 2FHPA 3PPWA 2HA4A 3E3AA 1PWEA 1EWRA 2YWHA 4DDVA 1QV9A 4BNHA 2CWWA 3FHLA 4MHSA 1XCOA 3WB2A 3F90A 4DDMA 4KGZA 1DAPA 2ZJ1A 2Q0JA 4NJMB 4OLHA 3FCCA 4XUKA 1WDTA 4FWTA 3T7DA 4E11A 3GT0A 1HDEA 4Q4AA 1VSBA 2CLOB 4DR2B 1XCLA 6ADHA 3I0VA 5KIKA 1IJFA 3Q8WA 4IJVA 2CFZA 3S5JA 5G41A 3WWCA 2CLKB 4ZOLB 1T0HB 4ZAGA 4B4UA 5BXYA 4OLFA 4TWAA 2XOKA 1YFKA 3IBFA 3DE6X 2JLVA 1JLSA 3IUSA 1K8ZB 3MJEA 1NYRA 4AS2A 3THYA 1Z5UA 2AQHA 4HMPA 5IMSA 2CBZA 3DZJA 3WY9A 3L8YA 4KVAA 2V1UA 2QX9A 4Z4HA 5ALLA 1LPNA 2FPIB 2ORED 4NENB 4RY9A 3PFKA 3WSVA 4BNYA 1QQBA 2QKYA 3CCCA 1BMFA 1C9JA 2EWMA 5DYWA 5BV1A 2VQDA 3K0CC 2G25A 1Z2NX 3NHJA 3Q0EA 3Q7QA 3U5TA 3CVWA 2E7ZA 3KSMA 2Y8EA 1LSSA 3CSDA 3C4QA 2GD1O 3EVAA 2V96A 2MMGA 3C3PA 4LDQA 1V1JA 5K6AA 4PNEA 3FPFA 4KLNA 5FULA 5CA1A 3IP9A 1M5TA 4KR7A 3LC2O 1F7UA 3I1IA 4AIRA 2I3AA 3D02A 1TIKA 2ONYA 1GZHB 3I9V6 4JNKA 5GV8A 3KD3A 3I4FA 4Z4EA 4Q6BA 4ODIA 4URFA 1GYRA 4CNQA 4UVGA 2ERYA 1XALA 3SZOA 2R8EA 1NXWA 3MJSA 2JJ8A 3QVSA 1PUIA 5IHXA 4FZ5A 1QFJA 3DUWA 2G7ZA 3PUWA 4I1SA 2CMDA 1JDSA 3RC9A 2CZQA 5ER9A 3AV0B 2F8LA 4MYDA 1E7SA 2UZ3A 4PQFA 3SZMA 3QKRB 4B0OA 2BFKA 1OAAA 5B4TA 3N75A 2XWBF 1XQVA 3FMVA 2Y68A 4MA4A 5JAQA 3A3KA 1O9BA 3IS3A 4ZK6A 5M7EA 4CKEB 4LBVA 2CNWD 2JI6A 4NK5A 4TYFA 4UHBA 4EVIA 4ZALA 4BP0A 2RCYA 5L3VA 1HTBA 1E3WA 1Y3HA 4RA6B 4X85A 2Q0SA 4EYBA 1J2RA 4IXMA 5DSXA 4U0KA 5ACQA 4AJKA 3EMDA 4MICA 2ZI4A 4TRNA 1RVDA 2FY8A 2YWCA 3IMEA 4KNWA 4QKQA 3MCTA 1Y80A 1EU1A 3TTWA 2X1MA 1OXBB 3PHLA 4RF5A 3U4MA 2QYSA 3DKPA 1O77A 4GD3Q 3URKA 2BEWA 1AQLA 1XRLA 3FLAA 1XTIA 2L42A 4BJ3A 1Y9EA 4NY1A 1TCBA 1EUCB 3KWJA 1HDRA 5DZSA 4HUTA 5BSRA 1AQIA 3ZDEA 4TMFA 1O94A 3WRYA 2EHDA 2HRQA 4MCHA 1LY1A 1XN4A 4ND6A 2HI0A 4QBGB 5J5VA 7AT1A 3THWA 2CXHA 2DERA 1OILA 1K6JA 1EEXB 4K9KA 1ZSYA 3TW8A 4OXIA 1EZZA 1YDGA 5B4VA 4FSHA 3CXUA 3EF3A 1Q21A 3U13A 5BNZA 4EAQA 4AXXA 1AO0A 1BN6A 3UMRA 1YS1X 3I0MA 1DWQA 3FLMA 2MYPA 3HXTA 3MGCA 1DEKA 4HN2A 1ICIA 4MWGA 3RWBA 1TYZA 4Z5ZA 2ACEA 5GZ3A 1A4IA 2DHDA 1PG2A 4KWTA 3PHGA 4C76A 5EXSA 4U00A 3R5HA 3QPBA 4JOSA 3NV7A 3AKDA 4BNDA 1MTOA 5BWOA 3CZ5A 1FP4B 1B14A 4AQYB 3KVOA 3W79A 1XZJA 2X2OA 1X1CA 2PO5A 1LK7A 1TPYA 1P7CA 5DIZA 5LYYA 3PTZA 4L22A 4H0DA 3AETA 2QAGA 1FYVA 4TGLA 3F71A 3I4CA 4P4LA 3L79A 3VO8A 4C1HA 4DKJA 3RIXA 4ACBA 2J7PA 1U2TA 5DSZA 3CXRA 4YB8A 2P2ZA 5KDLA 2ZK7A 5ALVA 1M1YB 5HJ7A 4V0SA 1AS3A 4LHWA 3KEMA 4RFVA 3TLAA 1JAYA 5LQNA 1I7LA 5JDCA 3BSWA 3GLIA 1UODA 1CF9A 1KEWA 4ABTA 1XXHB 2CC2A 4R2KA 4GSLA 4LHXA 5JE8A 2VS1A 2WWFA 4GOKA 4HRAA 4JSTA 1AVTA 1ULBA 5AHRA 2DLCX 1I4LD 1ZD5A 1ZX1A 3H84A 5HM6A 1JEYB 1ZAYA 1XFDA 4ZI7A 4O33A 2B1GA 4AJEA 4HFNA 2H3EA 1N6NA 4AAYA 1QGDA 2AFIA 3BV6A 4CM8B 3MD7A 2IVFA 3QX3A 5FTLA 4KFTA 5IEBA 1UKVY 4DWOA 1W75A 3R76A 3SZLA 1H2FA 4NV0A 3T1VA 2YFKA 2I3GA 1Z5WA 4C20A 2FUNB 1GZSA 2X19A 1ZOSA 3L7LA 1PTKA 4IDCA 5E4FA 3ZOKA 3FF4A 4BKMA 4BIIA 5CD9A 1X7ZA 3OVMA 1MVLA 1TJPB 3JVEA 4OHCA 3L7KA 3E9RA 4DR5B 1DIOB 2ZYDA 2R8YA 2PR2A 1SCKA 3IUEA 3NRBA 3VO9A 4ATNA 4Z54A 5CG2A 2IU4A 2FN9A 5CM2Z 3C98A 1MO6A 2OO3A 4M60A 4OFBA 3ZIUA 1KEVA 3A3YA 3P20A 3A4TA 1Q50A 3PHIA 1SVWA 4PVDA 4AFNA 5B5SA 2IX9A 3MHPA 5JLJA 1DC4A 4G5YA 1L5KA 1ACJA 1BROA 5DCYA 3U60B 4GI7A 5TS3A 3TDKA 4YSKA 2F64A 1C3OA 3ESAA 4WKGA 1RABA 2BI8A 2QD2A 3VH1A 1ULZA 1DQPA 3HDJA 4UNSA 3R5XA 2VEDA 5B36A 4FB4A 2D1SA 2HDOA 4NEHB 1QGED 5EIBD 3R3UA 1M72A 4OHVA 1QVWA 3IQEA 4OSPA 3A6EA 3N0TA 4FDUA 4RK5A 4EQZA 2AOTA 5JRDS 2FEWB 1OYWA 2GFIA 2XCLA 1O97C 2WHRA 4U3JA 4CQLB 4EI9A 4Q00A 3OJWA 2VAPA 1C8VB 1DIGA 3M3PA 2YJTD 4YONB 1PEKE 4GX1A 5HVNA 3ETGA 3FWYA 5CCDA 5EVKA 4ID3A 2YW2A 3B3JA 4UE6A 5AVSA 3ELWA 1MV5A 3JXPA 3L0DA 3U3KA 1DXQA 1IATA 1WHSB 3TZEA 1JN0A 4LGCA 3T3PB 2BSAA 3DAFA 4ICIA 4QGHA 1QP4A 2YQ5A 3OQHA 3PX7A 5HXAA 2AUNA 5ALRA 3OI7A 2NXEA 4JI4B 3SBEA 3UK2A 1AX9A 2YHSA 3CS3A 2WTUA 1PW7A 5D3KA 2B99A 2ZJ8A 1K68A 2Y8BA 3GNQA 1ZIOA 2UVQA 2OFWA 2X0RA 4PCVA 1OX4B 5KYKA 4R9UC 1WNFA 2E3JA 2V03A 3EQ2A 3OM8A 3F8TA 1VPVA 2AIRA 4HP8A 4PZ0A 1GQQA 5NULA 4FYJA 1ABEA 3HTXA 2YV2A 4HSGA 2JLRA 1VJCA 4B6RA 1P2DA 3IEVA 5IQKA 2ERCA 1S8OA 3ISTA 4LE1A 5KJEA 4EK9A 1KFCB 4KC0A 1DMRA 3PZBA 2PBFA 2UV8A 2PV7A 5DHTA 1IULA 1ILWA 2QMQA 4D5GA 4QYIA 2VJBA 4FFLA 4D1VA 4FW8A 4KL8S 4QFDA 3H97A 3OQIB 2BGGA 3H1AA 3Q7EA 3ICQB 2OCAA 1ZCAA 2EKQA 4QA9A 2OCLA 3P2JA 2C29D 1ZKMA 4P8RA 1IM5A 1NVBA 2DFKB 4QAQA 3SIPA 4PN3A 5HKAA 2QW1A 1ZQ9A 2R7NA 3SYKA 1V7PC 1VSTA 4EKGA 4QOJA 5EYPB 4DM7A 4DMLA 2YZ3A 3EH1A 4TTTS 3TFWA 4PFJA 1G8HA 2ZRNA 2P3LA 1V5EA 4M83A 3WNCA 5EZ6B 3MT7A 3EVDA 3KQKA 2JLZA 1BSVA 4F92B 4OMUA 3M83A 3GJZA 4D82A 1UWCA 4IM7A 4YJHA 4KBYA 4L07A 1H05A 1U7HA 3M82A 1QIJA 2AFHE 5FQBA 1V1MA 1XZCA 3UJ7A 2WKQA 5I4KA 1N3YA 1RXVA 2I7CA 1DUVG 3AJRA 5LQJA 4LJLA 1G2OA 2GN4A 3TAUA 5DCWA 3T9EA 3EA5A 3RGWS 1V5IA 1NVVQ 4Y2VA 1JH9A 2GO7A 2O20A 1E8MA 3ZCUA 4RJIA 4ZDIA 4HCJA 4OK6A 1UBJS 2ZIFA 5CBPB 1Z4IA 4NG5A 2QORA 3VR4H 2PY6A 5FLXA 1QO0D 3ZZ1A 2O6HA 4RLHA 4HNHA 3D6TB 4BP9A 3U4QA 1BHSA 1W85B 3OHPA 2CN1A 2W00A 4E1AA 3EUWA 4ME6A 1KDTA 5C5IA 1MVOA 1UKZA 5MFPA 5LD2B 3OOWA 1TU0A 2DECA 3F6PA 3KWLA 3WGVA 2HXYA 2QU8A 1UEXC 2B8WA 2W2NA 4UNPA 5CB4A 5FJIA 3K6SA 2V6IA 3D4PA 3GH3A 4IQ8A 3NUZA 2O23A 2QD1A 3VUEA 4C87A 3CF4G 1NNUA 3LV8A 4XFJA 3V2IA 4M3NA 3AFIA 1EGAA 4MRSA 5JH7F 1QR2A 3GXOA 1T3ZA 2ZCVA 3L1VA 3NR2A 4ASUA 4U7FA 3ZHOA 2FPPA 3OBIA 1P2UA 3RIHA 2A1TR 3ZWNA 4X1KB 1VHDA 5KHOC 3IUJA 1ZHFA 2BM0A 3K94A 3WBBA 2JH3A 4WXYB 3BB1A 4YCDA 1X74A 2PBZA 4BNNA 4D9EA 1R8SA 4AY5A 2XYRA 3ZHQA 2CJFA 4A8PA 2FUG6 1CR0A 2PWZA 1W8DA 3FLEA 2B4TO 3JQBC 4NE9A 3WNZA 1URPA 2DPGA 1DX4A 1SVNA 4GM4A 4EB8A 2AD5A 2ZSEA 4QQFA 1U1DA 2OWEA 1R0ZA 4HDSA 4IIJA 4TZ0A 1KY5A 4Q39A 3EFEA 1XVUA 3T7TA 2ZBEA 4EG3A 4FR2A 1N7IA 2Q5JA 3GGGA 1VCNA 2QRPA 1CG6A 2ZYVX 1R0WA 2Y67A 16PKA 3LY7A 4JWTA 4MIEA 3M3DA 1OFGA 2G9ZA 2YWJA 3RSCA 5HKOA 1T10A 1IPHA 3G0DA 3R75A 4BMNA 2QM3A 4C6SA 1DD6A 4KE6A 1QDLB 1GTG1 1V8FA 2W0SA 2Z56A 4GE0A 2OP0A 1QE3A 2GSDA 1Q91A 2FMIA 3EZ2A 4QFMA 5UKDA 5B64A 1GWNA 1UPAA 1VB3A 2ZT6A 4Q4HB 2XQJA 5HMMA 1KU6A 1W94A 3ND7A 4ZVTA 3V1MA 1DEAA 1FFGA 1XEFA 3F74A 4N6GA 4RIIA 5EMHA 4CM1A 4EECA 1TU4A 1YQTA 3WZMA 1GN8A 1XQ6A 2QQ0A 1BE1A 1DHTA 3KKPA 3NTUA 3GBVA 4L5JA 3LUDA 3EEBA 4H4EA 4LHEA 4AXBA 1QQ6A 1UIMA 3OT1B 5DMXA 2PYZA 5AKGA 1V8DA 3SEQA 3AY6A 2IHTA 2HZBA 4F5WA 3BD9A 4Y6QA 3OTHA 3CLKA 1QQ7A 2XA9A 4JGBA 3T5DA 1U9IC 1L8LA 1YVRA 2FX3A 3FZQA 4MAFA 1I2ZA 1Y8QA 4DDHA 1X39A 2QTBA 2V7UA 5G4KB 3U4CA 3GLFE 3FOEC 4EH1A 1OWNA 4M0DA 4LRQA 3QLUC 3T3DA 4Z49A 3KTOA 4X3OA 2AXNA 2AR7A 1M2HA 1VPEA 2VZLA 4NCXA 1VM6A 3B7WA 3QTLA 2X3UA 1Z63A 1MHPA 2EFGA 2VH2A 1U5BA 3O74A 3L9XA 2HU5A 2O0MA 1DVRA 2OXCA 3IPYA 4HNSA 4UOQA 1JZSA 4E7PA 1KVQA 4ARZB 1OUMA 1Z34A 1GL7A 1S1MA 1JZQA 2AYYA 1XDBA 2ZJ4A 3FZGA 1F9AA 1BXRB 1HE3A 4FDMA 1DXYA 4F2PA 1DMSA 1IEXA 4YRSA 4CL3A 5AVQA 4OUDB 3ORFA 2PSEA 2X0DA 4AT1A 4BPBA 2NZEA 1KK1A 4G4SO 1Y7LA 3LPDA 3FGPA 3JRNA 4CEHA 1E4OA 5CDFE 1DBIA 1MCZA 2Y77A 4PTYA 2IYYA 3PXUA 3Q8LA 4R9RA 3GPLA 1NI4A 2YV1A 3CLSC 2BG8B 4X9XA 3VOSA 2QUJA 1MC4A 2OL4A 4Y0AA 4CM5A 5K4GA 3JD2A 1I1HA 1PNQA 3H5NA 5BRAA 5TIIA 4ZV4A 2Y93A 5ETJA 5AJVB 4MMYB 5B53A 2DR2A 4DJTA 1N5DA 5FORA 4RBNA 1JA9A 3DZFA 2A5JA 3MINB 2BWJA 1JFFA 4X7RA 1RCFA 3AUKA 3SR4A 2GKOA 4E5VA 1PVVA 3GRRA 3IFSA 1IN6A 5HFJA 3DFFA 3G2MA 3HACA 3TLYA 5JQWA 1MENA 2DSTA 4YXFA 4EHAA 4F8EA 3TLBA 4UQLA 4DUPA 2ZRPA 5K3FA 5BWLA 1P80A 4EYFA 3KE8A 2QL5A 2PEYA 4IGKA 5I4CA 5IUNC 3EF1A 1SVKA 1ZUNB 3LT5A 1UK7A 2O7SA 4KIJA 4S1OA 4XRRA 4YN3A 5LLTA 2CLDX 2NTVA 3PDWA 1ZTCA 4O63O 5EWMA 4B3TB 3OQ6A 4V0MA 3PRJA 4Q3EA 4RZSA 4TKZA 4NBVA 5A2QA 3P9NA 3GGPA 3OHSX 8GPBA 4B6FA 3OIFA 4RTKA 2ZKLA 2IPOA 1N2XA 4ZT5A 2QNBA 1SVMA 2HMWA 1Y1PA 4MW0A 1G6HA 1QB8A 2H2HA 3P0FA 2IOYA 3OTGA 1NBOA 2VOEA 3O90A 1GILA 2FSHA 3HRHA 3IC5A 2H4YA 4HQ0A 1TXGA 2WSSA 1H5NA 1VLQA 4IINA 1U7OA 3IKJA 4LDJA 4QJ4A 4RW0A 1FUIA 4B43A 1DCFA 1DBQA 4WZBE 4YLEA 3DXZA 1W49A 4KVGA 1ORDA 1TNDA 3EW9A 1PHRA 3BIWA 4DL9A 1QTIA 3TZHA 1DB3A 1VCIA 2BFCA 1J56A 1W88B 5AM1A 2OA0A 4MRMB 5IXYA 1K08A 3VU9A 1I3OA 5AJYA 4L0MA 4BO8A 4D41A 4RTJA 5FBLB 3HDYA 5JJBA 3SVLA 2ZAGA 1FP6A 1LEHA 2G08A 1XCPA 3GGSA 2FV8A 3OLYA 3DDUA 5L45A 4ZO3A 3A6PC 4GEGA 3T1OA 3QX8A 4B3XA 3AYZB 3DOCA 5TMBA 1M6VB 4BBZA 1BFUA 3IQHX 4Q34A 1U1EA 4FXOA 1T36B 2G0AA 1C0KA 1NG9A 3QWFA 4GLBA 1SY7A 4GLJA 4N0QA 1BQ3A 3UANA 2DFVA 4U6SA 1P2GA 1G20A 3LWZA 4HKYA 1E4VA 4V0LA 1U8TA 2OT3B 3HPRA 4MWBA 3VPGA 1IUNA 2VZ9A 4CPDA 4DOMA 4Q0MA 1R5NA 1RXEA 2W6JA 3NHMA 3QKIA 2V0NA 4YRBA 5JYDA 5AKHA 3U1VA 4LYAA 1BDBA 1KDOA 3DZIA 4P4UA 3S5UA 5LN1A 2GMNA 4JVNA 2CUZA 2ONCA 5FWXA 1KERA 4DXDA 4CKCB 3VYVA 3PRYA 2Y1OA 5A4IS 2EIHA 1ENYA 1DG3A 4FEKA 1KJYA 5DNAA 3KTFA 2YZMA 3A1VA 5JXIA 1DT5A 1WZUA 1SH7A 3GA0A 2Y4NA 4U2GA 4P3PA 1T9GS 4FGZA 5DK4A 3FHCB 1SN7A 3B9BA 1UC9A 2JG3A 1L4UA 4Q82A 1YTLA 3T61A 1PR5A 5LR6A 1B8VA 4F9EA 2HJ9A 3DD5A 3GRAA 3H5TA 1U28A 1I8TA 3OEED 1OD6A 2JJ1A 3V55A 1SUBA 4MGEA 5JAUA 5LZ2A 2MYNA 2IT1A 4J7XA 1D07A 3DMGA 4R41A 3ZNOA 4V38A 2KLBA 2R6FA 5F3DA 5IRCD 1GPJA 2I3ZA 1MAUA 3IO5A 5JCOC 3FUUA 2OMEA 3L49A 3QX9A 4IQ0A 5D84A 3KZMA 4EA9A 5LVAA 4MGHA 1LNZA 3AM4A 4QPDA 3J81A 3DLAA 3PFNA 2BL4A 1VIAA 3DC2A 5K6RA 3O8QB 3ZIAA 4E70A 2HL6A 4UVDA 3D31A 1FDIA 1KJWA 3LUGA 4LV6A 4FYWA 5BPHA 1SU8A 4QFCA 3D8NA 2P18A 3NIWA 1NN1A 2H5IA 2VQ3A 1M7BA 3E4CA 1X42A 1UQTA 1C9YA 3OCXA 5FT9A 1RMQA 2OKCA 1NM5A 1CDOA 1F9EA 2OXFA 2YTZA 4YRJA 5KOHB 3GCWA 3V1UA 3T4EA 2B4KA 1TEVA 4UHCA 1A8TA 4DLSA 5JNSA 1JG6A 2YRXA 5EIAA 4AWBA 1JHPA 3ZHBA 2OBXA 3B6KA 5A4JA 1LK5A 5LLSA 4D9MA 4YT4A 4KGDA 2VKQA 1G16A 1A8IA 3DOHA 1BGXT 2IZOA 3G1PA 3L04A 4I7EA 5DH9A 1NW3A 4AP9A 4YRGA 5FFNA 3WLFA 5CVTA 5JALA 4KP7A 5D1HA 1QQTA 2QPTA 3JWEA 4R1OA 4GZLA 2A57A 4PNPA 1ACLA 1ADGA 3U7EB 4C6TA 1UBOS 2XF8A 5A7HA 2YJ3A 2QA5A 2HPHA 2B8EA 2R66A 2TMYA 1DDGA 3C3DA 5COBA 2PZLA 3T12A 1IZYA 5JS6A 3VAZA 4JUAA 1DRVA 1EP1B 3RS4A 1G6KA 2R7KA 1U0EA 1UXKA 3CCBA 4UUBA 1J0EA 1EVYA 3AEUA 4C0HA 5K09A 5LJIA 1DV1A 1L5GB 1ZMTA 2GPWA 1WMEA 3AY0A 4I8DA 4YAFA 2XNKA 5G0VA 3RC3A 1C7RA 3AQIA 2EJBA 2QVBA 3I2HA 4I6EA 1KO2A 3FPEA 2WMYA 2EHJA 3H2BA 3DS8A 4Y2JA 4BWVA 5IT9A 4NRDA 3ZV5A 2C4NA 2J09A 1BZYA 2C04A 4WESA 1FSFA 5CM9C 3PC8A 2O2JA 4DMUB 5JMOA 1PRYA 3MOGA 3E61A 4KU4A 5KDOA 4OIFA 4HNVA 4PZUA 4BNMA 4JB8A 5HQJA 2P2LA 4N3CA 4MKGA 4H7DA 2HPVA 3GLVA 4R2HA 4C6RA 1JSZA 2IF0A 4E07A 1SVUA 4L9SA 3NHRA 4G4GA 3LY8A 5B57C 3V42A 4P36A 1Z6QA 3O7MA 4BLOA 3DHCA 3GK3A 5JEDA 4PRKA 1GU7A 2GNPA 4KNVA 1A8HA 2GKLA 1P62B 1JZTA 2WJ6A 3QEOA 4EXSA 4KWEA 2FMUA 3WYAA 2A5DA 3B20A 1RTKA 2XF2A 3THXB 4WCFC 1MRZA 1P4AA 2YQZA 1NLYA 3KB8A 4HQNA 3TXXA 4FSXA 3IH5A 4DT1B 4Z1OA 3D3KA 2JH9A 2Z8XA 3THRA 1MN6A 3ZHXA 3RK4A 3OZFA 2ZTLA 3Q3CA 4P92A 1ZJ4A 2JIZA 3K72B 4NQRA 5FUVA 2WIAA 3Q3EA 1TMYA 1GLGA 3R7WA 2RHHA 4GKBA 2Q2NA 1R15A 5BVHB 1Y4AE 1I7SB 2HK7A 4Z3KA 4UBLA 1LPPA 2GZHA 1NXSA 2DH6A 3H0CA 3DAGA 3HJAA 3IA7A 4JL8A 2FMKA 3HZZA 3I5XA 1K92A 3MFYA 1CDEA 1UFVA 4JLSA 5E1MA 1T13A 2O7QA 1NQOA 4P3KA 2P2NA 3V4ZA 4AY4A 4D9NA 3ZI0A 4J7AA 4LJ5A 4HZUB 1G18A 3VC7A 1G4AE 1E2EA 2IS6A 2TMGA 4REQA 3BGSA 2QRKA 2O07A 2X40A 4RF2A 3N3BC 1K97A 1E2DA 4W9MC 3LY5A 3LCJA 3SX0A 2RH9B 2ZUUA 3K5HA 1H2EA 2ZBQA 1U3VA 4A27A 1M2FA 1W9HA 2EKZA 1CUCA 1KJIA 3CRNA 3OLVA 1EHIA 3PYMA 3VPEA 4KNYA 1BFKA 3TTYA 1W25A 4ARAA 4RVGA 1NUHA 1H1LA 1QG0A 4OMDA 1RQ7A 1CIJA 1IHYA 1K8YB 3BK2A 3F4LA 4QO7A 5I3CA 3PGJA 4I6JA 1UXGA 4B6SA 3BTVA 3JQPA 4XYLA 1HSZA 2F1OA 3IDFA 4UQOA 1PP4A 1BDIA 1MOQA 4I9HA 5IF9A 1O2DA 4H3VA 1WY7A 4YJ2B 1I13A 4TYYA 1K66A 4EMSA 4TMYA 1FS5A 4ENVA 3DLCA 1VMKA 4LXHA 2VDVE 4IO1A 5KPDA 3HXPA 1UBNA 4B3IA 2D2VA 3NT5A 1Z4QA 3IQGX 1FDUA 3VR4A 1TM1E 1NXTA 1Y81A 4G0QA 4KR9A 3ZE8A 4L5AA 5DGDA 4DNPA 2VSQA 1G41A 3H5LA 1TL7C 4CG3A 4BX0A 1T8YA 3FSEA 3FYUA 3P0RA 3BEDA 1G5FA 2DQ4A 1OU4A 3KZ1E 4HEQA 4KTTE 1CRQA 4X41A 4C1EA 3FSGD 4X8HA 2EIXA 1YR6A 4PANA 3B1JA 2F9LA 5C1OA 2EGHA 3GFBA 3ADOA 4JENA 5AK5A 3QYAA 1YDHA 3L8HA 1UQUA 4XB6B 4DYDA 3VTAA 3JY6A 3LPMA 5ALNA 2WT8A 3PEFA 5BW8A 3IXMA 1CJMA 2HAEA 1J8YF 1D1PA 3IE1A 3HJBA 3P2IA 1IIBA 1NUAA 3EIOA 2QQFA 2YNMA 3ESHA 3ZJUA 3QVGA 4N8SA 1SHTX 2ZP1A 3EFBA 3GDWA 2CLMB 3I34X 4L0DA 2WIKA 2XUDA 4G81A 4RIGA 1CQPA 4D7AA 4MV9A 1F3OA 1SKYB 2NXJA 3HJHA 3OM9A 5G3YA 4EFNA 2AN9A 7ABPA 3GLHE 4RXTA 1PZGA 3UXYA 4DWVA 1EVKA 1IOWA 1EYZA 1C0PA 1USWA 5G53C 2E1PA 3GA5A 2ADOA 1L9KA 4QQKA 2BF4A 1ZMRA 3EXFB 4G0NA 4O02B 3LUFA 3VPCA 1EBFA 1M6EX 3CEPB 3M9XA 3EXHC 3QJYA 4LF8B 3E23A 4DA4A 1SBNE 5L4SA 2DUJA 3DJYA 1G6Q1 1JFSA 5LCHA 3AWDA 4B9AA 3D3WB 4XD7D 4D80A 4DCNA 5H4GA 3M4XA 1BCRA 5BNTA 4BQSA 4NPHA 4MQMA 3UV6A 2OZLB 2XGGA 4CR7A 1JA1A 3KT8A 5JASA 4LHVA 1OE0A 3H8WA 4QZVA 1RJDA 2C9OA 2PR7A 4I4NA 4YAGA 4D99A 4D9GA 2WWHA 5HCUA 4EELA 4CR6A 1XMXA 2FZVA 4GMDA 4G8DA 1HKHA 4HEA6 4DR6B 3T3NA 4EYSA 1XYGA 5B30A 5CYOA 3WLPA 1QDUA 5KWJA 3PJRA 1LQ2A 3L7YA 1D4AA 3E2IA 5DHFA 4C5CA 5JV5A 4K2AA 3ZZUA 4W9RA 4YRNA 5DTJA 2GHIA 2CYAA 4AKHA 3P4YA 3DMTC 4MQEA 4Q7QA 3G02A 4OF4A 1V95A 5DB4A 4QEZA 1O6BA 1AURA 1E79D 1XD8A 3CW8X 1IMOA 4IOJA 4B2IA 1DV2A 3ZK7A 2G1KA 4BBJA 4B4DA 1TDJA 2VOJA 4I14A 2P9JA 3T3OA 3SPXA 1K98A 1OF1A 1XA0A 2GUGA 2QB5A 3DC7A 4EDFA 2IKSA 1XRSB 1S7GA 2HBZA 3CUVA 3BPSA 4YRPA 5BOSA 2C8KA 3HEBA 3N8DA 3N2GB 3T7AA 4LZZA 1KH3A 4RKRA 3ZE0B 3TM5A 3KDSE 4F2HA 1NE2A 1UADA 3UJ3X 1W4RA 4Z7OB 2QRZA 2W48A 1TF2A 2RAVA 4FT2A 2SHKA 1OT3A 2WD7A 2ZIEA 2FQXA 3B1VA 2V1XA 2VRNA 1GADO 3PA8A 1GPWB 1K9VF 4FHDA 5BPFA 1GKUB 1LLDA 1NQVA 1WXFA 4ZEMA 4NAHA 3QA3E 2XVAA 3MBIA 3R4CA 4HN9A 4PLYA 2VP9A 1DAKA 2RGAA 3PFCA 4J0QA 2BKXA 3P4UA 4J07A 5JMWA 4R1PA 2XTNA 2YMLA 4AZWA 3E0QA 5LNK6 1VI2A 1G8KA 3B1YA 4GR4A 1QJ4A 1OKKD 3O9ZA 4UMFA 1WPQA 2PGDA 3L8DA 4WKOA 3V7UA 3TW6A 4MA5A 2HUPA 1TE2A 4LOKA 5IARA 1WXHA 2L17A 3AKEA 3HDQA 3QITA 4UAUA 4DVJA 4EJMA 1DC7A 7GPBA 1BVHA 2PFKA 3VKUA 2VHUA 4G5GA 1WD7A 2IYRA 4DV4B 3J80A 1US8B 5BN5A 4HYEA 2PAFA 1BC2A 2PQ2A 1AZWA 3K0BA 3O4FA 4Y9SA 5CNMA 5BVGA 3OEHA 1NOJA 4FCVA 1SXJA 1VP9A 4TSFA 5G1OA 5M3BA 3WGKA 4CT4B 3GBPA 5K5EA 5L6MB 1Q2XA 3CR8A 3I2GA 4WZAA 2NU6B 1QRRA 3KEFA 1O58A 5D3MB 3BAZA 1FTWA 1M8GA 5AK4A 4FSBA 1E0JA 3G9QA 2CB9A 4YO8A 1OPRA 1Z12A 2IYEA 3ZNQA 5JCJD 1Z7WA 4LVNA 1GL3A 4KR2A 1N8NA 1WHTA 1LPMA 1TFUA 3R6WA 3ZWOA 2GN2A 3IUYA 3RM3A 4BECA 4DWJA 4KE7A 5G1NA 1D7OA 4JDUA 1P2VA 2WWTA 4GLOA 4DSOA 3RKKA 3JQEA 2IXBA 3BS4A 2P1EA 5CPFA 1ZMOA 4Y3UA 2FZ5A 3JQAA 2RB5A 3VH3A 4ER0A 1QIIA 2OQ2A 1GAWA 1SHJA 2B5WA 1JJIA 2VJKA 1AGYA 1HDZA 3ENVA 3GAAA 4NS4A 4M0UA 3RWMB 1INLA 1ZGGA 1XMVA 2JRLA 2R6JA 4BBPA 2BP7B 2WM8A 1A8PA 3CY6A 1D5WA 4HNAB 1U2GA 4ITUA 3A6KA 4R2XA 4D92A 1DAOA 1SUSA 2GJSA 1FS4A 4QHSA 4XPIA 1QIDA 1NP7A 1XP8A 5HCIA 1ULUA 5IH3A 1YZLA 3KDAA 3LA6A 3VSBA 1PDWA 2CDNA 1RLOA 1OQAA 2PHZA 2IU0A 3V2HA 2FE1A 4M0MA 1XZIA 1CR6A 1F2UB 4OFXA 3CLRD 3JQ6A 2H0RA 3Q9UA 4KPGA 2HQ1A 4L57A 3R9KA 1YHYA 4NF2A 5HKKA 4GYYA 1ODTC 1XZHA 3T0IA 1XPRA 2N46A 3L7OA 3IDQA 1CS4C 1HYHA 2EERA 3FNFA 5AW0A 3WRXA 2D2FA 3CUTA 4G56A 4DLBA 2K7ZA 4OBEA 1JEEA 1Y8AA 5IC5A 3KV1A 3R20A 5EIXA 4C2AA 2WG0A 1G3IA 3Q2IA 3IP7A 1UBCA 2BBWA 3UZUA 5JVDF 2GO1A 4E09A 4JUBA 4XQGA 4GWGA 1UBHS 1T91A 2XCRB 4KUEA 1SCAA 5GP1A 2IYQA 4JJKA 4A36A 3R5TA 4CLOB 2Z4SA 3AL3A 4MUNA 4PBSA 4CR8A 4CEIB 4JVSB 4AYTA 3G9XA 4DMCA 4EF5A 1R18A 3Q0IA 4QUDA 4NOMA 3B2NA 1MAWA 1SHZA 1SQGA 1VMIA 3SJBA 3T9FA 3V32A 3G88A 6REQB 1Z4NA 4M0PA 3VBCA 1OIXA 4MWTA 1ZRMA 2OM2A 2ZB3A 4L0QA 4QRIA 3M81A 1CQJA 3DCNA 4RE6A 4QE3A 4NYJR 3EDOA 5ED4A 1WUOA 1R8JA 2O48X 4RTRA 3U6BA 3OFJA 5GZ1A 1OXVA 2D1YA 5ALIA 5KVCA 1AXRA 1SVLA 2QTVB 4PICA 4YALA 5FNVA 3VPHA 1JIKA 2Z83A 3MQ2A 4ARUA 2WC1A 3HUFA 4BNXA 1LQUA 2VPYA 4E08A 2Q3HA 1UXOA 5HE8A 3ZC3A 1JJBA 4YXWA 1ADBA 3DXYA 2ZYSA 3QEMB 3CPEA 4JI5B 3C0KA 3DVQX 2C42A 4UTRA 5KU1A 5DNEA 4ABYA 3KPJA 2AK3A 4OQEA 3EVTA 5KTYA 3FUWA 2WTMA 2RGDA 2DBRA 2IIVA 5BN4B 2E4UA 3TN7A 4DCSA 4WGFA 3THSA 1YACA 2E2WA 1D0IA 4FYHA 1Z0KA 4OYHA 5ENDA 1FLNA 4ZK2A 1OXKB 1P81A 3L41A 2BDTA 3DXFA 5HIIA 2W8ZA 3AF5A 4NDNE 4TROA 4BQRA 1XR3A 2Q7DA 2V0GA 4OHBA 2GZ1A 2A30A 3HLTA 4C7KA 4KJZA 4NXNB 3FYSA 4PQEA 4UEQA 4KE8A 4YS6A 2MTBA 3USCS 4L85A 2ZQZA 3PNBA 3D8RA 4U9HS 4N6NA 4QU0A 3SD7A 3C3AA 3NGXA 1NN3A 4P4SA 2Q2VA 1BS1A 2FH5B 5EIWA 2DTEA 2B92A 5B3AA 1RXUA 5KINB 4EW1A 2FPUA 1BXGA 2VCHA 3ORHA 5L95A 1KJ8A 4RD0A 1ZC4A 3AL0C 4DCPA 4LTNA 4LMBA 1G9TA 5JS7A 1BCSA 3D6JA 2A5GA 3M6LA 2A9JA 4L3VA 2PU5A 2ZRLA 1L4YA 1T5HX 2F17A 4KFRA 2ZWPA 1Y8RA 2G28A 4N5NA 3LO8A 4O4IA 5B1HA 3RRFA 1W36D 1ZIPA 5A62A 1OT5A 3B1KA 3L6NA 3D5QA 2I6FA 2P2SA 2WFLB 3C8HA 1BEZA 2R1UA 3GHYA 3Q1KA 4KIUA 2WY2D 3SYLA 1DKRA 1MEEA 3N05A 1H8EA 1N7HA 2GT1A 4CBVA 4WBNF 3S0ZA 1FW8A 1XEXB 4N6OA 3BHNA 2Q2OA 4F84A 1JYEA 2E87A 2Q3DA 3B6MA 4GPEA 4KQGA 4ND1A 4RTNA 3U7FB 4BJ5A 3IBGA 4AN4A 2AE1A 4LHSA 5U1PA 1ZZEA 3OT5A 3RROA 2IYZA 2XKAA 1GCUA 5BMVA 4IVPA 4QNMA 4W5OA 3G2HA 3LHFA 3KQNA 4AJ9A 4C9BA 2OCGA 3A2NA 1TD9A 3R6GA 2MWMA 4G4JA 3EY9A 5JECA 2P7HA 3RYCA 1WY5A 1GGMA 3G0IA 3IOYA 4K6GA 2ORYA 2Z6UA 5KBYA 3OFND 4J4BA 4MVJE 1JB9A 4EW3A 4TV9B 1R1DA 3O4JA 1FMLA 2FETA 4O6VA 2CXUA 3I1YA 1PE0A 3VNSA 1AV6A 5AHXA 4B1FA 4D9HA 2C3PA 1UFQA 3PJFA 3RAEC 4L27A 3G2LA 4YJGA 2MINA 3LM8A 4FFVA 2PKQO 3ZWYA 1H4SA 5AKKA 2C2GA 3EDCA 3W6NA 3HXLA 1LI7A 2VDLB 1KQFA 5AVYA 1OPXA 1I4TD 3S44A 4OHRA 3KQWA 4BNTA 2C9DA 2CHFA 4PYRA 3ZCRA 4DF3A 2P40A 5B2ZA 1TUGA 3ZZ0A 3EA4A 1XXHE 1I1OA 3QWHA 4O0LA 4JLAA 1C9EA 1E5VA 1UC4B 1B00A 1FE8A 1ISIA 1PKXA 2H5JA 3IILA 3NCTA 4PTLA 2AKAB 4R6XA 2BFMA 4CGZA 2IIQA 3H1BA 1NUSA 3DHBA 4M0KA 3HVKA 4RMNA 3RADC 5SZHB 3IPXA 1N75A 4R69A 3TAHA 1NQUA 3DUFB 2B98A 4RULA 5F7XA 2AG8A 4R0MA 4F6RA 3GEGA 1HEYA 2HMUA 3FJ1A 3UMVA 3KKEA 3SBXA 2YNVA 1SCDA 1RRMA 2P62A 2R47A 3DEZA 4NJMA 1UEIA 4XDGA 2D59A 1FDOA 1IXZA 3U0BA 4F4FA 2J5KA 3QF7A 2BC2A 5AJLA 4DB4A 4D81A 5FDFA 1ZEMA 5EJ5A 5EQTA 2J9FB 1XK7A 4RTOA 2JB9A 2MSKA 4PE5B 3V9AA 2Q9CA 2RBKA 4PLPA 2DPLA 4LHZA 2ZJZA 3I04M 4D8WA 3QOYA 4CODB 1TCAA 1UBMS 1ESZA 3BH0A 5LMUB 3K8QA 3TFOA 1R0KA 4XVRA 1U02A 4FI3C 1VPLA 4AMGA 4F8JA 4NQ2A 4F5YA 5IP5A 1S3GA 2I0FA 1HV8A 2OZPA 2ZSJA 1HRDA 4JSYA 3ACCA 1RI5A 3PQ8A 5AOCA 1UPXA 4YV1A 2QTTA 4IQGA 1I2MA 2WNHA 3T5GA 3HKDA 2XCQA 1L1EA 3AFOA 5F2KA 1AT1A 5BWMA 4C0XA 3M8KA 5EMMA 3IHTA 1JJTA 1P5RA 3GPIA 4IDDA 5CJ2A 4BN0A 3C4VA 5EXXA 4EFZA 4YAWA 1FQJA 4KUHA 4CM9A 5ALMA 1FNNA 1G8MA 1KZ1A 4QVGA 2V5VA 3KUKA 3C8UA 4UVIA 5DJ5A 4MRNA 2CF6A 2YJ6A 3CUEF 2EZ4A 1FSPA 3CA8A 1DJMA 4AYWA 4AX0B 3SNKA 3CKMA 1BE8A 3NTOA 2ZI5A 3UUEA 3I42A 2NVWA 4I81A 1I51A 1A2OA 1NN5A 1XYYA 2G07A 3E2MA 3G1UA 3G5TA 4J0JA 1HZJA 4JL6A 2V59A 1XMOB 3R7SA 1E3JA 2ZYIA 4UASA 5TGTA 3H7IA 4FOPA 4O2LA 2VTKA 3QE0A 3BF8A 1TB4A 3WMEA 1YRBA 4PFKA 2I2BA 1I3KA 3BB3A 3ZR4B 2DCMA 1H2HA 1JQBA 2RG1A 3FYCA 2ZBGA 4KFCA 4CIVA 2WHPA 5EMLA 3REQB 4BKUA 1N2ZA 2C77A 3RVLA 2XKKA 2BFFA 1GUFA 3E2PA 1UJCA 1ZGHA 2ZG6A 2BBTA 4R0NA 2WTNA 1NT2A 3BXZA 4LISA 2VSNA 2VFAA 3FN4A 5HIKA 4J1TC 1NASA 2PV0A 5ALGA 4Z7QB 5A5VA 5KTMA 1NJGA 5EJ6A 2O59A 2JLAA 4OXRA 3FAIA 1B6TA 3QH8A 2IIBA 4UOZA 2G8NA 3AR5A 1OWLA 3TINA 3HRIA 3R9IA 1C5KA 1JF8A 3CZ4A 4C4SA 2NP6A 5LQUA 3Q6VA 1P44A 5EUQB 2AG6A 1J25A 1YB5A 4L50A 5T4FA 5TQJA 1CW2B 1PYDA 4G3XA 5CTAA 4ENUA 1EFVB 3KKQA 5GONF 3PDUA 1BE0A 4WKCA 1SNYA 4EHLA 3D5EA 1XMPA 5JNLA 2RH8A 3KLMX 1EI9A 1M0SA 1LTQA 2PUTA 4I0WB 5ED0A 1R00A 5F7ZA 4C0WA 3AHDA 4P7KA 1T6NA 2KI5A 2ZRKA 4Q3OA 1EGQA 4ZC8A 3SLGA 5C9ZA 2HD4A 4KGXA 1JDUA 1OR8A 1PJCA 1PJZA 1XQ9A 2OC9A 2PRJA 3E53A 2BIFA 4TSKA 2NMVA 2R1VA 1JXQA 4OHUA 5BQPA 1CLUA 5FH9A 3TCKA 1QX4A 4RQAA 1UBTS 3KR0A 3UB3A 4BU0A 3SQOA 1MIHA 3HCDA 2MHCA 3HBJA 1QAOA 3IP8A 3UK6A 1RQRA 3RC1A 1JQ3A 1H4QA 2BFZA 5IT4A 3DOIA 1UFOA 4CETA 1SZDA 2PUCA 2QX8A 5SZIA 3WSWA 5LWHA 2VAMA 1C0EA 2TYSB 4N18A 1VL2A 4R1TA 2FW7A 1VKJA 2JZCA 2QZJA 3CLTC 3NOQA 5DEOA 2WYHA 3L7CA 3DFMA 1T2FA 4EY3A 3MELA 4K87A 2IEIA 4KXFB 3D8TA 2FHSA 4U7WA 3EVZA 1D8TA 4GQAA 4EFKA 4DAOA 1TLFA 4GZ6A 3O94A 1C3JA 4D0SA 3BMOA 3P9RA 3VTZA 2WYOA 4DMMA 4EQ6B 1Z8DA 2CBXA 4ZVOA 1KMQA 2WV9A 2ZNBA 5J4VA 3LUAA 4AW9A 3INTA 2BR4A 1F8FA 2ZWOA 3EASA 1ZA1A 4P3YA 1O57A 1VYUA 1XQ1A 2GLTA 3ETDA 3VJKA 5IYZB 2EP8A 5JI3E 1B1AA 4H3SA 4KXMA 1DC8A 2H7VA 5IBPA 1CUSA 2SKEA 3JATA 4ZRDA 3ORSA 4IKEA 1WB9A 1D9ZA 3E5NA 1QRTA 3G23A 3IO3A 3C1OA 3CE6A 4Q9HA 4QARA 3IOBA 2OY0A 4R3WA 3UBMA 4D9JA 5K1ZA 3I15A 1P0IA 1MV8A 2BMAA 4LDAA 1CUDA 2QP3A 4NYMR 5DHSA 1J07A 1FYWA 2J3JA 4YMGA 3QSYA 2O4UX 3BWBA 5FPKA 3VZDA 3ZY4A 2BGKA 2QE7A 3DMRA 3HJUA 4EUEA 5A9SA 1C3LA 1R9GA 2LVBA 2VBIA 4MGZR 2QX6A 4AMVA 4AQDA 2CG3A 3TF5A 2R5FA 2P30A 5LMCA 4DHWA 5GGXA 5IAJA 2GM4A 5DX8A 5H83A 2O8EA 3FUTA 5LM6A 2HXGA 2O3JA 1I1QB 2C5SA 1VLZA 1JKXA 4LNUB 5CIWA 3RS7A 4EA6A 3OZGA 2C7RA 1KO3A 5JPIA 5K0CA 3FE2A 4GI1A 2VF5X 3V1TC 3V8NA 2YICA 3RSZA 2AFIE 3BMCB 3FPSA 3UIEA 3TI7A 1XFAA 1YKGA 1EESA 2JL1A 5L51A 1LGYA 3Q6IA 1B8PA 3A9CA 7REQB 3FDFA 5CVDA 3WQQA 5ICCA 2SECE 4RHUA 5JWRA 4EA8A 2QVGA 4KXNA 1C7JA 1JR4A 2CFTA 2OKGA 4HGYA 2NUAB 3L46A 3U62A 5BMOA 1BMQA 3HUEA 3M4YA 5EKUA 1QS0A 2FWRA 1BC5A 4FEGA 4XD7A 5BSKA 1CZHA 1XN1A 4PFQA 2BCGY 4Z6XA 5BT8A 1T2DA 1GSHA 5AKYA 4ND8A 3TGLA 4HB2A 4CN8A 1A9XA 2FEAA 4OGLA 4TMZA 3HVRA 2CL0X 3WJ7A 4E13A 3OFSA 1MBZA 3G8BA 4KEAA 3A31A 4ZGWA 1FNDA 5LXTF 1XTOA 3CM0A 4QOFA 2DR0A 3UICA 4OM8A 5JD5A 5AOBA 2UYOA 4XPZA 4DJJA 3MS4A 3PTAA 1V16B 2J3QA 4EB3A 2QN3A 3OCJA 3A06A 4Y6RA 5AM0A 3DMDA 5DWDA 1G6OA 4JJZA 3C6BA 3RIGA 5AESA 5K3AA 4DKXA 1L3BA 4ZMRA 5E8RA 4KPYA 5AKJA 5ECYA 4BAGA 2Q4DA 4ZEXA 2NSHA 2BHRA 1KTVA 3F78A 4HMQA 4MUYA 3DLHA 3FBWA 5JQGF 1HDYA 3HJRA 1WRAA 3VU1A 2NU7A 4D9FA 2UZ1A 3CGWA 3U3DA 4LC1A 4NMLA 1MW8X 5ISMA 2FI1A 6GPBA 1EX9A 3NHSA 1J00A 5EERA 4O5OA 1IXYA 1WG8A 1QC5B 1HFEL 1SHUX 2ACWA 3ANMA 4G67A 4CE6A 3TOZA 4RJKA 1NMXA 1NMQA 1S1CA 3BVPA 4NZOA 4CT0A 4G0VA 1KYZA 1RZRA 2PWYA 3AESB 4KCGA 1M1NA 3QOXA 3DBRB 3ZWVA 1C8LA 1Z5ZA 2I2WA 4MZXA 4KDFA 3FHTA 2GERA 1J4AA 4CYMA 2P9GA 3MYRA 3J7TA 1RW4A 1UFRA 3NPMA 2G3YA 3CF0A 4BFYA 1GU0A 4LCJA 1K8QA 1EFLA 3A9RA 4GH5A 2BJWA 4MVYA 4Q37A 5ALUA 1FFXB 2CUNA 2BHSA 4W9NC 4B5LA 5MF6A 2VXYA 3LLSA 2NM0A 5DYYA 5IAEA 2G4VA 3NVAA 3UG6A 2BRUC 3Q3IA 3W4JA 1OKKA 3AIKA 1W5EA 3ORQA 4YASA 3KVVA 3RT7A 1NUTA 3R41A 4RLQA 2WSIA 4ZPJA 1TKRA 3H9BA 2RHGB 2MMCA 2LW7A 3U7RA 4P38A 2ZTSA 4XX0B 3KKMA 2A0UA 1RI4A 3LRXA 3GP5A 3D6AA 3IOMA 1OAOC 3E22B 3MPUA 4L8FA 4DBZA 3HO8A 5HPYB 2Q2WA 1FMFA 3S1LA 1KSHA 1UJBA 2XMQA 3S2SA 1IBLB 3BDAA 4P0PB