5A0VA

Catalysis and 5' end sensing by ribonuclease rnase j of the metallo- beta-lactamase family
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
454
structure length
454
Chain Sequence
SHPHPELGRPPALPKGGLRVTPLGGLGEIGRNMTVFEYGGRLLIVDCGVLFPEEEQPGIDLILPDFTSIRDRLDDIEGIVLTHGHEDHIGGVPFLLREKPDIPLIGSKLTLALIEAKLQEHRIRPYTLEVAEGHRERVGPFDCEFVAVNHSIPDALAVAIRTPAGMVVHTGDFKMDQLPLDGRLTDLHAFARLSEEGIDLLLADSTNAEVPGFVPPERDISNVLRQVFANARKRIIVASFASHVHRIQQILDAAHEYGRRVAFVGRSMVRNMGIARDLGYLKVPPGLVVDVKTLDDLPDSEVVLVCTGSQGEPMAALSRMANRDHQIRIVNGDTVILASSLIPGNENAVYRVINGLTRWGANVVHKGNAKVHVSGHASAGELLYFYNICRPKNLMPVHGEWRHLRANAELGALTGVPHDRIVIAEDGVVVDLVEGKAKITGKVQAGYVYVDGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Linkage of Catalysis and 5' End Recognition in Ribonuclease Rnase J
pubmed doi rcsb
source organism Streptomyces coelicolor a3(2)
molecule tags Hydrolase/rna
molecule keywords RIBONUCLEASE J
total genus 149
structure length 454
sequence length 454
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 5a0vA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5a0vA01
4F6HA 1DDKA 2P18A 2WHGA 3S0ZA 3KNRA 2YZ3A 3I13A 2P97A 3I15A 2HB9A 3I0VA 2FHXA 2YNUA 3FAIA 3KL7A 2M5CA 5IQKA 4AX1B 4RL2A 2OHIA 3KNSA 2QDSA 2YNTB 1VJNA 2A7MA 3IELA 2BGAA 1L9YA 1A7TA 5AEBA 3WXCA 4XWWA 3SD9A 2I7VA 3X30A 3AF6A 1XM8A 2BMIA 4C1GA 5ACSA 2QJSA 4JO0A 1BVTA 3VPEA 3DHBA 3PG4A 5EVKA 2M5DA 4J5HA 1KO2A 5KIKA 5HISA 4P62A 5ACXA 3F9OA 4KEQA 5EWAA 3IE1A 4HKYA 2BFLA 4DILA 4XWTA 3QH8A 5AYAA 4D1UA 4RM5A 5ACVA 4Z7RA 4EXYA 2BFKA 2FM6A 4GYQA 5B15A 5EV6A 5EV8A 4H0DA 3I14A 5FQCA 4UAMA 3BK1A 3IEMA 3IE2A 3DHCA 2FU9A 1HLKA 4BP0A 3ADRA 2GFJA 3G1PA 1YCFA 4D1WA 2BG8A 5EW0A 3SPUA 1KR3A 2P1EA 2Q9UA 4EYLA 1WUPA 2ZO4A 5K0WA 4UBQA 4ZEJA 4YSBA 2FHXB 3T3NA 4O98A 3BK2A 2ZNBA 4WD6A 2OHJA 4EY2A 4C1HA 2H6AA 3I11A 3T9MA 4RAWA 4NQ6A 2WYMA 2GFKA 5A0TA 1ZNBA 5LSCA 5LCAA 4C1DA 3BV6A 1YCHA 3IOGA 4V0HA 5KILA 2XF4A 4Z6XA 3X2ZA 4D1VA 2YNVA 5AXRA 4DIKA 5LS3A 4RBSA 5ACQA 2YNWA 4Z67A 2BFZB 4KEPA 5LCFA 5EVDA 3ESHA 2BG8B 3L6NA 2Y8AA 4RL0A 1X8IA 3P2UA 4UWPB 4EFZA 5AHOA 5EH9A 4EYBA 5ACPA 3ZQ4A 2NZFA 3SFPA 3RKKA 4C09A 2AIOA 2BG7A 1K07A 5B1UA 2I7TA 1WUOA 3PY5A 4UWSB 2NXAA 4FSBA 2VW8A 3IEKA 3IOFA 1JJTA 4AWYB 2WYLA 5K4MA 2P4ZA 2BR6A 5A5ZA 1DXKA 4CHLA 2BG2A 2BFZA 4Z5ZA 1JT1A 4D1TA 2FU8A 4Z60A 4J5FA 3DH8A 2NZEA 4TZBA 4NQ4A 3LVZA 2CBNA 2DKFA 4XUKA 4RAMA 5AXOA 4TZEA 2WYMC 5LCHA 5HIOA 1YCGA 2GKLA 4C1EA 1BMCA 2Q42A 4EXSA 1VGNA 2Y8BA 4HL1A 3X2YA 4GCWA 4F6ZA 5ACWA 3T3OA 4NQ5A 5AHRA 2OHHA 4AD9A 3Q6VA 5HH6A 1A8TA 2Q0IA 5HIQA 3BC2A 3MD7A 4UWOB 2GMNA 4FEKA 5LMCA 5EVBA 3X2XA 4D02A 4TYFA 3ZWFA 5K4NA 2FU6A 1M2XA 5HH4A 4TYTA 2ZZIA 2I7XA 5LE1A 4TZFA 1KO3A 3JXPA 1X8GA 4UA4A 4PVTA 2ZWRA 5HH5A 1XTOA 5HIPA 4B87A 5ACTA 2QDTA 1ZKPA 2R2DA 4C1FA 1WW1A 4GYUA 1P9EA 3RPCA 3SW3A 2BIBA 3R2UA 3IE0A 5ACRA 1JJEA 4ZO2A 2NYPA 5B3RA 4AWZA 2YCBA 1VMEA 3PY6A 5FQAA 3IDZA 1QH3A 2GCUA 4Z5YA 4FR7A 5LM6A 4C1CA 1X8HA 4AX0B 2BG6A 3H3EA 1BC2A 5A0VA 4PVOA 3RKJA 3VQZA 2DOOA 4YSKA 3DHAA 4UWRB 4U4LA 2UYXA 5ACUA 1E5DA 4HL2A 5EHTA 2QINA 1WRAA 3AJ3A 1Y44A 2YNTA 5FQBA 5K4KA 2BTNA 3AF5A 3A4YA 3ZR9A 2WRSA 2XR1A 4EYFA 3SRXA 1DD6A 2Q0JA 1SMLA 1MQOA 2E7YA 4LE6A 4BZ3A 4ZNBA 1ZTCA 3ZNBA 3SBLA 2YNVB 3TP9A 2Y87A 2QEDA 5DPXA 4NQ2A 3FCZA 2FU7A 4TZ9A 4ZO3A 2BC2A 2AZ4A 5A87A 4YSLA 2FK6A 5LLDA 1QH5A
chains in the Genus database with same CATH superfamily
3P5BA 3FYDA 3HXQA 1Z5PA 4IF6A 4F46A 2G82A 1DMRA 5CT9A 1ZA1A 2OV6A 3WC4A 2WJGA 3UK6A 4F93B 5KNBA 4GPBA 3VDXA 5J4HA 5AXBA 3HTXA 1ANKA 3C1OA 2CFSA 4AUMA 2BISA 4UTZA 4EKNB 3T1HB 5JXGA 8MHTA 2WHGA 3DFIA 4ZPXA 3QJYA 3B7GA 5I9SA 4HBZA 5ICSA 3BX1A 4HQRA 4HTAA 5DNYB 5HW0A 2EKZA 1XCGB 1TLLA 1J49A 1HV8A 1SVIA 1OXVA 3A4MA 4GMHA 1Q7EA 5T3YA 4O08A 3RSLA 2I8LA 4RBNA 3X3HA 4BNMA 3CNBA 4BCDA 5IJZA 2PUCA 4HS9A 1NPYA 4RPHA 3OUZA 5K9ZA 1CHDA 2JIZD 5JTTA 3K9NA 4O2RA 4BFYA 3EVCA 3FAIA 1Z2PX 4KQXA 4OQPA 3OZGA 1UM9A 3TKLA 1ZO8A 4RLFA 4UAGA 3L7IA 1UJ4A 5KSYA 1PL6A 2UAGA 2FHSA 4LBZA 4FEEA 2QRJA 4KR6A 3TAXA 1SCJA 3ZDZB 3OZVA 5AM4A 2HFJA 1EQ2A 1U8FO 4N0PA 1E66A 4J75A 2HW8A 5ALEA 4DMRA 3GUUA 5T6BA 1IZ8A 2E21A 1K06A 2ONZA 3N0XA 5HS6A 1EUCB 5BW8A 1C0KA 3ECAA 5LLDA 2H48A 3HFSA 1YDMA 2H8KA 2OWDA 3GUHA 3PFKA 3X1DA 4DM7A 4WXPA 2K2QB 5E6RB 1CYEA 4Y1GA 3KJZA 5JSKA 1VL2A 4AMGA 1L8OA 3U3MA 4G6ZA 1L9YA 2P68A 4TPKA 2AFRA 3A9CA 2ZPUA 3WXCA 1WL8A 4MKGA 2FFRA 3BCHA 5SYAA 1C4XA 5F3DA 5THKA 4B3XA 3SD9A 5KNCH 6CHYA 2RBKA 2GJ9A 4P80A 4O4JB 3MYRA 4M8KA 4WGGA 1U5BB 2ODPA 4S3MA 3JTMA 3NBAA 1XN4A 2BTEA 2VJBA 3ZJUA 1HZJA 3KS9A 1Z2OX 2CXSA 3OZCA 2DYKA 3PI6A 1KYXA 4F2HA 5HRCA 5KREA 2QQEA 2IP1A 3DDSA 4JB3A 2SNIE 3NRCA 3KX2A 4IGAA 1CDDA 2NLOA 3ANTA 4KQWA 4UBIA 5SYNA 3BMNB 5BUQA 1ZUD1 2BUCA 2ZJ8A 3ZR4B 3S81A 3R3WA 4HQ0A 1T1RA 1XHLA 1LJ8A 3OJXA 4PWZA 3VPAA 4CQLA 3HGTA 4Z7NB 3TPCA 3TTSA 4F72A 1UFOA 1UWCA 4AXHA 1MEEA 1OF1A 3VPDA 5ACXA 1N1MA 2A88A 2HB6A 1TQDA 2V65A 3H1PA 2EZUA 4PLGA 3CLTD 4C0HA 5L51A 3K0KA 3IE1A 4KEQA 4UXJA 2G5TA 5FD8A 1ESEA 2D7JA 1T3SA 2BN4A 2XXJA 1ZZEA 1J5PA 3NALA 1JHQA 3MF4A 1VIDA 4MKXA 3PFNA 3UAGA 2RK6A 1VPEA 1LQUA 1B8PA 3MM4A 1QS0A 1P4RA 4I50A 4QATA 2QN8A 5DHQA 4EG6A 3LOUA 4HF7A 5F35A 1JHYA 4DG8A 2ZDQA 3D3WB 3HWWA 2B0JA 1VE6A 1G7CA 4G1FA 5IT9A 1DGQA 1PT6A 1TIPA 16PKA 1LDNA 1NXXA 3ELYA 5C1DA 1YO6A 1I80A 4L8GA 3D7MA 2WYOA 4HEA6 5LBIA 2EQBA 5KYUA 2PKCA 2IWHA 4AP6A 1NVKA 5LIRA 2BEKA 3AZOA 4NTZA 5DISB 5KQGA 3BD7A 4O4JA 1NQVA 2I3GA 5HFNA 1B6GA 4UVIA 3TJZA 3ZGLA 3OQ1A 4BNIA 3TKYA 1G5RA 1JQJC 1HY3A 2H5EA 3T3DA 2QPAA 3KWLA 4ZO4A 2GD1O 4LJ8A 3ZS8A 4BGUA 4DANA 4G85A 1L5FA 2ATCA 2EDCA 4YPOA 2YVQA 3TBFA 4G09A 1X1AA 4CETA 5FADA 3ZV3A 1R6VA 2FN9A 3TLGB 2YYSA 4PXYA 5ENDA 4AROA 4LISA 2D8MA 1LPMA 3L2OB 4LNHA 5AI0A 1MC1A 5K99A 1RQPA 3PKJA 1MPXA 3UJHA 4XAQA 1KJYA 5KTMA 3I45A 3SYTA 3U37A 1J25A 1PD1A 3HCNA 5AUNB 4JR2A 5C5CA 1M9NA 4BNZA 3B5JA 2HA6A 1I1OA 1PWEA 2OECA 4AUKA 4ZANA 2AH5A 4RMNA 2XUKA 1V9SA 1KR3A 4FGZA 2HMUA 4FC7A 4DL9A 5B6IA 1RD4A 4ZZ3A 4OHUA 5TPWA 2J30A 2ADOA 2WIFA 3DBIA 4PU0A 4ZI5A 4CT0A 3A27A 4UAVA 3SDSA 3Q9UA 3IEVA 3W79A 1G3IA 3M2TA 1M8PA 1YJCA 2R1UA 2OFPA 1KHHA 1SC3A 3OPYA 1MCZA 3AK4A 1GVNB 1PRYA 2D1RA 2PN1A 3IA7A 2FAXA 3DAHA 3KYIB 4P7JA 5BO5A 5PGMA 3G8AA 4LDQA 1G8KA 3R7FA 1D2HA 1ADJA 1KZYC 3BJIC 4D56A 4GX2A 2IUEA 4KRYA 3NCHA 4LK2A 2MHCA 1RI4A 3I8XA 4WKBA 5GAJA 3OZUA 5DNWA 4ZAXA 1F7UA 2EW2A 1U2SA 2IYXA 1AF4A 3L4BA 4UNSA 4IDFA 5ITWA 2ZWPA 4EHJA 3HI6A 5CT8A 2CNNA 4XWOA 3C3CA 3MGAA 1ZISA 4P3YA 4W5WA 3MMSA 4HWTA 3RC1A 4Q4JA 5JAZA 5JLAA 1LBTA 2YXDA 1VMIA 2NU7A 3FPKA 3L1JA 1MV8A 4FQ7A 5AVOA 2DUJA 3FBTA 4IOKA 3DTVD 5KYUB 2E5WA 5LP1A 4RF2A 4IVRA 3BHIA 2HU7A 5H80A 3AKYA 3QW2A 2DBZA 3R6TA 4P0PB 4B2IA 3WK5A 3IESA 2YICA 1TB4A 2I87A 1QVRA 2I4IA 2J6IA 2QL7A 2YW2A 3QPAA 4W1SA 5IH7A 1ODSA 4Z2YA 2BMFA 3JARA 3CNHA 3L1UA 4DCNA 4EENA 3V32A 5TMPA 1C4WA 5AW2A 4UXHA 5TJHA 2CB0A 1XTUA 3LVQE 2PUFA 5JEDA 3Q85A 5BSVA 2GRAA 3TQQA 1DCMA 3MTGA 4IWXA 1Z07A 4B4OA 4R1UA 3DEJA 4W5RA 4G4SP 1OYVA 4OQXA 4YWJA 2QE6A 4JBWA 2QENA 3EUAA 2ECFA 2XECA 1XTZA 4W9NA 5DHRA 4AV7A 4NMMA 1FB5A 3E53A 2FYTA 4AS1A 2IZZA 1HYHA 3LQ1A 4CKCA 4RL0A 2PL3A 2QN2A 4YJFA 1Y5RA 4LE2A 1EVEA 3KWMA 1RYFA 3UTCA 4E88A 4YAIA 3C1TA 4E0BA 3SM9A 1KARA 1Q12A 3GPLA 2I0FA 2ISCA 3FH0A 3COWA 4G5XA 2NTEA 1F48A 3L7BA 4ERNA 1DB3A 1Q84A 2WYHA 1Z4NA 4HLNA 4MA5A 5K0EA 2AIOA 1XMXA 3G6WA 1KXJA 3MGCA 3K9QO 4WKOA 1E0KA 2O54A 2JHPA 4X66B 2GZSA 3D8BA 1H1LA 5E6RA 4KOEC 3VYRB 2NTNA 3TIIA 3EBOA 7REQA 2B6NA 1WO8A 3DVAA 1T5TA 1EU1A 2AD1A 3HRHA 4L4YA 3EDCA 4PC3A 1R0CA 1JB1A 1YBVA 4AWYB 1Q0TA 2OFOA 3X2SA 2J41A 2ZSDA 3DAFA 4HH4A 4ZVVA 3VJMA 3QX3A 1RLTA 1IE3A 1JA0A 3KIPA 3L8FA 3PD1A 4HGQA 1QGOA 3SGLA 2QU8A 5J5VA 2XE6A 4UWSB 1WAMA 3OIYA 4B40A 1WE2A 3HFRA 3WJAA 1GLNA 2DR0A 3FTEA 3E4CA 3OT1B 2NXWA 2AUMA 3RU3A 3HBJA 1QVAA 2WJ4A 3KPUA 5E1DA 4J5FA 5KKNB 4A0GA 4CM4A 4ZJUA 5F2KA 1ZNZA 1IBCA 3DEAA 1SC6A 1XHEA 3MJSA 1OE0A 5FTKA 1ARZA 4RTLA 2AD5A 4HDQB 5BQ5A 3GNLA 3OQJA 4WDRA 3EN0A 4DNQA 2QSYA 1VCNA 1HGXA 3SXUB 4J3JA 2BLLA 3IUJA 1NIJA 1XZDA 3PHCA 3M4JA 1M76A 5JI3E 1T3LA 4ZDJA 1EIWA 1PVDA 2A14A 2H11A 1CKEA 2QRUA 3TK1A 1NKTA 2MMGA 2R8BA 3ENNA 5G41A 5DYNA 3OEHD 2DTDA 4ZXPA 4BBAA 1OH8A 4F3TA 1N78A 5HIOA 3P9YA 1I3NA 1KPGA 2CLSA 1SNYA 4C1EA 1P3JA 2VXYA 1SC4A 3CRZA 3FRHA 3KZNA 3LPAA 2Q5IA 1M10A 5HSGA 4UMFA 3FGPA 3IAEA 3DLBA 2IODA 4YJGA 4ESHA 1P74A 1CQJB 1IBRA 4XYLA 1GNLA 1FFEA 2B3TA 3I2YX 1SB9A 1HL3A 5LWHA 1JWAB 1P0CA 1XDDA 2Q6VA 4FIZA 4UHHA 4WNYA 3RFTA 2A33A 2XBUA 3RU7A 2CF6A 1U3CA 1MQ9A 1QQ7A 1V11A 2H2FA 4G8JA 4ROTA 3ROXA 3MA0A 2IYSA 2XPCA 2PVCA 1AQYA 1BEZA 2H00A 3QIVA 1ELOA 2CV2A 2ZPAA 5A4IS 3RODA 1KMQA 1FS5A 4GKAA 4HLUA 4CL0A 4B0PA 2HDOA 3SX0A 3B1JA 4G3XA 1XQ9A 5J4KA 1DO0A 4NYJR 5CXSA 4RPJA 4BLUA 4D02A 3NT5A 1ULHA 3VJRA 4ETNA 1CIPA 3P9NA 5EJIA 1RQ7A 1E18A 2GVDC 1JDZA 1ZIXA 2H63A 2HWWA 2JH8A 2XRMA 1HPLA 3EA4A 5DNEA 5F2EA 8AT1A 2OVBA 5AW6A 4B2YA 3SFZA 3DYBA 5HH4A 1JIUA 1PLJA 1CUEA 4NEHB 4QJIA 2F3PA 3T7CA 4B3IA 3HEAA 4FFMA 1DMSA 2DUMA 4WA7A 1Q2UA 3HZHA 4AJNA 1GVHA 2O1EA 1EGHA 1NVWQ 3ZQUA 4S05A 4YJ3B 4TSFA 1CQIB 1C2YA 2PX3A 4Y2GA 1W9HA 3PS9A 4UEOA 1E7QA 3DUFA 1I4TD 2VRNA 2VWHA 1R0ZA 4FFBB 4N03A 4XRRA 3NTRA 3VUEA 4MQBA 2Y1FA 4GWLA 5EMJA 1CUAA 4LDAA 4FFLA 4UVDA 5B1IA 4EG1A 3GCGA 4AMZA 1ZD4A 1Q0LA 3BJEA 3BOSA 4BJ5A 4G5HA 3OCZA 5A62A 4KDCA 4U9HS 2RGXA 2GA8A 1YQQA 2GNOA 4QXOA 1YB5A 4DABA 5JH7F 1RKBA 3RRMA 1XK6A 3I2GA 3ADDA 4HLDA 2BBWA 2ZRMA 1G5PA 1T2NA 3IXQA 3PNPA 4I9NA 5EP4A 5HF9A 3G8YA 2C7VA 5EJ6A 1S96A 4J4HA 2LKCA 1EH5A 4NBSA 2JA1A 2SKDA 3U80A 2F62A 1JNYA 3UWOA 2QZJA 3KLNA 2VYCA 3IUEA 4OIMA 4E13A 1BW9B 4Y6PA 4EY3A 1WW1A 3GA0A 3AI1A 2P5TB 3SW3A 3DFMA 3BFJA 3IP9A 3A2MA 2YIVX 3HA7A 2W2NA 3GARA 3FCCA 1UFKA 3DZGA 4UDXX 1I2ZA 3IEUA 1PKEA 2YXEA 3UCFA 2AFHA 3RUPA 4AJOA 2I8AA 1TQHA 1REQA 3QFHA 5CTAA 3WZLA 2W2LD 4QDTA 1YQXA 1GL6A 3DGFC 2ZYUX 3FKQA 4LQ4A 2NYPA 2V6GA 4EZEA 2JCVA 1GJRA 3TLCA 1XLTA 4YJ2F 3H13A 5AXCA 4D1YA 1KSGA 1QP8A 1S02A 4Z5YA 1BXGA 2YFYA 3S8EA 5HOQA 5EJ9A 3HP7A 4G1MB 4RELA 2UUOA 1JEOA 2O07A 1H65A 1S7CA 5CB6A 3K0EA 2CNLA 1KR2A 1BDBA 3H04A 2MMCA 3HR4A 3RABA 4BKQA 2PBRA 5DDIP 1X1SA 4P5EA 2OO7A 4YSKA 2CLHB 4DCTA 4LF9B 4KLZA 5C31A 1UBOS 2V4MA 6ADHA 1H69A 5BWNA 5K0TA 1YZKA 4U39A 3JD2A 4UEWA 4HL2A 2ZTSA 3F7TA 3SK0A 1G6HA 4BS9A 3LC0A 5K4HA 1O0BA 5LDDC 3MERA 1VTKA 3B3JA 4IKEA 1S3FA 3QXHA 4G0MA 2XI4A 3EIFA 3SVTA 1P31A 4CN9A 4GHWA 3AF5A 2IWRA 2WJZB 1K0UA 2BH9A 4E5VA 4GBJA 3SQNA 5F33A 1PTKA 1TKAA 3BWCA 2IEIA 1OBVA 1P0IA 3G5UA 3ZJ5A 2GK4A 4UNIA 3GGGA 4A4DA 4LN1A 1IJEA 2JJ8A 1Q5PA 4ERXA 5BUCA 1Z8NA 2QTVA 1RACA 1KORA 1YQ9A 1UOQA 1U0FA 3ITKA 3T5MA 2D00A 1WPXA 4X44A 3R9IA 3TVTA 1CEQA 2DFDA 5F9FA 1DAGA 1UPUA 1OB2A 2XDQB 1VE5A 4R0NA 3CSSA 2J3QA 2PVPA 1P80A 1KERA 1XZHA 5J1TB 4IQ0A 4NRDA 3R9XA 2X7HA 1X74A 2NO1A 2RB4A 5AKJA 3F49S 5G1NA 2IH4A 1JH8A 2HA3A 4PYKA 3BULA 3HKCA 2XZLA 1XRPA 1OLXA 1VXRA 1SD5A 5L4NA 5F23A 1H3FA 1SZPA 1TK3A 2LNDA 4LJ7A 3BQNB 5FBLB 5CIYA 3ZIAD 1QF6A 2YIDA 1N5MA 1KBZA 2PX8A 4BO6A 5JS1A 2Q07A 3KWFA 5EWMB 1PUIA 2QZ4A 3X1XA 4U0KA 3SFTA 2CJYA 3FYUC 3GRVA 3W6NA 3GLIE 1C2TA 5DI3A 1RJ9B 4KFTA 2CHEA 5I51A 3WYEA 4D3DA 1XP8A 1N77A 2BC2A 2Z98A 2F3SA 1URPA 1UP6A 2O3RA 1L4KA 2V74B 4BO1A 1ZTCA 1SCAA 3ZWCA 2VXOA 1AF7A 2BEWB 4ZVTA 2CDCA 1GZ6A 3ZKWB 4Q03A 1RKUA 4O59O 3IBYA 1ITZA 1T0HB 2XUAA 2YNMC 1OGYA 4U6QA 4MVJA 3TX6A 4JMPA 4D3SA 2QORA 3ZCVA 1GPWB 2P18A 3HSYA 2XCQA 3HUUA 4RK5A 4XTCS 5HR5A 4DV6B 2QRLA 4ZRNA 4UAUA 5JE8A 2B9EA 1TRHA 4QG7A 1YS7A 4OQ4A 4X7PA 2JCXA 1XTKA 3MT7A 1QRDA 3RYIA 1Y42X 3OIUA 2P97A 4HPWA 1A9XB 1XP5A 2ZSUA 3BWEA 3EWNA 5E1BA 1XJCA 3NO4A 2ZJ7A 5U4QA 1PD0A 2QAGA 5J4VA 5KCZA 4YDHB 1XBTA 2DCUA 1O6CA 2ONCA 4YR7A 5F76A 3SU8A 3QLVC 3CVOA 4C3OB 1X7HA 4EW2A 1H5NA 1FFSA 1VYHA 2ODQA 4CVNA 2WZDA 2PGXA 1V2HE 2ZT7A 3LT5A 2DFNA 3P9ZA 3W0LB 5EHIA 4Q7KA 1QTIA 4HK4A 1GDHA 1GPKA 4U00A 3RAJA 3MGKA 2BE7A 3KCQA 2XA1A 3WKCA 5GONB 4WLFA 3RVMA 2PWAA 1T6XA 3TVYA 1YJXA 1P3Y1 3AHJA 5D3MB 1SVWA 5A5FA 3ZCTA 4B81A 1C9YA 3ECSA 3UK0A 2DUWA 1LV7A 4URVR 3DOHA 4QAJA 1U9IC 3O0DA 1A76A 4ESEA 5HUJA 1NBAA 1WOMA 4U2BA 4JL5A 2AS0A 3ETEA 3FWPA 1AB5A 1JPVA 2PXAA 3IELA 5ERGB 1BYIA 1F1JA 3LYUA 5HIAA 5IDXA 2J4FA 1ZMTA 2YJ6A 3V7NA 1YWGO 2KQUA 3RW9A 2Q6KA 5CU7A 4F9TA 5IG2A 5DP2A 1EDEA 4IFIA 4IJ5A 2I33A 2IXFA 3AMVA 2GARA 3FZEA 2XAUA 4AY5A 1CUIA 3MT0A 3GLGE 1E3LA 3EY9A 2IPNA 4IWNA 1JDJA 1F2UA 3BB3A 3QBDA 5IJ0B 1QRSA 3Q0IA 3LQKA 4BMCA 1L5MA 1V8ZA 3PTAA 3VNVA 4AY2A 2Z6VA 3ZHXA 2VSXA 2XOKD 1WS6A 2ZRHA 3UENA 4Y2TA 1V1MB 1XD9A 1XJQA 4WBNF 5G1OA 2ZB4A 4RK7A 4UFNA 2O4UX 4I3FA 1ZMBA 1U2ZA 3DCIA 2EX1A 2QKYA 5COBA 4QHSA 3H9CA 3QITA 2Y27A 3RV3A 3KUDA 1THGA 5DX0A 4RIHA 5KJCA 1QOQB 4F6RB 3RBZA 1UQUA 1EAMA 3KVOA 1PUXA 2R5WA 4ZI7A 5CA1F 5EWAA 3GEMA 2IX3A 4R69A 2WWIA 4YPVA 2EL7A 2X4LA 3QE0A 3UWDA 4FSHA 4IH4A 2AYXA 4IYJA 2WFZA 1PL0A 4QBIA 2ZTLA 3ILSA 3NC1C 1NZJA 4KXYA 1G55A 3L6UA 4D43A 3C6XA 3H5OA 4LFCB 3ELWA 3GFQA 2OZPA 3I39X 4H3SA 3FFXA 3TUZC 1LD3A 4HQNA 1UMCB 1T36A 3DWGA 5JNVA 3T1NA 2WJAA 1DRUA 2Z09A 1N5JA 4CLOA 1VMAA 2I54A 3LLCA 2H51A 2N9UA 3P2MA 3ED5A 2BR3A 3KHSA 2A5FA 3GT7A 2ZOSA 2P8SA 5CVJA 2G9QA 3X1JA 5DBIA 4BGEA 4C4AA 4H7FA 3A06A 3L05A 2WEKA 3OM1A 3GLFB 5B30A 3Q7IA 4J0HA 1MUUA 2R9VA 4BP0A 2RHJA 1Z34A 2QLTA 2QRGA 1AQJA 1ZI6A 2XHEA 1E5TA 1E94E 1A95A 2ZSKA 2PCLA 5BQ3A 2F48A 4YLEA 3X1MA 3ZWKA 5I7OA 4KJXA 2NSJA 5AVSA 2NZUG 3G2JA 4ZCTA 3UANA 2F8TA 3KPWA 5BSTA 1BEUB 2EC5A 4B09A 4D3FA 1OV4A 2DP4E 5BYAA 1RPNA 3Q8MA 2CHVA 4TKLA 3NJ8A 5EAIA 2PZGA 2XTMA 3OF5A 3O31A 4ZRDA 2DFVA 4MW0A 5J9FA 4YQFA 3RF7A 2YH2A 5A7GA 1WUPA 5I9NA 4L95C 5GV7A 3MUNA 1MLDA 1OGJA 2B5VA 4MVJM 1NV8A 2Y4NA 4LYEA 5CDGA 5LFAA 1JSCA 4O5AA 2Y1WA 3N28A 5IJ9A 5TF0A 1R4NA 4D92A 3SNKA 1XLVA 5L3SA 4KZKA 2NXCA 3LAWA 5EE9A 3PGMA 3ZNOA 2MTBA 4LKOA 3D7NA 3AYZB 1EFAA 4HFRA 1YZUA 3JQAA 3R3VA 4RAWA 2JKYA 4QJ5A 1MRSA 4IDOA 2IH2A 4LSMA 4EBFA 2O8EB 2ORED 2WV9A 2EFDB 5E7QA 2OGSA 5L3QB 2C77A 3QLVA 2ZWIA 3GY0A 3WAGA 3TOCA 1JFTA 3QJ5A 4G8BA 1UC8A 1RBMA 1LWOA 2J0UA 3A0RB 5JFOA 2VJQA 4CM6A 2JANA 4AG6A 4M1SA 1P91A 1PR6A 5L6LB 4KR9A 1YQDA 3JQAB 3V33A 3WADA 1DOZA 4CQMA 2UZ0A 1XXHE 1ECJA 1RRFA 1UC9A 4GE3A 4TM8A 1O08A 3K0AB 4F7DA 5JV5A 2GBPA 3FJOA 3FNEA 2NZJA 3M4YA 4L08A 3W77A 3QHQA 3MJTA 5IWCA 3HHPA 3GJ0A 3RYCA 2FFHA 1QPBA 1Y4AE 1V6SA 4QUJA 3LHIA 1ABFA 1GSHA 1OC4A 3Q5GA 4JLDA 3LGAA 4D96A 3SZUA 4A5OA 4FUTA 4E4TA 4PO3X 1OD6A 2FKAA 2J3HA 4B9AA 3AVQA 1W52X 1BHJA 4BGIA 4NIMA 4AC9A 2HRRA 3LYHA 4YV0A 3EQ9A 3KLBA 2BW0A 3NTLA 3KTAB 3MS2A 3PF9A 3TNJA 1UXOA 4ITUA 5J43A 1TUGA 2FW0A 2IT1A 5LD2B 4QUKA 3COVA 3Q7EA 3R8XA 4W99A 3WGJA 2VZEA 3ZK8A 4PLPA 2BI7A 4HJRA 2Z2KA 2ZSFA 2R1VA 1O4WA 2Y1DA 3DGEC 4LXUA 1A9OA 3NOVA 5CCEA 3K8YA 1MQSA 3NAZA 2RGRA 4BNTA 4BE9A 3CEHA 1G42A 1GWNA 4OGGA 3NDJA 4GRAA 2HQBA 4IHJA 3KR2A 5F5XA 3GXOA 3TINA 1O6BA 1SOMA 4RESA 1BX3A 1VBMA 2O0MA 2VSFA 4OH7A 4RULA 1APBA 4FQ5A 4MOWA 4IQ8A 3I9LA 3R76A 4EBBA 4P82A 1WCV1 1S1CA 1D03A 3FMVA 4BV8A 3CKMA 5JS2A 2QHXA 2V7XA 1J0EA 3GFBA 3GP3A 1UK7A 3LI2A 1XD2A 1M2JA 2GBLC 3H1AA 1XTBA 5JYBA 2COUA 1VZ2A 3LKZA 2B7LA 2VTDA 3I30X 3YASA 5KVCA 3ETCA 4BP8A 1G5QA 2AF4C 3BS4A 1XGKA 4K9QA 1E1LA 3KNZA 4LHSA 4MKFA 3SC3A 1WNFA 1JJVA 2HO4A 4B7AA 4DSUA 3C3EA 3ITDA 5G0VA 1G98A 3DMFA 4R3UC 4EYKA 2TMGA 4LK3A 4TN1A 5ALGA 3MTBA 2Q0HA 1XAIA 2FB9A 2X9LA 2AN4A 3IAM1 4FE3A 4K87A 4L6CA 4W6QA 4C5CA 4C87A 3IP1A 4A2WA 3NFRA 1N2CE 1Z73A 2BDTA 2P27A 3TYXA 2V3CC 1J2UA 3AR2A 5JNSA 5AXOA 4C43A 1B42A 1T1IA 2NO7A 2WFAA 5DM1A 1DARA 2FUG1 4TWJA 1ATZA 1ZD5A 3K6SB 3C7AA 2A0YA 1UJ6A 3KVNA 4GT1A 3KSMA 1MAUA 3L1HA 3PC7A 1UFQA 3QNWA 4LJ5A 4UE6A 4PHTA 5BN3A 5BSGA 4F1WA 3GZ4A 2D54A 2FPOA 4H18A 4JEHA 4W1PA 4KXFB 3LO8A 1DRVA 4TZBA 1L7EA 1F06A 2FMHA 5IARA 4YAGA 3T3IA 4U7TB 4MIYA 4IIHA 3S2GA 1AUXA 3CX7A 4PLYA 2AVNA 3UC5A 2CE7A 3HJCA 2C42A 3AFHA 4MJXA 2VP4A 5KYXA 5IJ0A 3BG5A 3O26A 4D98A 4HNGA 3QGMA 1N5RA 1V1RA 1FLDA 2C4KA 5ESXA 1VKJA 3UK7A 3DB2A 1ULZA 3IV9A 1PFGA 3CNEA 1AN9A 3VPGA 4LGYA 2GVNA 4OYRA 4MWSA 1NU6A 5HKAA 3GZNA 3WLFA 1CUGA 6GPBA 4JROA 1PQWA 5EIFA 4EX7A 3ST7A 1U9YA 1EK5A 3ONDA 2N1MA 4UU0A 1C0PA 3KJFA 1XVAA 2AJBA 3OICA 4FOTA 4XKJA 3ZW8A 5B6PA 5IK2D 3CLRD 3DNFA 5ACWA 1SY7A 3F1KA 4ALKA 1LS6A 5BQOA 1SIWA 4H6VA 4MP8A 4HDMB 5GONA 1D8AA 5LD2C 3EXEA 1ICIA 4K6GA 4TMWA 2HCRA 2FE4A 2J32A 2JFOA 3EFOA 3QVXA 1II0A 4CM8A 5JAHA 1AQLA 2FHPA 3WYAA 5ALHA 4DOMA 5LMZA 4AQ7A 4Q0MA 3BORA 4EY8A 4E07A 2UZ1A 3D2LA 4XRGA 2X1HA 2CZQA 1KAQA 2QN6A 3W1EA 1H3EA 4YV1A 2GPAA 1QIHA 3OQIB 1XD8A 3WKBA 3TXYA 5EVBA 2UV8A 1ID1A 4MS4B 4QEZA 4RQBA 4F4UA 1KOJA 1MJ5A 1ODJA 2BHLA 4CL2A 1UC4B 1Z4KA 2HLPA 2VHJA 5T67A 4L7QA 4B71A 3K1ZA 3C5EA 4N5MA 1E7YA 1KIMA 1Q7BA 1XF1A 3M9XA 4CCYA 2E89A 4JU8A 3I5YA 3BAFA 2HPAA 1LSUA 3NB0A 5ADWA 4NAHA 5JADA 5LLSA 4FFDA 1C0LA 2XYHA 3CPJB 2ONKA 3HHEA 3PDCA 4PWYA 3RJMA 1V7PC 3L02A 1DOAA 3T1VA 1PF7E 1W93A 3O8BA 1G4UR 4G0OA 1ZMOA 4BIMA 3X44A 2A0UA 2F43A 2ZVDA 4NECA 4Q6BA 5HKLA 4TZFA 1X7YB 3AUXA 4YV7A 5IPFA 1JEEA 4GGOA 1NMEA 3RARA 2HRDA 3N2ZB 1SKMA 2WJIA 2PFKA 3W2IA 3JRNA 4LWPA 4X60A 1G8FA 4XIYA 3RS2A 1CVRA 1OAOC 1OVMA 2V5VA 2WKRA 3F6PA 1E20A 1CQPA 2B2NA 2R86A 3R6DA 4JENA 1BXKA 4WNAB 2VH1A 5AW1A 1T2UA 3T34A 2QP3A 2ZI7A 2X0IA 1T4GA 3M7IA 3O73A 3SPXA 3J7AC 5HBRA 2E5FA 2R1TB 2JH9A 5CGZA 4RADA 4PYJA 2BFAA 1LZLA 1XRQA 2GO7A 3E35A 5J1SB 1ST2A 1L5GB 3F8SA 4QBGB 1AKRA 3L6CA 2P62A 1MX9A 4HG2A 2XEXA 3ZWYA 4WBNB 1BXRB 4KLCA 1ZGAA 4TV9B 1WXXA 4JBYA 4KBGA 4GXRA 3V4ZA 3F9RA 3VPCA 2FN8A 3GRPA 2WG2A 1AGXA 1IPFA 1U2DA 2DBQA 2VWPA 1E1DA 3CZQA 2PRKA 2J9FB 3TTWA 5AQ1A 4CIWA 4N7JA 3UTDA 3R2UA 2XDQA 3IB3A 4KK3A 2XCOA 4XE5A 4CTOA 2XCLA 2QX8A 5A4FS 1LPSA 3PUHA 5K8VA 2KE5A 4RKFA 4Y7DA 4ZO2A 2HLNA 1I0IA 1HR0B 4ZO9A 3PY6A 1KY3A 1L8XA 1PP4A 4KNVA 1Z0UA 4GGMX 2XMQA 3CBGA 3HN7A 4PBRA 1E2JA 2WJ6A 4KIUA 4FR7A 5HQ3B 4RORA 4S1OA 3V8QA 2ZCJA 5JZ9A 4M1TA 2JAQA 1GGVA 1L5VA 2WF7A 4YA6A 5EEGA 3TWOA 3ZQKA 3NRBA 4B3TB 1NRWA 4UHEA 2AWNA 3P27A 1Q0ZA 4UDNA 1VPWA 4IIJB 1MF7A 1RWQA 3JQGB 1AKUA 3AHCA 1GAWA 3KJXA 2YXBA 1PLLA 2I3AA 2O9JA 3H19A 4LI3X 4AF7A 4ZN6A 3MPUA 2ZE7A 2NV6A 3I62A 4AMBA 3HO6A 4ESOA 4J49A 3W8RA 1DXHA 4RIGA 1A8PA 1C81A 1HE5A 1ZN2A 4XJTA 2XOXA 4B2LA 3BXGA 4KR0A 3QWFA 4YDQA 5JQGA 3GFOA 1SB8A 1WA5A 2XDYA 3ISVA 1AKYA 5AKXA 1CR6A 1NOIA 2OCKA 3DVLA 4BQRA 3UT5A 2P7HA 3PDIB 4R2WA 4NU8X 5U1PA 1GGEA 2XOKA 4F06A 5IXYA 2F1OA 2V9CA 3PDJA 5DLEA 1B14A 1Z88A 5L7WA 3H2GA 4QARA 4AXXA 1G17A 1VXOA 4KPUB 3N0WA 4FGJA 3HU3A 1CXZA 3II6X 5E9WA 2B8WA 2H2GA 5EWLB 4YRZA 1XNRB 1K5GA 2IA5A 1R15A 3SSAA 5MGBA 4EO9A 3SD7A 3A1VA 4UQOA 3L6DA 3R20A 3GLUA 1VMKA 1T10A 4PRZA 1HE1C 1NMZA 3WY9A 4IHAA 3MELA 3SQXA 3AUKA 5IKOA 1JILA 2QI9C 1SCQA 2D3TA 4FHEA 2Q5LA 1NBMD 3OLVA 2IP4A 4HGZA 3THOA 1VKHA 4L8WB 1XRRA 3K0FA 4PSVA 4M8NE 4RVFA 1ZJ6A 4LHZA 2VHUA 4JT9A 3TB4A 2IE0A 5CB0A 1R6UA 4B3DA 2CLLB 4YMHA 3FDFA 2IZ1A 1A9PA 1GSOA 4GMGA 3UWSA 3GEHA 1OOEA 4ZI2A 1PS9A 4NZMA 3CX4A 1HT0A 2X13A 3PQ7A 1KI8A 3LGXA 2VPWA 1G3MA 1SCDA 2UYOA 4Q3KA 4RQUA 2YN0A 1M2GA 2GM5A 4O4JF 1Y9EA 4C7OB 3HYTA 1I5OA 3PEYA 4MRVA 5I7WA 1N1GA 1UADA 5KINB 2OAGA 4F8YA 4D0NA 1WBBA 2RKWA 5CPBA 4ZOLF 3ND6A 3VR3A 2FR8C 2Q4BA 2A9PA 1BROA 1R0RE 1XSEA 2PUTA 5ILQA 5AI5A 4KREA 1C1YA 1Q0HA 2FGJA 2ZEJA 5M2QA 1CJTC 1O54A 1GZHB 3A37A 2Q99A 3I9KA 3BVPA 3FJYA 3QK7A 4LNUB 2WHYA 1P4AA 4IH9A 4XDGA 4PC6A 1U4OA 2POCA 3G2NA 3VKVA 3MQ4A 3ZNPA 1WXWA 2N47A 2PKYX 2XYPA 1M6NA 3FLBA 5CVUA 2GVZC 1R4NB 4C22A 1D2CA 2HMTA 4D0GA 3I15A 3AF1A 2E6KA 1GR1A 2HCJB 1DT3A 3I6YA 3UV6A 2FF5A 4XVHA 3S70A 3IJ5A 1JAHA 3LD9A 3D6NB 1JG2A 1ZD3A 3N0TA 1WG8A 2BFFA 3C8UA 4TMYA 3QSGA 4RCYA 4URFA 3QOYA 1T1EA 4PNZA 1IWOA 1IG0A 1CFJA 3PFCA 5E7JA 5T5QA 4YMUA 4DR1B 1EX7A 4M0EA 3CG0A 3COJA 1YVPA 1NDUA 5H81A 3ZHZA 1K75A 4R5HA 4HV4A 5FA8A 1ENZA 4NF2A 2I1WA 4XFJA 1GPDG 2ID4A 2R47A 1A88A 1UXKA 2EW8A 4IVPA 3RRZA 2NADA 4H7IA 2PAFA 3W6UA 4BX0A 2WJHA 4UARA 1DEXA 3DXZA 2C96A 3THSA 4HGOA 1DQPA 1S1MA 5LQRA 2JLAA 3H16A 1E2EA 4KMSA 4YRJA 3UUEA 2OT3B 3OEHA 4MR7A 2C54A 3F3KA 2LTAA 3C39A 5DGDA 2F4VB 3KOWA 1MVNA 1SUSA 4LQDA 4BVJA 3CTPA 5L45A 2CLFB 3F73A 2NNWB 1W0JA 3AONB 4F5EA 1QIKA 1VIYA 2FMIA 4YQEA 3IEPA 4NZZA 4FQ8A 4WXEA 5I7UA 3OJLA 2H9YA 5TF4A 1ZQ9A 4XGNA 4BXOA 3IEXA 3NV7A 1R0KA 1LPPA 3EY4A 4RFLA 3LRPA 5EGSA 3UHOA 5KQPA 4LZNA 4O4LB 1P2VA 3CINA 2MR6A 5ES3A 2EP7A 1KPIA 4NYMQ 2LRHA 1E64A 5C51B 3EEIA 4E12A 2ZQZA 1WDWB 4YGXB 3DHBA 4GL4A 2IYEA 3ACCA 2W2PA 1QIGA 1NSTA 4X6YA 3SBOA 2JK1A 1VKOA 5G0SA 3A6JA 3OAAA 4RANA 2XDAA 1DVRA 1HFJA 2BOVA 4PVDA 2XGOA 2FPLA 1D2AA 1VIAA 2VP2A 2ZRGA 3MNFA 2GRJA 2XB4A 3NIGB 4HDRA 4N3GA 1JG7A 2NN3C 1VGQA 3FDJA 4M9QA 3NHRA 4ZEXA 3IAHA 2HI0A 1UOPA 4XIGS 2JGIA 4M1EA 1PS8A 1YZLA 2J4DA 4H1UA 4RPLA 2IYFA 4LE0A 1AURA 1AK9A 1L4BA 1OFHA 2FKNA 5HHTA 1KYWA 1BKDR 1Y3FE 3UFXA 2BFLA 1GAXA 2C2GA 1P7VA 1CTQA 4XWTA 2C9YA 2Y1LA 5CUQA 2MINB 1GYRA 2G08A 3RVDA 4D9FA 1HE8B 4YV2A 1P19A 1SJ9A 1YU6A 3KQVA 2V4UA 4RM5A 2R1TA 1WB5A 5TV2A 3ZY2A 7REQB 3I0MA 3VBCA 4YONB 1E3QA 5BMVB 4TZ0A 2AQIA 3PC4A 4NMHA 1TYCA 2Q1UA 3C6BA 4F84A 1NKVA 5AQEA 1BGXT 1H2AS 2XIQA 3PFBA 4HX2A 5COQA 1O97C 1JQBA 1TMKA 3M6MD 3Q7RA 4KUHA 4RAOA 4UBOA 2GF9A 5JNTA 1L1EA 1N2SA 3C7DB 1I2MA 4H3HB 1IZZA 3R7AA 1GQ2A 1X7YA 1EUZA 1YB4A 2XLBA 2NP7A 4IQGA 4ZEOA 1EXVA 4INAA 1SKBA 2QG6A 2PTGA 3V2IA 2IW3A 4DLKA 4TWIA 1W1IA 4X65B 1B73A 1WUKS 3FMIA 4INZA 4KU4A 5DTRA 1U0GA 3ASYA 1USUA 4L4RA 4C08A 1NYRA 2HRCA 4R8SA 5EJMA 5IP5A 3RUAA 1Q1NA 4CCYB 1DPFA 3PDHA 1JHZA 1N25A 3ZW9A 1I3CA 4JXZA 2XA2A 4OATA 1FZQA 3SHQA 5I7RA 5EQFA 3DE2X 1NT2A 2RGNA 2V7PA 2H59A 3B52X 5AK5A 7MDHA 4OP1A 3COZA 1C7JA 1FMTA 1YB1A 2P6PA 4BVEA 3FUVA 3PXXA 1XTIA 2ZO4A 3I73A 2AYYA 5CPFA 1BCSB 4P32A 3UG7A 2RC6A 1EE1A 2XWPA 4Y98A 1RM0A 1CERA 1DKNA 2WJPA 4HH1A 4TROA 1G9XA 4TL9A 4TTRA 5EJAA 1D2MA 4LC9A 1ID8A 3ELBA 1QLWA 1HE4A 1T3TA 2VTEA 3IAS1 1UPBA 1EB8A 4H7JA 3MUFA 1YFLA 1T13A 1IZ7A 1DL5A 1YBAA 1O96A 4KJZA 1NV9A 2EATA 2MT9A 2VQSA 4PF1A 3RFXA 2IYVA 5AVKA 3UOAB 4Z2AA 5C8YB 4KLAA 3O0TA 5FB3A 3VR6D 4CDNA 4HRYA 1V5WA 2MSLA 5FOWA 3WIEA 1AHPA 4KXMA 4KX3A 3EZNA 3JR3A 4M22A 3TNLA 3OOSA 2R8ZA 4EPWA 1R8XA 5CYGA 4TRJA 4EATA 1GXSA 1QVVA 3TGPA 1NBEA 3EHDA 1DG3A 4JUDX 4NOJA 3G9ZA 1X8JA 4MV5A 3LPMA 3IMGA 4O2LA 1H4TA 2GCGA 4BU0A 1HOXA 1M1UA 3O94A 4K7JA 4WZBE 2GA9A 1X7ZA 1O97D 3LH5A 5B3KA 2F7SA 2W2TA 3E3AA 1R9JA 4RMHA 5E1MA 3WGQA 5EWMA 4WKCA 3C3BA 1N8KA 1Y4ZA 3IQFA 1H94A 3K9HA 3DBRA 3UWMA 3HKCB 4LZPA 5DXJA 5JI2E 2VHEA 1IQPA 2W2KA 5DTMA 1XV5A 1OROA 3CVUA 2QVLA 3L43A 3DT6A 3OCWA 1VL8A 4ZGGA 4ZOQI 2XTJA 5AKHA 1UMBA 1P0QA 3WL4A 3AI3A 2DQKA 5JAMA 1WY7A 2FQQA 2MSKA 1WCWA 3O03A 3ESDA 2G7MC 1HDEA 4C7BA 4EHFA 5JW6A 3ILYA 1HFKA 2WKPA 3GDGA 2VP9A 3FMOB 4I1OA 3MTAA 4DXDA 1Z7GA 4HVCA 3OTOB 1TL7C 2WSIA 3ZPXA 4QVKA 3K96A 5F4BA 5LQMA 2HK8A 1EFRA 2H16A 3I83A 1J21A 2AOUB 2FOIA 4R05A 3OZ7A 3TQIA 4J3FA 3RVKA 4R9SA 2PUAA 3JZFA 3RREA 5B3AA 3VGJA 2VPTA 4KOAA 1INLA 2N3ZA 3IP6A 4NCJA 1MH1A 3ENZA 1Z0SA 3AU9A 3B6EA 1N6HA 4IMIB 3G8BA 4HGYA 5BSRA 4O1MA 1I0LA 2ILVA 3SFPA 2G1JA 5D8DA 1YJAA 4M86A 1JFSA 4YCSA 1KQOA 3FI0A 2ORVA 1C7IA 1RC0A 3K20A 2JATA 3KOXA 1T6ZA 1CUCA 2A4MA 3D5QA 4K6CA 2R8OA 3OD5A 3KHUA 3P4YA 5HZMA 4E1AA 2OD2A 1FMLA 1OA1A 3KDAA 5HKBA 1KIFA 1SKYB 3OFNA 1EXMA 2VJYA 1G20A 1TOAA 3O8OB 4TS4A 4ABYA 4A36A 3E3OA 3HN2A 3ORRA 4C3ZA 1P61B 3KC2A 1B0UA 4IZOA 4PY2A 3OO0A 3DHYA 3ZDFA 4DAEA 4EA9A 1DEHA 2CCJA 2E7YA 2QXYA 1CZUA 3G6KA 5A3QA 1N8NA 3FSGD 5JASA 2C2HA 3AJEA 2VQDA 3QE3A 2IFTA 2IPMA 1TMYA 1EK6A 4HQ6A 3WQBA 1G5IA 1H0HA 1Z47A 1X8LA 2EYQA 1NVMB 3BF7A 1XWFA 4YO7A 2GPBA 4CT5A 1EX9A 4P38A 1KOGA 4ZVPA 1C1DA 1XRLA 2DQYA 2PX5A 1AKMA 2JDIA 1MU0A 1G2QA 2XGGA 3TB6A 4NQRA 5AHKA 5FWYA 3IULA 4BB5A 3BMNA 2HQ1A 1VJCA 3UWKA 5BWMA 1FYWA 1T9CA 1YZYA 3LLVA 1QE5A 5ANRB 4QVIA 4P8RA 2P7IA 4B6JA 2BGTA 1FVOA 3PUZA 4NX2A 3C5CA 1NM5A 3BDAA 5TB5A 3WK8A 3N87A 3NGXA 2R7LA 4P98A 4GVXA 3AP2A 2Z95A 3HNOA 3STVA 4BGDA 1YTUA 2O59A 5IS2A 2Q3LA 1C8BA 4AG5A 2X0NA 3FW1A 5EI5A 3STTA 1A9ZA 3ID6C 3EDOA 5G4KB 4M4SA 1VL0A 1MJNA 2ZIZA 2X7XA 4JVOA 4P0TA 3X2YA 1BX0A 4ZDKA 1SBCA 5M7EA 4YJKA 4F6ZA 4XD2A 2Q5EA 2QTTA 3CU5A 4DCVA 2WSYB 1WQ3A 3DH0A 4CIVA 2L2QA 3LUDA 4DC0A 4W5JA 1A2BA 1RWWA 1YZ3A 2WP0A 5FOSA 1K86A 4N76A 3WGKA 3QVWA 1QGZA 4X91A 1U3GA 1W94A 2QR5A 5IMBA 2QZSA 4EYOA 3K70C 3KYJB 1MTOA 4XWAA 1ISHA 1QLJA 4WINA 2PT5A 5CXXA 5LXTA 3VR6A 2GBIA 2PVSA 1C3OA 5F21A 5BNZA 1IAVA 1YVEI 4JJFA 4A8PA 2PU5A 4TVBA 4YQYA 5E3HA 2EOAA 1KVRA 2QT1A 4ARBA 2V6FA 3R6WA 4P58A 2HEIA 3A4VA 3AESB 1Y3HA 2CUZA 2RHBA 1PJ3A 1IK6A 5KNCD 3B6KA 4QU9A 1J00A 1A2QA 2JF0A 4NSNA 2FU6A 2BP7A 2H2DA 3W05A 2A4KA 3EEBA 2XKJE 2E4WA 1JTEA 2H5IA 2B37A 2FEAA 2BFBB 1KJZA 1XXHB 4A8HA 1LI5A 4BUJA 1PVOA 2P6OA 1G6KA 1ZEMA 4WWHA 4BEJA 2W93A 2FUCA 4ODIA 5CYPA 5IT4A 2QK4A 2ZP1A 1EDOA 4DWJA 4MB2A 2ASEA 4L6AA 2XEDA 4B48A 6REQA 1XEAA 3FTNA 2OKGA 2HT6A 3AR7A 4IXNA 3H9EO 4W6ZA 4X7MA 5AH0A 4Z3KA 1Y34E 3ANMA 3FYCA 4E31A 2F9MA 1C3XA 5FBQB 4AAYA 1NP6A 3AX6A 5JXIA 1CP2A 4X54A 1T24A 1CUFA 1PFKA 3L07A 2X5OA 3EGEA 5JR3A 4JSYA 1YQTA 3CT6A 4NR0A 3WDLA 4TYMA 3O3CA 3C6MA 5FPQA 1NNEA 4AM8A 4MYUA 3TR6A 3UA4A 1FK8A 5CM9C 1QO0A 2HWYA 1FVHA 1RE1A 3S2ZA 4JUBA 2UZIR 2QIOA 1FDVA 1CQWA 2ZJ5A 5KTNA 3NEAA 5HBGA 3KLMX 1WP9A 4CTKA 1YONA 5JJ5A 1JFLA 3A9SA 8ADHA 2O3SA 2HQRA 3GUZA 2IU3A 2GCOB 5CYFA 3RHSA 1YRQA 3ROZA 3QI2A 1YR9A 2WP8J 1KAOA 5J5CA 3ZXUB 4DE5A 5BXQC 2PSSA 1MN6A 2BMAA 1D4ZA 3RUCA 4BRUA 1E1NA 4QBHA 4E5KA 2UDPA 2AKYA 3MWEB 5TEVA 5LM6A 5FIUA 4BKPA 4MV7A 2HU5A 2JFXA 2GLTA 2PMDA 2NIPA 5DLQC 5JNUA 2NUPA 3TW8A 1EE9A 1M6HA 2VJLA 4TQGA 1VCIA 1DJLA 1WZEA 2A0KA 3HL0A 3RS0A 5GP1A 3ZNNA 4EY4A 3V34A 3ZDAA 3FY4A 4FC6A 2P5UA 2J48A 1QCZA 2YQZA 3OIGA 1TM7E 4L76A 1I7NA 2WUVA 3H75A 4FS8A 5AR1A 3PVCA 1RTKA 1NG1A 2WICA 3R9KA 3DCNA 4WUTA 1ESMA 2FZEA 2OCBA 3QKRA 5GADl 4IBOA 2BI8A 2RE8A 1V2GA 4W5QA 1W36D 4QOIA 1JFRA 5EHTA 1QF9A 2HK7A 2OUIA 1GA4A 1GOTA 3DNPA 1WZIA 3R5JA 3LA6A 5E3JA 5JCZA 1IZ9A 3OLWA 3U60B 2FJUA 1NR1A 5D3MA 2XB6A 2BTNA 3K4PA 4M87A 4YJFB 2PD6A 3PFWO 4EQ6B 2WUWE 2HMAA 2HSZA 5AVXA 1RI2A 2NACA 4HBGA 1JUDA 4UMEA 2CMDA 3V6MA 4O2BF 3LF1A 1OHHD 3MINB 2AVDA 2BUBA 3CZPA 4PIMA 3GJ6A 3BMQA 1SQ5A 5AI4A 1CJVC 1QR2A 1VHQA 2QUZA 4JBHA 5B58T 3AJRA 4YRKA 2AC7A 3QKIA 1YS4A 1XIVA 3CUEF 5GGYA 3QH4A 4Y9RA 2XNHA 5JOQA 1U65A 4F2PA 1GT6A 1TGVA 1U7TA 4JA0A 4F9FA 3LDHA 3SZLA 4B3JA 4YUAA 4ONEA 5B53A 4BFCA 1AGNA 1MA0A 3EVEA 3FYSA 3PT9A 3DF9A 1KQ3A 3UK2A 2BDEA 4QDKA 4AJ2A 2FPGA 2O1WA 3REGA 4EB8A 1A2KC 2VUIB 3G9XA 3K1AA 1JIIA 3JQBA 3SOZA 2R68A 4BVAA 5ADHA 2ZE8A 3MAJA 3ZWVA 4E46A 4EVSA 4EMTA 4R1PA 2D13A 2QQ0A 4MB6A 4Q37A 4ZA2A 4BEVA 1MABA 3AW9A 2PL1A 4XFKA 4QVGA 3IMFA 3P0IA 4WLNA 5T3UA 4YY3B 3OMWA 4OKNA 1OAOA 2VWGA 3O75A 3OIDA 4NZNA 3N39C 1MAHA 1TF2A 2W4QA 1LF0A 3I58A 4MRSA 4PZPA 3JPWA 4BMDA 3A58B 4EG3A 4UHKA 3RTEA 1W8DA 1YQEA 4NBKA 4DEXA 4ED9A 3AVUA 3DZBA 1RDFA 3CUKA 3DEIA 2PXHA 2ZI6A 4PHHA 3U61B 2EKQA 5DI3B 5A4MS 2KHZA 1V16A 1P6UA 3HBLA 4MYTA 1PR5A 1KETA 2JFZA 1T9ZA 2CYAA 4FMPA 4M0DA 2DLDA 1B74A 2NQTA 1HT1E 3DR3A 1EMDA 1HQKA 2TSYB 4AJLA 3GLSA 1XWIA 1GFWA 4LVUA 4OY3A 4CM5A 1X1DA 1YT5A 2GAIA 1A1SA 1V95A 4QJ3A 3C3YA 1HDCA 2ID7A 4GOND 3VZRA 4D3ZA 2GO1A 3WGUA 4EJ2A 4UM9B 3PD7A 3IJPA 2FRVA 4EKGA 1T25A 1M2NA 2ZIFA 2EJWA 4WBXC 5JCJD 2OYSA 2ATXA 1OIXA 1JU3A 2AN5A 4D4LA 5E8JA 2H1RA 1DC5A 1MIOA 4KEAA 4FMDF 5P8WA 2BYTA 2AHRA 2MYPA 1KDPA 2VYVA 1NL3A 4UJ3A 5I47A 4RABA 5E4JA 1C8KA 4FYPA 1N6LA 3VGPA 2SICE 1R0XA 4M9ZA 3AV3A 3UT0A 2DY1A 4DTCA 4XB1A 2Z4RA 2JLYA 1KRXA 2GTIA 1Z0AA 2QZPA 4PLCA 4ZHQA 3MWYW 3KETA 4DZRA 1W1WA 2OHIA 3I0NA 1XFDA 3JQRA 4UOEA 1NVXQ 2FCRA 3NAQA 2VHTA 4AICA 5HZGA 1WHTA 1ZGBA 4JYZA 3R7SA 1EWKA 1JU4A 1WOYA 1LXCA 4M0UA 3DDZX 1Z25A 1KJWA 1PFYA 5HDBB 3D2AA 2GHTA 3OJCA 4FDUA 5KPDA 2V5AA 4MUAA 2I7VA 4PO1A 4X90A 2ZRJA 2R3SA 4KV7A 4C06A 2BL4A 2G67A 1PBTA 3CEMA 1F1BA 2EXXA 3KO8A 3UJ7A 5IJAA 1Z3IX 1GG2A 2J85A 3CLSC 4KE8A 3HV0A 1Z7BA 4ZOLA 3SZGA 2R62A 4DHEA 1OTYA 4OOEA 3CUVA 3PHJA 5KMGA 1QO9A 3EYAA 2ZI3A 2ZT5A 2HHAA 3LLMA 1U3UA 1ECFA 1PR3A 3DG9A 4EJMA 3QMMA 1JLLA 2PMWB 2QTZA 1YHNA 3BIWA 2ZUUA 1U3VA 3QBTA 4MPDA 2CFZA 1EGMB 1ESNA 1SUEA 4I0WB 4HDCA 4OKIA 5T4BA 3V3KA 2WWYA 1UH5A 3L7YA 5FUVA 5TY0A 4XIJA 1XX6A 2HZ7A 5BOVA 3WP1B 5BNFA 4W5TA 4I36A 4MIOA 1X9GA 2W37A 2PH5A 3MMPA 2XT9A 3U6BA 3THWB 1L5OA 3KZOA 3RH0A 3RVRA 3NHAA 5CBPA 5F1OA 3FPGA 2I22A 4AT1A 4LXYA 3BXEA 3EGXA 5EVJA 3QYJA 4I5EA 1MO3A 2A3NA 2ERXA 1M2VB 2F59A 3HJNA 1Q6ZA 2PGIA 3OLZA 1JYFA 2E18A 4LGVA 1JXOA 1CDOA 1ZRMA 1QE0A 3BXFA 3O8OA 5ACVA 3C98A 5KI6A 1J8QA 4JOSA 3HKEA 4EB3A 3SE0A 2BFKA 4P7GA 1QG4A 4ZQCB 4CM9A 3OQHA 1TLTA 5JSHA 3RC8A 3NWEA 2XUHA 2DHDA 2H1LA 2D0IA 4AK9A 4AECA 2BI4A 3L7AA 4RZSA 1QQ6A 1OQAA 2H1FA 3ZI4A 4CIDA 4DLAA 1FNMA 4UAMA 1VJDA 2OLKA 1DG1G 2QF7A 1Q16A 4J0KA 2JIRA 5DTEA 3Q8XB 1Q2XA 4GX5A 2DSTA 1UKVY 3Q3VA 3G02A 1OI7A 4TLBA 3BL6A 3SQDA 1N32B 1HLKA 1XMVA 3CMMA 1W5EA 3H1BA 5B1HA 4K05A 2DJIA 1U8XX 1OVGA 3RQSA 1J7JA 3ADRA 4XSVA 2GFJA 3NIDB 3KKLA 1QIFA 4FD2A 4HXFB 4L2IB 3D6TB 1TUBB 2X4IA 3WI7A 1OWLA 3ELDA 3ZE1B 2B98A 4C0KA 5C7YA 4R83A 2GWHA 3JYPA 4G89A 5HA5A 4V1CA 1HRDA 3IX7A 4WECA 4PS1A 1X15A 1L5QA 1YIDA 4YAOA 4PC7A 3DZKA 1FMCA 3AOEA 1F8GA 3ETGA 1J8VA 1G66A 1JXQA 2HLDD 5CFQA 1AMUA 4B3SB 4J2TA 2QMEA 4Q9LA 5DCUA 1Q21A 2C58A 1T43A 3DXFA 4PYMA 3T3PB 4EYLA 3LX8A 2Q2NA 4V0QA 1KI6A 2IYLD 4XXHA 4Z1MA 4BATA 1LBHA 5EIEA 5J4LA 1DBIA 2AE2A 2DERA 1PQ4A 1LTKA 3TM5A 3P71T 3SAJA 4X41A 4OB6A 4F9GA 2KMLA 3GAAA 5CVCA 1HQYE 1XPJA 2KM1A 5JZMA 4LAFA 4S0ZA 2NU9B 1GN9A 1NW7A 3TL2A 1PJQA 2OHOA 4LJRA 3QENA 2MSEB 4JI3B 2IPLA 2CNOA 2ZYGA 1RPTA 4IIFA 5J2TB 2BRUA 2V55B 4Q82A 5L3RA 2GFKA 1TF5A 5M29A 4TUYB 2W22A 1R6AA 3ZC3A 1NUHA 3EBPA 2OYCA 3O3MB 4B3CA 5TPZD 4WX2B 2ADMA 3E8XA 3T3EA 3U6KA 2VK4A 1Y3CE 4KGVA 3T8YA 1KMIY 4XCQA 2AEMA 1IN8A 2OFXA 4PNEA 4HSGA 5EVCA 1TFUA 4MB0A 4RCZA 3ZZTA 1XOIA 1L1QA 4JI8B 4R40A 4YACA 1DJOA 3X2ZA 2WTNA 2FSHA 1JMKC 2QW1A 4Y6QA 5DHUA 1Z0DA 5HQJA 5K51A 3CIFA 3R6GA 2XJ9A 3EPRA 4R2MA 3UAYA 2O2DA 4DBLC 5HXAA 4D5GA 4G56A 4M2LA 1V1JA 3RS8A 1R10A 3F8TA 3I61A 4XPIB 2WWHA 1HFWA 1U31A 3JWGA 2QTHA 4G84A 3AVYA 2QMZA 1SURA 4K03A 5CAEB 2GN6A 4D57A 3MMZA 1GCAA 3STWA 3USCS 4QNRA 2Y1EA 1HNWB 3GLHA 1XTJA 4PR0A 3GP5A 2WQ6A 1SCIA 2DT5A 1CY2A 2DX7A 3FNQA 4AULA 3NUGA 1D2RA 2KI5A 4YCCA 1IBLB 3P2UA 4BO8A 2H17A 2IUTA 1UCFA 4CTMA 3VVBA 3IUBA 3IB6A 2BGUA 2MCFA 3WAKA 1T2EA 4CQNA 1A97A 3SKYA 1JW9B 3RJZA 1DKQA 1GKIA 1YRAA 2BKEA 3GRFA 1KVTA 3MT8A 5G40A 5TGTA 3VAYA 4L4ZA 1I7QB 3MOIA 1C3LA 3WFZA 2VXBA 3QVMA 3EWAA 4UHJA 4XQ9A 4A16A 1MO5A 3HPQA 4H6XA 4DXAA 1P2DA 4MEAA 3HB7A 4ZCQA 3FVQA 3AV0B 4G1EB 3RTDA 4K0RA 4NPCA 2CJWA 2GXUA 4LMRA 1PDOA 2YY6A 1RQXA 3DS8A 5K0JA 3IL2A 4DNPA 3HJGA 4NCIA 4Z6KA 2XNDA 5CXQA 3DQPA 4UOZA 2RK3A 2YJ4A 3Q9NA 3DBLB 2Z0MA 5IVKA 4YMLA 3V46A 2QBYA 1HYQA 3AETA 2JC3A 3D6MA 1JJTA 2FPPA 5IJWA 5G53C 3FJ1A 3IBCA 1NBME 4ZI3A 5D1NA 1ISSA 3NHMA 4L5YA 4UASA 1XTQA 4M0KA 2WG0A 4MXDA 4QRHA 4A2QA 1MNAA 5AXDA 1J0XO 2MJLA 1YMQA 2PLFA 3ORFA 1XEXB 4MO2A 4JJGA 4HAUA 3WSTA 3WK4A 3LCMA 3Q98A 3R3HA 3G17A 3KT3A 4UVHA 2P11A 3ZTWA 3AY6A 3U3OA 1TA9A 2CLKB 4NVRA 4DLXA 4DJDC 5BPHA 1P73A 1XMPA 1WMDA 4PO8A 1FXWA 3ZWPA 1GUBA 2QD1A 2F8MA 1V7CA 4NBNA 1RMTA 5HM8A 4HWOA 2Q6TA 3W5IA 4BEWA 1U1DA 3WA6A 5E38A 4LMBA 1GQFA 1EHIA 1LQTA 1YSCA 4OQNA 2L0XA 3MJHA 4I4TF 3ZN2A 1W46A 1E2BA 3AHGA 4CMBA 4R6WA 3BXZA 1E9DA 1YASA 4NHEA 2NQ2C 3GMIA 5ULLA 4GX0A 2QM8A 3F5QA 4RVOA 3BGIA 5LCHA 3GNQA 4BMPB 2GKLA 4DCCA 3L79A 2VJAA 4QFDA 1XALA 5DBFA 3E5RA 4Q24A 5TR9A 3T7SA 1LA2A 1BMCA 3KDPA 4C4OA 1CZKA 2RBEA 1CY8A 2BFDB 4J0CA 2O6HA 1OB5A 4JT4A 4ZU1X 2ZSAA 4EW3A 5ICMA 1EM8A 1DBWA 1JDBB 4K1LA 2V7QA 3GU3A 1IOLA 3R0IA 4I55A 1SN7A 4ND7A 5KYVA 4F0JA 1UM8A 5IABA 2D2EA 2GR9A 1LBEA 3Q6VA 2BP7B 3GVXA 3HXKA 4YB8A 1I36A 1TXGA 2JCSA 1XU4A 5DNDA 3WGGA 1ODLA 2JGLA 4S1WA 2OC4A 1E7MA 5DSXA 1JTFA 4L9AA 1JPNA 1AOXA 4YO8A 1W4RA 2JFQA 4Q18A 2JVKA 4GM1A 3WYFA 3TXAA 2BFCA 3K5WA 2ZIXA 4EM6A 1HSZA 2DR3A 4DRXB 1KFKB 5BNWA 2BZ0A 1NLMA 4R71A 4TKVA 3J80A 3PKIA 2ZSIA 1VLMA 5D87A 5KHAA 2X58A 3TZEA 1ZJZA 3DR5A 2IP2A 1QZXA 2VL7A 4WMLA 3OURA 3W06A 4JS0A 1DRKA 1TUBA 1LI4A 4YT2A 5B7QA 2P2CA 4CMJA 3RHFA 4KQ2A 1CG6A 1KZ6A 2C99A 1YL5A 2XCRB 2D0PB 4HZGA 2G1AA 1WSDA 4ND8B 1GO2A 1ZXBA 4ENPA 3C48A 3UKOA 4G8CA 3ZWXA 1B0AA 3C8ZA 1YNOA 721PA 1L3IA 5K6RA 4BASA 5F12A 4MW6A 5DTQA 1J24A 3SR0A 2VF7A 1ZBDA 3DDNA 3KCNA 5LQJA 1T9HA 2MDTA 3PU6A 1XL0A 1AUOA 4KYIB 2Z4SA 2B9VA 4FGSA 1MA3A 3BE5A 1VIMA 4C7OA 5E6SA 3C4QA 4CHGA 1J0DA 1IAQA 1V41E 4X1IB 1GNSA 1XTOA 1EK1A 1RZRA 3R7WA 2HAEA 2G9UA 3PHBE 2ODWA 1HK7A 1FFYA 4JJIA 3EGXB 2I7DA 1BXZA 4EUKA 5JJLA 1CE8B 3C85A 4C1NA 2Z3ZA 1VHWA 4FCVA 2JAUA 4BAUA 3OIFA 3KSBC 2NAFA 1IZ0A 4IIVA 2QX9A 4JBLA 4XOIA 4QGFA 2WVAA 4RL6A 2DULA 3NM6B 3R2JA 1J2EA 5EHGA 2ZRDA 4EKIA 1T4CA 1DO2A 3M9LA 2HUPA 3N8GA 1N6OA 1ZI8A 3EXFA 4JXJA 4UVGA 4M53A 1X6VA 4KW7A 2YWXA 4RF3A 2LV8A 3LDGA 4GNKA 1NM5C 2JZNA 1EAYA 4ZT2A 2MSWA 1Y5LA 2WF9A 3KZKA 4D4JA 1G63A 4KAFA 3T1QA 5JMTA 1A8TA 4TWBA 2DBRA 4E6EA 2I91A 3P2OA 1XMSA 6LDHA 4B6QA 4BVLA 1BHSA 4DLSA 4GLOA 3QTTA 4JQSA 1JDSA 1G6Q1 1Z16A 3H83A 3PLNA 4ZOLB 4M89A 2B4AA 2J08A 2JIMA 2OQ2A 5K2MA 1RXYA 2DFLA 2PUWA 2X8AA 1PJCA 1P7YA 1XTRA 2BBSA 2B8NA 2OBFA 3P9KA 2HQSA 4UU1A 5LWQA 3JYOA 4KTTE 5JHHB 2PD3A 2W8BA 4EPTA 5DHAA 2CWWA 3VSAA 3SXPA 5CP8A 2HA2A 2WPDD 1C30A 3RGWS 1K8XB 3WHKA 5BV0A 4FKBA 4L6IA 3ZUPA 2AXQA 3LUGA 5DSZA 2D7CA 4NFYA 4DIMA 1SQSA 1COWA 3FNGA 1K68A 4INPA 1UBSB 5TQ0B 1WV1A 5F51A 3V97A 1H5UA 1P0PA 3W5SA 4RYDA 3R1IA 4N0DA 1X38A 5HWSA 1G4HA 5FTLA 4LGMA 1FUUA 3HPRA 4YK7A 1JG3A 1HT3A 2O1XA 2GZ1A 4FR2A 3D4LA 4F1KA 5JVDF 3PFHA 3OWHA 3GLRA 4EFMA 1XROA 3R8CA 4F92B 2WHPA 1KO1A 3LG2A 1QHEA 1ZC4A 3BE4A 4GPZA 1GP2A 3HXLA 5E6UA 5F5NA 4RTNA 2ICAA 1XLTC 2GRUA 1MB9A 4O02B 2NWQA 2FW8A 5U4XA 3CY6A 3AINA 5EE1A 1DD6A 3PP8A 1FRNA 2PR7A 3IFSA 2REOA 4BNNA 4DRXA 5FKJA 1FFWA 2OHXA 1QHYA 3ZDRA 5FOQA 3HB9A 1HSOA 3SG0A 4LXQA 3AY7A 4FYMA 4QBTA 2RKBA 1Z28A 2H4XA 4LHVA 3EQ8A 4MARA 2H9AA 2UXCB 2WHQA 5ALMA 1UJ2A 2EG9A 2YQ4A 2ZVQX 4G0QA 4I9FA 3PVZA 2VJPA 3W9UA 1EXWA 4IOLA 1KJJA 1M67A 1R74A 2FFQA 3SBLA 4HH3C 3HXMA 4IILA 4JNCA 2A5JA 3R3SA 4D9IA 3TP9A 4U7JA 2GNAA 3L0SA 3T06B 4HDMA 3UT6A 1C5KA 1U99A 2YVLA 4MYHA 2OG1A 3DMRA 3BH7A 1SXJE 2YHAA 1XQYA 3RG2A 4ZVKA 3SJBA 2HF2A 2VPYA 2R97A 2ZYAA 1I7PA 2DWQA 4EG5A 3KBOA 1F6DA 4AWBA 1H8HA 1ZSNA 2P1ZA 1XQWA 3ADPA 4IFTA 1DINA 4WV3A 1T5BA 1KE2A 3V4SA 1YF3A 4OU4A 4BO5A 4KIFA 3DA8A 4KXWA 2O8CA 3FETA 3ZZ0A 4CI0B 4EA7A 5B2FA 5KKCA 4BO0A 1YNSA 1W5FA 3QVGB 4I66A 4XM1A 1XTTA 2PLRA 1L1FA 3UJ3X 2QMQA 3ABQB 3R3YA 5HG0A 3CEAA 3HMKA 4IXTA 1EFCA 2GM9A 2FLVA 3PNMA 3U17A 4JI7B 2Y0BA 1Z9BA 5DASA 1MAAA 1PZNA 3S0ZA 1RWKA 4IO0A 4DKXA 4MQ4A 1JG1A 3UOWA 4S24A 1Y80A 1UBHS 2VC2B 1KC1A 1H1DA 2N46A 4MR9B 2EF1A 1IY2A 1JBEA 2WABA 4GVPA 5F52A 1XFAA 2A1UA 1QWOA 4BMNA 3K09C 3B1VA 1HE2A 1PHPA 3K2IA 1ECLA 4KZPA 1EBBA 4NZYA 3WQRA 1B1AA 5JWRA 4LOAA 4MS4A 4Q1EA 1LB1B 3TEFA 3H99A 5LA6A 2NXNA 3WGHA 3C3KA 3O91A 1DI0A 1IMJA 2JG3A 1F7VA 1AS2A 4KXVA 1CZOA 4YAFA 5BR7A 1NTRA 1T5HX 1B26A 3BICA 3GFTA 3CRW1 1FYVA 4AS2A 4IM7A 3QEAZ 3CWCA 3HBAA 3LRXA 1KYTA 5ALDA 1WABA 4HDNA 1N9ZA 1QV9A 1PT9A 2FSUA 1SKUA 5ALZA 3WLEA 3GEEA 3W78A 4RTOA 3VX3A 5IBCA 4GFDA 2QDSA 1MJFA 4Z4GA 5HJ2A 3RUIA 4IDDA 3LDFA 3SKVA 4GI2A 4H4CA 4P34A 1ZN8A 4ZT3A 2G9NA 3WMGA 4B4UA 1USIA 2X3YA 3FNHA 1R50A 3PJRA 1A27A 2V9ZA 1JEYA 1KDOA 1BJTA 1YAHA 3QLEA 4MV0A 2A7MA 4UREA 3TRJA 5HUHA 3GRKA 3M83A 4UQLA 1CUZA 1UANA 2IOHA 1V3TA 4DZZA 3HVIA 1TT7A 4PG5A 3X30A 1BKYA 3AJAA 3LNCA 3AF6A 4ENRA 5CFZA 3R8FA 1F2TA 2ZYVX 3CCCA 3FPCA 3EPPA 2CN1A 1G64A 2CEAA 1EWRA 1CSEE 4PZ0A 5JXWA 4QPPA 1Y4UA 4C4ZA 2QV0A 2RGGA 4ZICA 3A26A 3WTBA 1ZOOA 4CF3A 3K15A 1JZSA 3IUMA 5FFNA 2P3LA 1QB7A 2ZTMA 4D8WA 3V8NA 1SBZA 4MUNA 3M5WA 2D1QA 3ROEA 2ISQA 3CLHA 4MQ5A 1R4AA 1EX6A 1G19A 1RM3A 1ZI9A 3HB4X 4B6FA 3OKAA 4LYYA 1CHNA 1XI2A 1FDRA 1XCOA 3IPXA 2GZ2A 4R6XA 4CFZA 3D8TA 1AKWA 4RKQA 5E1OA 5LQUA 2HWKA 2PX6A 1CC1S 2ISSD 4I46A 4OQEA 5FWXA 3EVNA 3AJDA 1YE3A 2YCLA 4FP9A 4M6WA 3Q3HA 3CPEA 3C5WP 3OOEA 4X24A 2QTAA 4X1OA 1Z0FA 4X8LA 1OSNA 3QH8A 4EVRA 3UPTA 5AYAA 4JI4B 2AJCA 2CMKA 4NS4A 3WA7A 3L7MA 3LC1O 1UK6A 2Y71A 2W00A 3AM3A 3DBOB 1HEIA 2G9VA 2QTBA 3IT3A 4PTLA 2QSZA 3UB2A 1R37A 3FWNA 2IX9A 1E0AA 1JLMA 5EV8A 1LV8A 2HF8A 3INYA 2HH9A 1JSXA 1PZGA 3FOBA 2WSMA 4IHJB 2CSXA 2FFJA 1FRZA 4GQIA 4U1RA 1SVUA 1TKBA 2QYOA 5ELXA 1OJ7A 2AOVA 2P91A 3AUAA 5JC8A 2FU9A 4CMGA 2CFIA 2WE7A 4G5QA 3LIPA 2WSSA 3MSXA 3OD1A 4EDHA 2BFEA 1NWHA 5KOJB 1ABEA 2FA9A 4URZR 4FFWA 4Z9XA 1JBQA 3U09A 4LX8A 3BGSA 1HETA 1ZFNA 1HNXB 3BCSA 4OO3A 2PZKA 3I9V1 2VQFB 4Q3CA 4CM9D 3JYQA 1FU4A 3P4UA 4R1OA 3LP6A 3LU1A 2GHRA 2I6QA 3FRIA 4IINA 4KYTA 2NPFA 3S1AA 4FJ1A 2FPSA 4Q9JA 3T5BA 2NYVA 2GZRA 3RC9A 2X3FA 2KJQA 2XQIA 2A84A 1C3OB 3O4VA 1CB0A 4OHRA 2EX0A 2Q4TA 2EWVA 1T26A 1AGPA 3G0GA 3KOMA 3AY0A 3PE4A 5BUSA 1OH5A 4PVCA 1W581 4WACA 2PYZA 2LR0A 4PZ9A 1JJAA 2ZXEA 4RWZA 5F78A 2CMFA 1AHIA 4TYNA 3EHEA 1OJLA 1DCTA 4MV3A 1ZQ1A 1RFLA 2IUUA 7ABPA 2I6GA 3CFYA 1AZTA 4F71A 2B2CA 1DOHA 2ZJ1A 2JGNA 3GVIA 3I11A 1UEIA 3E9DA 3QI7A 4FN5A 4ZV9A 4BLSA 5KJEA 4LYGA 4PX3A 4GMFA 4FZ3A 1T8WA 1VJ0A 3EVZA 1HA3A 2R4UA 3F5SA 3NOXA 2E82A 1TYEB 4KN8A 3OTQA 2WM9B 5ESRA 2I9PA 5BORA 1YKGA 4LVNA 1NOKA 5L3QA 1JLSA 1K97A 1YFKA 3H1EA 1XRMA 2CL6X 1KEKA 3AEYA 3F6EX 3MRTA 1P1RA 5D6OA 3ZCSA 4E2FA 2H7XA 3IOCA 4ALLA 3FYUB 2P9GA 1KP2A 2VA9A 4R3NA 2JGDB 2R79A 4F4HA 2F64A 1L5RA 1ZIOA 4QNMA 3QG5A 5KSWB 3CONA 3AIMA 2N42A 3C15C 1NW8A 2NU6A 4GI7A 4FK8A 4QSHA 2F1KA 3GLGB 3NM5A 3Q5EA 1ZH4A 2VDUE 3NETA 4QUDA 3MPOA 3GYBA 4CKYA 1GDDA 1RIIA 3DM5A 2O1SA 3EH2A 5CX1B 4AQYB 3KE8A 3MJVA 2BM9A 2DM6A 5K4AA 5KU7A 1KEWA 2OCYC 3O8QA 2YINC 3WS7A 4CLRB 4HYYA 1J0BA 4D4IA 1MEJA 2CBZA 2JAOA 1JHVA 1MZPA 4MDYA 1WD5A 2FZVA 3PQ3A 4P84A 4QOJA 4YRCA 2VCEA 3HCEA 1ND6A 3IHLA 3NWOA 4TRMA 2YNWA 1TEXA 1ZK3A 3BDIA 1F51E 2X8JB 4D8VA 2GILA 4WEQA 1JR3A 2EU8A 4TS1A 4U4AA 3BMCA 3DB1A 1NUPA 3M6LA 5TEWA 4CM1A 1B3BA 1NNLA 2A6PA 1YZVA 4IJ6A 3ZE2B 2AZDA 4JEMA 1XNHA 4L15A 3V7FA 1Z2DA 1EDBA 1OXUA 3EDMA 3A11A 3H2YA 3S2FA 2NZ8A 2CW5A 4M0PA 1G20B 5KSOA 1Y1KE 2EERA 4KQGA 3PFGA 3T6KA 2C0PA 1I6KA 3IKJA 1G3UA 3H2HA 3P9RA 1Q1ZA 4M1ZA 1BMDA 1CIVA 1OILA 2ZTVA 1KH3A 1RXCA 5JDIA 5DIZA 4J7UA 3EA5A 3LHKA 4M37A 2BG7A 1N2ZA 3VSBA 1D5WA 1GZSA 3C5VA 4PPNA 1PJAA 3QUSA 3O2NA 3JQ8A 1PFQA 3KKEA 3SHVA 3DTVB 3HABA 3RHTA 4AO7A 1H9CA 2XZTA 5JS7A 1VMDA 1NVUQ 3QJGA 4C2AA 1JKJB 3H3JA 1X7XA 2SHKA 1ZH2A 3VZDA 2P3SA 4DG5A 4Z4HA 3BCUA 2VW8A 5HM6A 2F55A 3V00A 1AQIA 2B1QA 4TV8F 3RVPA 1H9BA 4HB4A 1I94B 3PIIA 3G89A 2JD2A 2Z5FA 4NYIQ 1GPLA 4FB4A 3N2LA 3V4FA 4PZCA 2X7JA 4PPFA 2JJQA 4CIAA 3B2QA 2HHCA 1FXWF 1UMBB 2ZR7A 3FHTA 1VL5A 2GCPA 1XAHA 4LQLA 4MICA 1SXGA 4BNHA 4NU5A 4XGQA 4AP9A 3IDQA 1AZSC 2XUGA 3PE3A 4QYMA 1A4UA 1JDPA 1Z0IA 2WBLC 3HKBA 5IMSA 4LSGA 2IKSA 4D25A 1EFRD 5GGXA 4YRNA 1ORIA 2I4RA 4LECA 3RSQA 2CBNA 3S7ZA 2RHGB 4MVYA 1VFNA 2VNKA 4OFWA 4BE7B 1TJYA 2MU1A 1V4VA 4ZREA 1O4VA 1VI2A 2GAOA 2JFWA 4MWZA 2P9ZA 4OJQA 1X70A 3J7TA 1WMFA 3D3KA 2OHFA 3O2QB 1MJGA 1P0FA 4OBEA 4WNAA 5IT0A 1QP7A 4TZEA 4K5QA 4MUJA 1WQ1R 1DJPA 1RMQA 1K89A 2VKTA 4PQRA 5ALUA 3UATA 2LDXA 4UUPA 1T1SA 4F1JA 5LQNA 1RPZA 4Q9HA 5TQ2B 3EQ6A 4CR8A 2I9KA 4Q4CA 1RM4A 4ND5A 3KUCA 3ASUA 3UMSA 3E1GA 1LDEA 5HFAA 5JARA 3ZGYA 1I1NA 3K2EA 2G4VA 4FYYA 1Z8HA 4QT0A 1K6IA 3FOAA 2CHGA 4R7ZA 1Q11A 5DHPA 5HF5A 5AHRA 4BYGA 4NU6A 4MUXA 2D7DA 1X2EA 5C1BA 2H29A 2IDKA 2IY9A 3WYDA 4WOPA 1UDCA 1EJ2A 3DE6X 1KQFA 3B48A 3GBPA 2Z4TA 2DCMA 4EF5A 1YXMA 1RI3A 1VSQA 4BRSA 2OAQ1 3OA2A 3EGDB 2M6RA 4Z1OA 3I5XA 2EDAA 1M54A 1NW6A 2GMNA 3GHHA 1WDMA 5HCIA 4FEKA 3WV5A 3BPSA 4EX6A 1U5AA 5JANA 2POQX 4J94A 1IJBA 1KK1A 4EUNA 3T5CA 4OMCA 3LQFA 3N2KB 4GUDA 2Y77A 3L9XA 1K7SN 1KMCA 2Q3CA 2JI4A 4IUBS 4BNLA 2C59A 4BP1A 2X4GA 3NQ41 4RGVA 4PLVA 3WK7A 4E09A 1W1UA 3QHPA 5E3IA 4EQ6A 2QD4A 4E5NA 4J1TC 3U7JA 1KJ9A 4AJEA 1X1BA 2ZJYA 4P7BA 2WYIA 4MCAA 4GSKA 2PLNA 3AZPA 2EBFX 3BXHA 1FX0B 1Y1QA 2NO6A 3FPJA 3K9BA 3OAAD 4ND4A 5KTSA 1PX0A 1Y7PA 4L9WA 1S9DA 1JAZA 3KVVA 4LY6A 1E4EB 4NCHA 3PUYA 3PGJA 4RNCA 1ODIA 3EJ6A 1G9SA 4DSZA 3W3AD 4YP5A 3THRA 3Q72A 1E9CA 1SVKA 3BZBA 4KAXA 3SBEA 1UR5A 5A2QA 4D0SA 5BYJA 5EE0A 4L9RA 1QTQA 3V4VB 2Q3FA 3EUFA 2E3JA 4MVJF 1X8GA 2DB3A 1E77A 1HORA 1PW7A 2AXNA 2JIQA 3W5JA 4BLWA 1U1FA 4PGHA 4RY9A 3IQEA 4CIBA 1NNUA 3A4IA 3TW8B 4Z9BA 3IYLW 5KYXB 2I03A 3ADCA 2OOKA 3B1YA 1RLUA 5CT4A 3EMDA 1N9GA 3LT1A 1XK7A 2Q1WA 2QDTA 3CWQA 2BGNA 1IOWA 4ANFA 3M89A 2GDJA 5LP6C 3Q2IA 2P6NA 2XD9A 1BU5A 4EVQA 4FYWA 3C41J 5F73A 3BTSA 1VPDA 3QIAA 4O2AA 4QA9A 4QXRA 1BRMA 1L0BA 1NYLA 2Q2WA 1OWPA 5EEHA 3GJ3A 1KP3A 2RHMA 4HDRB 3KELA 2JH3A 2VDRB 1MXHA 4XD7A 2COKA 4HYQA 4O29A 4EP1A 5TQJA 3O3OB 2GASA 1EVLA 3H6HA 2LBPA 4PZEA 2Q5QA 2GCUA 2BKVA 3WBFA 4B6RA 1J8YF 1T9KA 2P9BA 4MWCA 3VU0A 1X94A 4TTQA 5LZ8A 3L8CA 1SGWA 5AI9A 1E2LA 4E08A 1Z83A 3HB1A 3KFLA 1SBNE 2J59A 1MG0A 1QGAA 5CNKA 1CW2B 1P9LA 1A9TA 2IDJA 3H3EA 5KJ6A 2DBYA 3Q5DA 5JJIA 1BC2A 3OKPA 5CG2A 4F5YA 4PVOA 5H68A 5GIPE 3KWJA 1RBQA 5LYJA 4ML3A 1IONA 5FUXA 2ZDGA 2EKDA 2M6LA 1Z56C 4MJLA 1EG7A 3K7EA 3EFEA 2J8ZA 2WB2A 1GZ4A 2REQB 3OX3A 2NVWA 1OFIA 2IE8A 3MJRA 1R88A 3MN1A 4MS1B 2YZ7A 2Q3MA 4H1HA 1ML3A 4QTXA 2C98A 3QKUA 4LJ6A 4B47A 3RSFA 4J7CA 2NX2A 3BWXA 1WXDA 1ZIDA 1P4JA 2P78A 5HPYB 4JB2A 1HDIA 1Z2NX 3MAGA 3PB3A 5F2NA 4RTSA 1RHKA 3PBKA 4IVNA 3GWZA 2PY6A 5HILA 3N2EA 4C14A 1J2TA 2G9RA 2OORC 2ETXA 2YOHA 1WW2A 5A0FA 3WJ1A 4A0QA 1DFGA 1LBQA 2AMJA 2AW5A