5A0VA

Catalysis and 5' end sensing by ribonuclease rnase j of the metallo- beta-lactamase family
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
454
structure length
454
Chain Sequence
SHPHPELGRPPALPKGGLRVTPLGGLGEIGRNMTVFEYGGRLLIVDCGVLFPEEEQPGIDLILPDFTSIRDRLDDIEGIVLTHGHEDHIGGVPFLLREKPDIPLIGSKLTLALIEAKLQEHRIRPYTLEVAEGHRERVGPFDCEFVAVNHSIPDALAVAIRTPAGMVVHTGDFKMDQLPLDGRLTDLHAFARLSEEGIDLLLADSTNAEVPGFVPPERDISNVLRQVFANARKRIIVASFASHVHRIQQILDAAHEYGRRVAFVGRSMVRNMGIARDLGYLKVPPGLVVDVKTLDDLPDSEVVLVCTGSQGEPMAALSRMANRDHQIRIVNGDTVILASSLIPGNENAVYRVINGLTRWGANVVHKGNAKVHVSGHASAGELLYFYNICRPKNLMPVHGEWRHLRANAELGALTGVPHDRIVIAEDGVVVDLVEGKAKITGKVQAGYVYVDGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Linkage of Catalysis and 5' End Recognition in Ribonuclease Rnase J
pubmed doi rcsb
source organism Streptomyces coelicolor a3(2)
molecule tags Hydrolase/rna
molecule keywords RIBONUCLEASE J
total genus 149
structure length 454
sequence length 454
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 5a0vA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5a0vA01
4TYTA 5K4KA 3SW3A 1YCHA 4FSBA 4EFZA 3I0VA 2YNVB 4RM5A 2P18A 2BFLA 3FCZA 4C1FA 3I15A 2YZ3A 4FEKA 5LMCA 3ADRA 4EYFA 2Y87A 4XUKA 2VW8A 3AF5A 3JXPA 4NQ2A 3IOGA 3RPCA 5FQCA 4RAWA 5ACRA 4PVOA 2DKFA 5AHRA 2WRSA 3AJ3A 1ZTCA 4UWSB 4UWRB 4YSKA 2DOOA 4UWOB 3X2XA 2OHIA 2BG7A 2XF4A 5K0WA 5IQKA 3IEMA 3PG4A 5EH9A 5A5ZA 2ZZIA 2CBNA 3DH8A 5ACTA 2GKLA 4Z5ZA 1BC2A 1K07A 1WRAA 2BR6A 1MQOA 4RL2A 3KNSA 5LE1A 4PVTA 4Z7RA 5A87A 3IDZA 4Z5YA 1KR3A 1A7TA 2BGAA 3QH8A 3T9MA 1JT1A 4C1CA 2BFKA 2NZFA 2GCUA 4TZ9A 2QEDA 4ZEJA 2FU8A 3RKKA 2BFZB 4RBSA 1P9EA 5HH5A 5LLDA 4HKYA 4O98A 5EVDA 2FU7A 3BK2A 5HISA 4P62A 3WXCA 3R2UA 1KO3A 3L6NA 3TP9A 5EVBA 5B15A 5ACUA 2UYXA 1X8HA 2FHXA 1DDKA 5K4NA 4GCWA 3H3EA 4U4LA 5EV6A 3MD7A 3SFPA 5AHOA 5AEBA 2YNTB 1E5DA 2YNUA 5EV8A 3SPUA 4NQ6A 5HH6A 2Q9UA 2QJSA 2BIBA 2P1EA 5AXOA 2ZWRA 3Q6VA 3A4YA 2FK6A 5B3RA 2QINA 2YNTA 4KEPA 4UA4A 5LCFA 4BZ3A 5LM6A 5EHTA 2Q42A 3ESHA 1DXKA 2GFJA 1VJNA 3X30A 1L9YA 4V0HA 3IE2A 1HLKA 1KO2A 1XTOA 1WUPA 2P4ZA 2R2DA 2YNVA 1A8TA 1ZNBA 1JJTA 2FU9A 4BP0A 3IOFA 2Q0JA 3SD9A 3IE0A 4C1EA 4GYUA 2BFZA 1XM8A 1YCFA 3I13A 4AWZA 5KILA 1Y44A 2FU6A 4TZBA 5EVKA 4WD6A 3DHCA 4Z67A 2WYMA 3PY6A 3RKJA 5ACVA 4AX1B 4XWTA 2YNWA 1QH5A 3DHAA 4HL1A 4EYBA 2QDTA 2WHGA 4EXSA 5ACQA 2FHXB 4JO0A 4EYLA 5ACWA 3I14A 3PY5A 4RAMA 4TZEA 2E7YA 3IE1A 3SRXA 3F9OA 5K4MA 1BMCA 1ZKPA 4Z6XA 2OHHA 2NXAA 4NQ5A 5A0TA 1YCGA 3KL7A 4XWWA 4D1UA 2H6AA 2M5CA 3X2YA 4EY2A 4EXYA 3IELA 2Y8AA 3SBLA 3IEKA 5ACXA 3VPEA 4UBQA 4TZFA 4FR7A 5EWAA 4C1DA 3T3NA 5LSCA 4D02A 1VGNA 2I7TA 3G1PA 1X8IA 2WYMC 5HIQA 2BC2A 5LCAA 3BV6A 4GYQA 2BG6A 2BTNA 4UWPB 4J5HA 4C09A 2GFKA 5LS3A 2ZO4A 5DPXA 5HIOA 4YSBA 3LVZA 5AYAA 3X2ZA 1WW1A 4DIKA 4HL2A 2BMIA 4D1TA 3VQZA 1DD6A 4Z60A 2AIOA 5ACSA 3P2UA 4D1WA 1BVTA 5HIPA 3FAIA 4YSLA 4RL0A 4ZO2A 5LCHA 2WYLA 5FQBA 2QDSA 2M5DA 4LE6A 2NYPA 4F6ZA 4UAMA 4C1GA 2BG8A 4CHLA 5A0VA 3ZQ4A 1QH3A 1SMLA 3BC2A 3T3OA 3I11A 4J5FA 5KIKA 2Y8BA 2P97A 1JJEA 4D1VA 2A7MA 3ZR9A 3S0ZA 3KNRA 2GMNA 4B87A 4KEQA 2BG8B 3ZWFA 3AF6A 5FQAA 4F6HA 2HB9A 4AX0B 4H0DA 4NQ4A 2OHJA 2I7VA 4AWYB 5ACPA 1X8GA 4DILA 2ZNBA 2NZEA 1VMEA 4AD9A 2XR1A 1WUOA 2Q0IA 4ZNBA 5EW0A 5AXRA 3BK1A 2BG2A 2AZ4A 5B1UA 2FM6A 5HH4A 3DHBA 4C1HA 2I7XA 4TYFA 4ZO3A 1M2XA 3ZNBA 2YCBA
chains in the Genus database with same CATH superfamily
1FMJA 1RAHA 4JQCA 1EM8B 1JUDA 1TZ2A 3C4QA 3O75A 4MP8A 4NJMA 5JQGF 3EIXA 1O94D 3P71T 5SICE 4BC1A 4IDFA 2FVXA 1ULHA 2HJWA 1DZ3A 1YB4A 2CJWA 4EZEA 2CFRA 2ZIVB 3N8NA 1Z63A 4K2HA 3E6AA 3IXMA 4TTRA 1E0DA 4WZAA 5FWXB 3GPBA 2CNKA 1COWA 3JQEA 3KQKA 1TT5B 4UHEA 5FR1A 3JPWA 1W19A 5F1KA 5SY4A 1UBGA 1CNFA 2J32A 1T6YA 3LD9A 4NK5A 4YMWA 3WRVA 4D56A 1GSIA 3AOGA 5JQWA 4IIDA 5ALQA 3WLFA 1ZNZA 3CBGA 1GDDA 2G5PA 2P18A 3EIEA 4W5JA 5CJ2A 4JQOA 1KAEA 2CMHA 1JHZA 1N9GA 3SM3A 1SQGA 2JHFA 4ZIRB 3TLCA 4FFRA 2JHCA 3BMCB 1XVVA 4TVOA 1L3IA 3R8XA 1XTSA 3ZHYA 4PRZA 1KR2A 2XE6A 3HR4A 4C78A 4FMBB 4PNHA 1L1RA 1E1LA 4LFBB 1IB6A 3N2KB 3O91A 1KYTA 4LWPA 2GN6A 5CEFA 5JMTA 1OKKD 4GMGA 4EJSC 1PR9A 3LH5A 1WSWA 4L50A 3V34A 3GLIA 3V80A 4DDVA 4PO1A 1UC5B 1Z5VA 1LSUA 1RACA 2G77B 1EQ2A 2O7NA 3FMOB 3JATA 4PZ0A 5AI8A 2ZWIA 1J22A 3N8DA 1BCSB 4R83A 1MO3A 2DWCA 2YZ7A 3KXDA 2FMHA 2QRJA 2Z3ZA 2QUHA 5E4JA 3CGGA 4MVJI 3DZGA 3D3QA 1M6VA 4JI6B 1CUEA 1NQUA 5CVEA 2PWYA 1FZQA 1AHNA 3GZTB 3UOWA 1WKCA 4R41A 3VDNB 3WB9A 5A6VA 4IDGA 1XZEA 4E5YA 1H2FA 4DR1B 1UODA 3LOPA 4PX5A 2OQVA 2QX9A 2Y1DA 4MKFA 5CJPA 3M5PA 4JEMA 1B8NA 4D0GA 1UKCA 5BQXA 3P2KA 4EG7A 2C9DA 4AKGA 5GONF 1OXTA 3C6XA 5T3UA 2Y1WA 5KYKA 4XVRA 5C7OO 3OIWA 5ADVA 1SRRA 3TXYA 4KQ6A 3X0DA 1JTVA 4KQMA 1GQQA 4KRXA 4N7JA 2GM4A 1JBEA 2ZJ5A 4FDUA 1DS6A 2EFEB 5EIHA 4EJMA 1OFGA 1VRCA 4A1FA 1OLUA 4TYQA 4R69A 2NVWA 2PE5A 4Q1BA 5KREA 1FPMA 2IOFK 3ED1A 4N40A 3G2QA 2BEVB 3O4GA 4Q37A 3OTQA 1IB0A 1IHXA 2CNLA 1SEPA 4DNOA 5K5EA 4DG9A 5JO9A 3DLIA 1F0NA 5IG2A 4UU7A 3FGPA 3ZWWA 3OZFA 2V8OA 3DTNA 1EWYA 4HS4A 1ODSA 2OCXA 3RRMA 1P6QA 3VR5D 5A0FA 4F1JA 2PS0A 3LT0A 1LWOA 3WIDA 2DLNA 1C7IA 3AF1A 3ZDFA 3FSGD 3ZX5A 4NCAA 2XMPA 2Q1WA 3CTPA 1YOVB 5H3CA 3ER9A 1YONA 2G3YA 4RS3A 1ZD2P 3I73A 4L85A 4Q24A 4L07A 3DFKA 2BFFA 3NM6B 3K15A 4U9IS 7ADHA 1TT7A 1QCDA 3IDZA 3RF7A 3AI2A 1ZM3A 3LBAA 2HEGA 4XI9A 4ACBA 3A14A 1R16A 2VH2A 4H18A 3BXFA 3QH8A 2DLCX 2GEFA 1VKJA 4Y2JA 3OPVA 3S7TA 3WBKA 2EL9A 5FOSA 1C3OA 5E6UA 5IJ0A 5HOEA 4XM1A 4MWEA 4PSAA 3WZMA 2ZIXB 5HYVA 3N1UA 4RQAA 1QIHA 1Z2NX 3SEZA 1VCHA 2QZZA 4PG6A 3G7SA 3OA2A 3RLFA 1ZGZA 3CEMA 4BNIA 4WTOA 4Z0HO 5HIAA 5D84A 1KVUA 1FP4A 2VL7A 1VKNA 1WCWA 3FUVA 4WX2B 1S7CA 3K0AA 1EDEA 4O4IA 1RWWA 1LDEA 1LUAA 3K16A 5BQ5A 3VZRA 2C0PA 3S27A 2VAVA 5KTPA 1YBMA 4LW8A 5EXSA 3TEJA 4FVTA 4JKIA 4BFWA 1K5PA 4ZI5A 3U48A 1WZ2A 1JKMA 2VPXA 5HISA 4B9AA 1IIBA 4HF7A 2VUHB 1E79D 2D7DA 1BU5A 1QZXA 2N75A 2QLNA 2B4AA 1OX6A 2DR0A 3REOA 3BERA 3OHPA 4ZMBA 5LYJA 4UUNA 3MHTA 1AGXA 3OOWA 4R1TA 4KAAA 4AJOA 1OILA 1WOYA 3BFPA 5EVBA 2GVNA 1X19A 4ZYYA 5A4IS 1QWSA 1ESEA 3RO7A 2FW9A 3C3WA 3B6MA 3HN2A 4G1UC 1W30A 2C2ZA 4X61A 4YRPA 1JHXA 1MJFA 3GL9A 3GLQA 3ORRA 1SELA 4IJ5A 3VSEA 4B4UA 3L8DA 4ZOCA 1XVTA 4YRKA 4ZZ1A 3MFQA 4MW7A 2J85A 1A9OA 2VDOB 3GX1A 3ICVA 3F7MA 4INAA 3GFOA 4M9ZA 4OHKA 4UTPA 4HB3A 3BYZA 1BGWA 4OGLA 4W9NA 4CQMA 2VHTA 2NUBA 3H2KA 4AY2A 3P97A 2E21A 2M6LA 2OG1A 3UMYA 3IDAA 3GN1A 2ODQA 4PGAA 5FFNA 1XRSB 4EQ6B 3KZCA 3KZXA 5B53A 2P91A 3WRXC 1A69A 1KU6A 3C70A 2VSFA 1TE2A 1N5KA 2YN0A 3JYNA 2FUKA 3C6KA 3TQHA 4LDPA 3EQ6A 1A96A 1QKIA 3U37A 2CF6A 2DUMA 2GHIA 2GPNA 3CH7A 1TM2A 4AJKA 2J4DA 1W96A 3GFVA 3JVIA 4YP7A 4FB5A 1NVFA 1EFKA 2OV6A 3VKVA 4Q9HA 2QJSA 4Y0AA 5GP1A 2RHRA 1V5FA 3EUEA 4YRTA 3JX9A 1YRQA 3CCBA 5L3QB 4RJ2A 1F14A 5GONB 3L7KA 4FGSA 2I8AA 4RK7A 3R3VA 2HC9A 3R7NA 3CZ5A 4BWGA 1ZIPA 1WUYA 2JLBA 3ZD9A 3U3KA 4FE3A 3PXCX 3FLAA 4PG5A 4JUIA 4NR0A 4Q1CA 3ZXSA 1F4LA 1Q74A 4HWKA 3RHSA 2BFWA 4LXTA 1V9LA 3MGGA 1EP9A 2ID7A 4BRWA 4RKEA 2DHQA 3TH5A 2H1RA 4K03A 5EKUA 3ZIAA 2EATA 3GT3A 1WQ1R 3EF0A 4UFNA 1C4XA 3IV7A 1KFBB 4X1YB 4B9EA 1NVBA 3CR8A 4D99A 3DJYA 5KWEA 2XH8A 3PHBE 3DL0A 5EZYA 1PSDA 1OKKA 1AUPA 4K9LA 4WBNA 5TMDA 3C39A 4YBZA 4BP9A 5FH9A 2P2LA 3KQNA 3GLHB 4V0HA 1S4MA 3GLRA 4ZU1X 3JARB 2ISCA 3MTAA 4NSNA 4JZYA 2YWJA 3P4XA 4CHTA 2CFCA 4GX2A 4XJVA 8ADHA 4KJZA 3R5TA 3QYAA 2X1LA 2Z1MA 4HYYA 1WA5A 3W8EA 3BZWA 3RHTA 3WQSB 5K8UA 2ZB2A 1L4BA 1QVZA 1JR6A 2WSBA 5T8KC 3NIBA 2WZBA 5DBOA 4MUJA 2C3MA 2G07A 1FYWA 4EBBA 3BD9A 2VQEB 2AC7A 3IOFA 2AS0A 1WD7A 4MP3A 1MC5A 1CQJA 2DFTA 4WK6A 3UJNA 2VZ0A 3RNOA 2HPZA 3ANLA 3FMIA 2QDKA 1LBEA 3G89A 4WXHA 5D7NA 3RG2A 3TMKA 4AN0A 3WMGA 4ETIA 1E9DA 4P6VF 3DTTA 1Z2CA 4TKUA 4MW9A 4UHHA 3CNOA 1F8YA 4WDQA 1GPUA 1KI7A 2AD5A 1LD3A 2N42A 4GRDA 3EFHA 4QNMA 1MAVA 3O38A 1G6HA 1RZ3A 3IUQA 4DC0A 3LYAA 3I42A 2FPRA 2VDQB 1VRVA 2ZE5A 2G40A 2BGLA 3WLKX 2HWWA 4G4IA 4Q7JB 2YQZA 2FUNB 1U3DA 3I45A 5LMZA 5LKRA 1RXYA 2X0NA 3LC2O 4K9PA 3HHPA 4AP6A 4MV5A 1NOKA 3WXMA 2FH5B 3TLYA 1T8WA 3CW2A 2C2HA 2D5AA 2WF9A 3M9XA 4AUKA 2HRQA 2NU9B 1VLZA 1HGXA 1UT5A 1W4BA 2FPMA 2TRSB 3HY4A 4G4SP 1WM1A 3M6LA 1L4EA 4OUDB 5FUQA 2XQFA 1P4AA 3AV0B 4ZI3A 4DJEC 1BAPA 1DXOA 1Q91A 3I8OA 4RS4A 3LZCA 3MWLA 3L0BA 3TOXA 4HK4A 3IPCA 2POQX 4X7RA 3DEYX 4I8XA 3FDZB 4WLEA 1EE9A 4EA6A 4B3HA 1ML3A 4IGEA 4CL2A 4MV7A 1VP3A 3V1MA 3L04A 5E4TA 5K3BA 1OPXA 4L8LA 3SRXA 3KE8A 3QY9A 3N6XA 1Z4NA 4MEBA 4YRSA 1G41A 1HNWB 3RC3A 2VF8A 2CXUA 3ANNA 2XKKA 3REGA 2OHHA 3ZHOA 2ZTHA 5JNUA 2YY6A 6NULA 1I7QB 4U1RA 3F8WA 3ZHQA 1U5BA 4QXOA 3UMFA 2H2IA 2YY5A 1J25A 1WMFA 1G8YA 2D2VA 2XMRA 3L40A 3L4SO 3C74A 3FYCA 4F4DA 5B30A 3EPKA 2VRCA 1F51E 1QHIA 2Y1EA 3UQZA 3LLSA 4II2A 3QEOA 1C4KA 2X6TA 1OJLA 2XQGA 5TJ9A 1TAHA 2AFRA 4UXIA 3W6PA 5AVUA 3I6IA 4NFYA 1G9TA 3IAS6 3PFNA 4MWCA 4IXMA 3SFVA 3W0LB 4IX9A 1UL1X 1USVA 4S1PA 5D5HA 4US0R 3WADA 1ZY2A 3OF5A 5J4KA 1I0LA 3TLKA 3OEHA 2F1IA 4QM7A 2B4TO 4CV0A 5CTAA 1HT3A 4FD3A 1FU7A 1O0SA 4ZREA 5I3CA 4NARA 4B6EA 3WK8A 1KDYA 2C2KA 3ZI4A 3DD5A 1Z2OX 4I7EA 3DWIA 4JL6A 4DIDA 1V3QE 5J43A 4DB4A 1XK7A 4TGLA 2CZQA 3PUIA 2JEZA 2FX2A 1V43A 1U28A 4HXYA 3OIGA 1ZUD1 5FUBA 3R9WA 3SYLA 3K72B 1MP0A 1YC2A 1S1MA 1BXGB 4IVRA 4B6GA 2H7YA 3PHLA 4K6HA 3IX7A 3DVQX 3QG1A 4R7TA 1N2JA 2QJTA 1DO2A 1S01A 3A1VA 1VSVA 3Q8WA 2VJNA 2P3LA 3HO8A 1LZKA 1XWWA 2Y1LA 2BELA 4P0QB 2EVWX 3Q7RA 1KARA 1FQOA 5CDTA 4M22A 1NW7A 1I32A 2QUKA 3OD5A 5K20A 4FN4A 4IIFA 2ZTUA 4C09A 4Q9LA 1ORHA 2HU2A 4U6QA 5F2NA 3AWIA 3W5UA 1Z4OA 1JR3A 3LY7A 5A4FS 4EYQA 5GGYA 3ZCQA 2ISSD 5EXXA 4B7AA 3A2MA 4EFKA 3B52X 2I1LA 3KQOA 2VP5A 4QFBA 2BMIA 2CLKB 1FSSA 3WLQA 4WCVA 3DQZA 4ZOLA 1N1DA 2MU1A 5GV7A 1Y33E 2IKQA 2B7BA 2OVBA 2ZB4A 1V7CA 1RRMA 1VFNA 2YXLA 1ZJ4A 3DOUA 3WL3A 3ZS8A 1H2HA 3JR7A 2HX1A 4PHTA 3VSAA 3WLPA 3IT2A 1TVKA 3RK4A 4AMBA 4COOA 3F7NA 3EZ2A 2SNIE 4XARA 4YP5A 5SYNA 1V6SA 3HUEA 2OBMA 1DQPA 2M32A 3OJ0A 4XPIA 2D2EA 1GQ2A 4HB2A 1KI8A 2HLNA 4P5PA 5E95A 4ZTBA 4KQEA 5C4IA 2XXAA 4RL0A 1I1HA 1T6ZA 2NACA 4Y6GB 1QCZA 1UWLA 2ODWA 3DLTA 4UMFA 4A3SA 1I6KA 1OUMA 4LKRA 3VPBA 4M76B 3VTAA 2V8BA 2VJLA 1LDMA 3EGDA 3JQFA 3SQMA 3SY8A 3KEGA 4XYLA 4ZMSA 4ZQEA 1Z36A 2RFLA 3MGBA 1Z47A 1RLMA 3A9VA 3P27A 4L74A 5FTNA 3THXB 3C7AA 5LLSA 2Q9BA 3MMSA 1CUFA 4K7JA 5F52A 3HCOA 3FYHA 3FAKA 5D3MB 2V7QD 5F3RA 4DNPA 3ZOZA 1IVSA 3AHGA 1T2EA 5MDHA 5KIKA 4DM7A 3QENA 3HWX1 3KLPX 2Z2JA 2NZJA 1WY5A 5L4SA 3E22A 3UHJA 3PC8C 4IFTA 4EI8A 3EXG2 2F8TA 4O1IA 1NNSA 3SYTA 1RJEA 5FHRA 3FFTA 4M9SA 4EG6A 3AFNA 2HXSA 4M38A 1I4EB 1MCZA 2GZAA 3AP3A 5E8RA 2NX2A 1OAOC 4QPJC 5IULC 2P6UA 2YHIA 1KO5A 4BLOA 1FP7A 1QG0A 3BWMA 3DVLA 4M83A 1KDVA 3ABSB 2C0CA 3IAXA 1P7WA 4F04A 3T7CA 2JAOA 2H5IA 5B3AA 4P3OA 3S8YA 3ZWFA 2W37A 4L02A 4D9CA 3QEMB 4RVOA 4M1EA 5F2OA 3GMDA 3WAJA 3D6JA 2V0NA 4TMZA 4BNZA 1KK3A 2V4ZA 2WINI 3JWEA 3T9CA 3KHUA 1EZ4A 2GRAA 1X2EA 1JT9A 2WTAA 3HKDA 4QSMA 2GZMA 5EOVA 5K6AA 2OCKA 2JKYA 4DLXA 1MKYA 1YIAA 3DBLB 1LW7A 3B9PA 2XQJA 3AFMA 1Z34A 1Z39A 3ZQUA 2WJHA 5JC8A 2XYHA 5JFOA 3LAWA 4FFVA 1KNQA 3ILSA 4XFKA 4NLLA 5K0ZA 1YBAA 3RARA 3C6YA 5DB4A 1HNZB 5AVTA 5KO2A 4XASA 4XXHA 2RGEA 5BW4A 4YUAA 3G1UA 1JL3A 4MCHA 5AO9A 4IHKA 4U7DA 1ZR4A 1MABB 3UVEA 3KQYA 3HVIA 1M6NA 1D9XA 4O2LA 4MV8A 4I08A 4PZUA 2BG2A 2FCRA 3WYBA 2OD7A 3ABZA 1QIIA 3PFIA 4J0IA 3FPFA 1OU4A 4O02B 4PIVA 4IX1A 1FK8A 1XMSA 4AKHA 3RFVA 4DBZA 4XWAA 4ZAZA 1EB8A 1O9BA 1D2RA 2R3SA 3GBVA 5F4ZA 2O6LA 4ITUA 2QJOA 2VDNB 1NBWB 1L5GB 1YB2A 2KWIA 4Z49A 4RULA 1F2UA 2QN3A 4NMLA 4Q34A 4TYFA 1A4XA 4AZWA 2FUEA 3L9XA 5BWCA 3IIJA 1UEIA 3MTEA 1KU0A 1SUAA 2DE0X 4ZAYA 4CIVA 1PZFA 1LVGA 2LXNA 2BSXA 3WIEA 5C4MA 4DTCA 2B0CA 1ABBA 4ZEOA 5CFLA 5J5AA 2Y9MB 3OTIA 1D07A 1I3NA 4BFCA 4ND5A 5IU6A 1EK0A 4Q3LA 5LA6F 1T4MA 2V7BA 2YTZA 4ZAXA 4JOQA 4LXYA 5I6DA 2H1OA 5EW0A 2NTVA 3HDVA 3Q3IA 3WAGA 3A37A 2P2NA 2YOGA 5ERGB 3ZHSA 4KE8A 2NYUA 1JBQA 2O0LA 3KJIA 3L4KA 2V74B 4C7VA 4EJ0A 1I2ZA 1EGVB 1GQSA 1S2GA 1T2DA 3D2LA 5T5QA 4XWYA 1JHQA 1VOTA 4ZQGA 3O1IC 3JQGB 3RTGA 4FDAA 1P18A 3EWAA 1M8GA 1W5FA 3FDFA 4QUIA 4IGAA 2C95A 3CB2A 4X97A 4YAJA 1XQVA 5JMPA 4FC6A 1A9RA 3OPYB 1QM5A 2QQ5A 4M55A 3CUTA 2ILVA 4YRJA 4LZJA 1ZKMA 1MX3A 1PE0A 3GQVA 2W2KB 4HSEA 3WYDA 5A5DA 2C3OA 3ILVA 1ZISA 4D6YA 4AZVA 2EG9A 2EIHA 4ZCIA 1GNPA 2OCAA 3K8ZA 2HHJA 5AHRA 1QCCA 5B6PA 1PFWA 1GZ7A 1HETA 4JP1A 1QU2A 4HUJA 1HY3A 5LJLA 3RVQA 1QPZA 2UVDA 2CVHA 1IEVA 2ZYVX 1G63A 4A10A 4IH1A 4UNPA 3LWNA 3UKOA 4PNPA 2VAMA 2XZPA 3W8FA 4UWRB 4BOYA 2BHSA 4NHOA 5B4TA 4QARA 5CMLA 1SG0A 2W6PA 4JT4A 1RMTA 3MD0A 3LZDA 4CJXA 2WQ6A 2BHLA 4N76A 3L6RA 3GIDA 1LLQA 5AXBA 5EHIA 3I1IA 5IF3A 1QNLA 4DMFA 2ARKA 2I6TA 4I36A 3OIYA 2ONYA 1DJPA 2EV9A 3RUIA 3N0TA 1V25A 1BW9A 4NE9A 3IMCA 3HL4A 4DLTA 3HKCA 2OD2A 3EZ7A 3L7BA 3ZVLA 2V6GA 4D9IA 2AK3A 4PCAA 4WKPA 4E4YA 4CCAA 3CNBA 1SC6A 2ZI4A 3IBCA 3NVKI 3Q2OA 4OQXA 4P4GA 3K9BA 1CT9A 2VDJA 2YMLA 2YW2A 1GDHA 3FVVA 2F00A 1DJQA 1U9JA 2VK1A 1Z2DA 3B3JA 5AKXA 4Q4AB 4UFOA 3GCXA 3T52A 2WSMA 2WMNB 1G8AA 3NZEA 2H4HA 2EQAA 2C1EA 3GRPA 3OQPA 4PVTA 1XFDA 3TFQA 3INYA 3TMAA 4Z7RA 2DFLA 3ITNA 4LYEA 2PUHA 2EWWA 4H7JA 3A3OA 3H0KA 1UC4B 2Z5VA 4HPXB 4J76A 4US1R 4WI1A 5KOJA 3AY7A 4UXJA 3LBFA 5LA6B 2GM5A 4KYUA 5JIBA 2IH5A 2E48A 2P7IA 3GAMA 5A9SB 3EOZA 3DTVB 3NDPA 1PR0A 3KWLA 1D1SA 1PRYA 3WRYC 5K8IA 2C2BA 1VJ5A 5JH7A 1X1SA 4DSNA 4Q9IA 3ZNQA 4KQ1A 2ZAGA 4S1NA 5BW8A 2MMCA 2X1HA 1WKBA 1CEEA 2PZMA 1GAQA 3T12A 1BXGA 1FFEA 4KK4A 1A4IA 4HQ0A 1PG2A 4RJTA 2GDZA 5KVSA 4ZEVA 3NWOA 1GXSB 2BE9A 5EQJB 3E7WA 3EZ9A 1IONA 2GFIA 3BL6A 3V3TA 2F9MA 3U7RA 1E5TA 4ZCRA 2YRWA 4KSYA 5H9WA 5BPHA 2JH3A 3IIEA 4I66A 1G16A 4U4AA 1OSNA 5K8LA 1H22A 1X7DA 4Q4JA 1CUBA 5ED0A 5JS2A 3HPRA 1M1XB 3CINA 3EDCA 4PLHA 1AOXA 4QTTB 4RM2A 4AY4A 2GA8A 1FP1D 1H6BA 4AJHA 1T8TA 3AX6A 3C24A 1Y4AE 3D81A 1HZJA 1SBNE 4C0BA 4S05A 5H4GA 3A27A 5JWHA 4HN4B 3RVMA 3W2HA 2AG0A 1QO9A 4UDYX 5DBGA 5FD8A 1ZJ5A 3GZJA 4CTOA 5JD6A 3TP9A 1JA0A 3ZDZB 2BV3A 2Y99A 3UICA 2BM9A 1L5HA 2GAFA 1EX1A 3OTWA 4ALNA 3N2KA 2R7LA 4KDEA 4L4XA 4RKYA 3OT1B 4TSRA 4UCWA 2Z6UA 2C5GA 4OAOA 5AJHA 1XZ8A 4BNGA 4GCWA 1GYRA 3KQPA 3PHCA 5E1DA 4DCGA 2OK7A 3KQVA 5A62A 5HXAA 1JJBA 3X1ZA 3AM5A 4CCWA 4UNSA 1N33B 3EBPA 4QRHA 1ST2A 4C3ZA 3M4XA 2O5EA 4YT8A 4MUGA 5AOCA 5JSYA 4AYXA 3IAAA 2FSIA 3ZPXA 2VJPA 2ZRMA 4MGIR 1ACMA 2DUUA 1AO3A 3AGPA 1WHTA 3HH8A 3NTUA 5JCOA 4JWTA 1VB5A 2CV0A 3DQPA 3FF4A 3L7JA 5BSWA 3OJFA 3WLEA 2DTDA 2DETA 4TWRA 5EE9A 4AURA 2F59A 3INGA 1QYVA 3PC6A 4RK0A 1FZTA 2QTZA 5F7JA 1SUSA 4EZBA 4B6SA 2PKCA 4LC1A 1H3EA 2FZ4A 1KKUA 3UMSA 3LLMA 3W1VA 4UTOA 4ZI2A 3PVCA 2WKPA 4CQMB 4ENSA 1OXVA 4CF3A 2OAP1 4A36A 3STHA 4JI7B 3MQ4A 1RW4A 4H6WA 4FZ3A 5FPHA 1M7HA 4WKCA 2ZITA 4N9WA 4NZNA 4JI0B 5D2CA 2CY0A 1UKBA 5L3ZA 4U7PB 1T35A 1E96A 2YOFA 2O52A 4G4GA 3U4AA 1AGYA 1Q3KA 4QOFA 4U9UA 3E2MA 1ZHOA 3AP2A 4PG7A 3E3LA 3RAEC 2YQ4A 2BMFA 4FGZA 4BLTA 4YUVA 4G9BA 3F3SA 5NULA 2A35A 3WHPA 2NUPB 4Q7KA 3IE2A 2W8ZA 3T3PB 1CR2A 1HLKA 2WTBA 3BE5A 4II3A 1U3TA 2C8LA 3KUCA 4L5CA 4UATA 3Q0IA 4AT1A 2ZVPX 5KJFA 4X1IA 5LQDA 2R2DA 1Z2EA 4DIFA 4BRZA 2F9FA 1MRZA 3OIDA 2V7GA 4ARAA 3H18A 2Z83A 4LISA 2H2HA 1YVUA 3H9GA 3KB6A 3GRKA 3VSCA 3QPBA 4LJ6A 1JDUA 1ZCFA 1NKTA 1SOVA 2WG2A 2R48A 4FMDF 1NKVA 4GU5A 2R8EA 4W5TA 2IY8A 4KQ9A 3UK6A 4HX2A 2FA9A 2ZYRA 2ZGVA 3QVOA 5DGTA 1VSQA 2XW6A 3CCCA 5I7EA 2NXJA 5EP4A 1VCOA 4WD6A 2VF4X 1WTCA 3B3QA 3SR3A 3OX3A 4WA7A 2X3YA 1LF0A 2B9EA 1AC5A 1J56A 1LLFA 2Q9AA 5BVHB 1EUCA 1I1NA 2YX1A 5ACVA 4N8SA 4MVJA 4BO7A 1LSJA 4A0GA 9MHTA 2MYPA 4KH1A 2NYVA 3BWDD 4REQA 1YRBA 2G72A 4MV9A 4ID9A 4RPGA 3O3MB 1KI3A 2E7ZA 2P9FA 4ECEA 5HX7A 1K88A 1MZVA 2LPMA 1NX9A 1GRNA 4M49A 5SV2A 1NUPA 1LU9A 3H4VA 1GNVA 4J91A 2BIFA 3D8BA 4UZFA 3TUJC 2HSWA 3Q7TA 4KO1S 4D3XA 5AVSA 3SVLA 2QBYA 3PQ5A 1KETA 5G1OA 2QN2A 4N03A 4M9QA 4L57A 1SHUX 2D00A 4MTLA 4XR4A 1AJEA 2YMMA 3KKLA 1AVTA 4HDSA 1V39A 3BD6A 2DERA 1U2RA 4B4VA 4JYCA 2JCGA 2ORED 1COZA 1XLWA 2D62A 3OOJA 3PY5A 5EZ6B 1H9BA 3L6BA 4UOZA 1E5QA 3GFRA 2H1VA 1FDUA 1GM5A 4PPGA 3H05A 1ICEA 2IYTA 3CVJA 3LLVA 4BQEA 5FL7A 1MT3A 3IJPA 1PSWA 1Y37A 4IIEA 5KQRA 1PFKA 1H3FA 3RFUA 5BSUA 3FOFC 1Z8FA 2TSYB 3LXXA 2FSVA 5KNBH 3EGEA 3FFXA 1P9OA 2XBUA 3QXGA 4IO1A 6LDHA 3HCCA 3SICE 1DBPA 3V4ZA 1N7JA 1B76A 2P3SA 5K7SA 4XCVA 1YCGA 3D7LA 1CS4C 1S2IA 1XZIA 2W93A 2ZI9A 4UPVA 3RV3A 5CDUA 2PSDA 4IFIA 3JD1A 2KM1A 3QIAA 1U0RA 2F3SA 2Q6LA 3GFPA 3IJRA 4KBGA 4JA0A 2NUAB 3T9DA 3X2YA 3CPSA 1ACLA 2I2FA 1MJHA 5HBRA 1VZ2A 3VX3A 2PH1A 4MXDA 4CMHA 1MB2A 3EEQA 3FOCA 4YX9A 2E0IA 1CZLA 2I8LA 1V95A 2XRFA 3LVBA 5FOWA 1H85A 2GNAA 2COKA 2ZLBA 3A3PA 1VPEA 4XGKA 5F51A 5K6RA 5ALKA 5B3KA 1E2KA 1YZKA 1TQ2A 2P8JA 5LU8A 3CNEA 2ZI3A 1G1MA 3OY7A 3PKIA 1T3GA 2QTWB 2OQRA 4GS5A 4LG1A 3ZD8A 2B94A 3E5HA 2KBFA 2ZDQA 5EINA 3MC1A 1E6UA 2A5DA 3V9AA 4LJRA 3G59A 2G08A 3G5UA 4POAA 1D8TA 1C3LA 1L5ZA 3RS8A 3TQSA 2BZ1A 2AEFA 3BV6A 2LNDA 3ZGVA 1U9IC 3MINB 4JDPA 4O1HA 1GZVA 3DO8A 3GLGE 2Q50A 3EXHB 4UWPB 4PYIA 4JQSA 1TTPB 5LS3A 4YQZA 2HK8A 2ZO4A 4IXNA 1P2DA 4RKWA 5ECDA 5KI6A 2VJOA 1QX4A 2Y1KA 5I01A 4GVLA 4BPBA 1E7RA 5AYAA 1W581 4A2PA 3SR4A 1GCOA 3KB1A 2JPDA 3GJ5A 4H1HA 3UN1A 4OV6B 4DT1A 2EP5A 1KZGB 1NN5A 3RGGA 2WUGA 4EP1A 3D5QA 4ZVSA 1ODKA 2VS1A 4Y6RA 4ZC8A 2ZSHA 3BHNA 4QIHA 4B32A 2JKZA 2OAEA 4FWIB 3WB0A 1KAGA 3EVFA 4LXQA 1KBOA 2A5LA 1RRKA 1J0EA 3EVNA 4YLYA 4RJLA 1Z16A 1VLHA 1UPBA 2EC5A 1NBEA 2PKXA 4MKRA 3HB7A 4R1PA 3YASA 4J0JA 3H6HA 5M34A 1L7VC 3KYCA 3BHJA 4F6LA 5BXYA 1WSAA 1PZGA 2ICAA 2DFPA 3OJEA 5EIBC 1E6LA 3FWYA 4CL8A 4UUAA 3KR9A 4BY9E 2H7VA 1XDZA 3NP9A 1AHIA 1YR9A 3FNIA 3HCEA 3LK6A 5TEWA 3UWOA 5KTOA 3ONWA 1BVTA 4EHFA 1EK1A 4DLKA 5C5DA 4R2MA 1E1DA 3PQ2A 5E2IA 3CUVA 1TC1A 4C0AC 4MLZA 4E5MA 4Y2PA 3I62A 3CH4B 3DXZA 1JMYA 5B3JC 3RFCA 8OHMA 4P36A 2A1UB 3UTCA 1P61B 3PSAA 1PEDA 4C76A 1FTQA 2ZRGA 3AP1A 4KK3A 4WVFA 1FBNA 1PI3A 1CNMA 1G55A 2OTCA 4GWKA 2NSJA 4XFJA 1Y7LA 4H31A 4CQLA 1DCTA 4L0MA 4BKPA 4EI9A 4YPOA 3STXA 5MF6A 4LYFA 4Q4JB 4RD6A 4X71A 1BCSA 3KQTA 4GGPA 4ZOEA 1ADFA 2MMGA 4FSXA 5GJVC 2FN3A 4AS1A 2B4KA 2DUJA 2HSZA 1CSEE 1XE3A 3DKIA 4C6TA 3QVXA 1NJ5A 4CL0A 2MIIA 3MGKA 4Q7EA 4TQAA 5AJXA 2OPBA 2AE2A 3EVZA 3QU7A 5LZ5A 1V8FA 1WRBA 1BN7A 1ADJA 3ESCA 1G2IA 1A27A 1JDVA 2Q8NA 3NH6A 1N6IA 4PNEA 2PLAA 3DMPA 1RP1A 1TIPA 2PANA 3VDXA 4EECA 2XCTB 2V0GA 3I92A 2F9LA 1SCNE 4GMHA 5KNBA 2LV8A 4C1HA 1ZQ9A 5D3MA 4YAIA 1J07A 1NAHA 2I2XB 2LCQA 1H66A 2NV6A 4C5AA 1C5KA 1I0ZA 5KU7A 1VSUA 2GDJA 4F6HA 4DW8A 1O0CA 4AX0B 1TJPB 3TAUA 1H4TA 5KC8A 3UJHA 5FNVB 1J97A 2NQ2C 3L8EA 5BYKA 2P9QA 4DLLA 3GLGA 3DKPA 5G0SA 1UFVA 4OHPA 1XQXA 3IL2A 3CRZA 3IBGA 4TM8A 3UO8B 3GRUA 1DDOA 1NURA 3KOMA 4MRPA 4RE6A 3MBKA 2H9IA 3IR7A 2OECA 2EWVA 2B8EA 2X1VA 3IUNA 5G0WA 4MYDA 4TS4A 1V9CA 1EX7A 2DJIA 3PX2A 3QPCA 5EI5A 4DVGA 4F8YA 3EOAI 5EFZA 5AKYA 4NZ9A 3WLIA 1Y5NA 3GG2A 1AB5A 1PD0A 3MTGA 2CVZA 4UUBA 4QBHA 1H2ZA 2B8JA 3X2EA 2WU4A 3SXUB 1KSGA 1IQ0A 2VHUA 5CFNA 3I05A 4LK2A 3ZXUB 5JI3E 4IR7A 1HKUA 3W6UA 3G17A 3AHEA 1GTL1 4C3UA 3K9FC 4BWVA 1N2OA 1PZHA 1G18A 2HQSA 1FVHA 2QRKA 4G6ZA 4RZ3A 3VC2A 4J1QA 2EKDA 4TM7A 1I3MA 2YHBA 2GETA 1AB6A 2VHXA 4YT4A 3DVRX 2Y1OA 4F38A 4GDFA 1JDNA 4YA6A 5E6UB 1P7PA 1FJ2A 2F90A 1GT6A 4LSWA 1L7DA 1XNQB 4Z7JA 4WZZA 3FPAA 4QUGA 3N8KA 3G2HA 1T9ZA 1U2ZA 2PBFA 1YU9A 2WF7A 4Q6BA 1X14A 2E87A 1ZM2A 2GAIA 2ZYAA 3OP4A 3OQJA 4LWQA 3USZA 4DDKA 2GPSA 3FHTA 2F3TA 2MINB 1GRVA 5FLEX 4PLZA 1B23P 2IOQA 2V59A 1O89A 2HEIA 4BNFA 1T3LA 3FLMA 4HNHA 3P32A 4W9MC 3L8FA 2PMDA 1TQ4A 1L7PA 3OLVA 5KDDA 1X7YB 3CLKA 4K9DA 4F9GA 4ZVPA 4W6ZA 3STWA 4X1IB 1FDOA 1IXKA 1QR6A 1P2UA 4IOMA 1U04A 2PUVA 3M3DA 1TTHA 4HLUA 1WOMA 3H87A 1XKXA 4FEKA 1YFKA 4FYVA 2N0SA 5AHXA 5BMOA 5EMMA 4JI5B 1FYFA 2ZZKA 3G2IA 3VJLA 4M1KA 4ZI7A 1T5DX 4EHJA 2P5UA 1F2TA 3EGXA 3QBJA 5LZ2A 4FFBA 5IZCA 4Q1DA 4D26A 3RUDA 1SVMA 4REOA 3JXPA 3OJWA 3ADDA 3NWBA 4Q00A 4B7CA 3HU2A 4OJMX 3CX4A 2P6PA 2QQ0A 2TMYA 2EL7A 4NYIQ 4Z4QA 3SQLA 5ACRA 2ZE8A 2X6QA 4E4TA 4E94A 5DN6D 1ZUNA 1L7QA 3U6KA 3L4EA 2JAUA 3IPXA 4FQ5A 2CG3A 3DV0B 3G9UA 3C4VA 4JVOA 3V3KA 4CTKA 4IUCS 2GPBA 1XEWY 5JSFA 1OIXA 1G42A 2DCMA 2PU7A 3CURA 2F1KA 4YRCA 3TAXA 1JR3D 1K5GA 2QU8A 3KSUA 3NHPA 3WJ2A 5IDQA 3ME5A 4YSKA 1OTYA 3V4SA 4G5RA 2DOOA 1H69A 3ZU5A 5G53C 5ALJA 1XJWA 3WJAA 4B33A 5I9NA 1W48A 4NOLA 2BG7A 3K0KA 2QWXA 3COSA 4TOIA 4MWBA 4RTLA 2JGFA 3PG4A 4YB8A 4NEQA 1TX4B 5KSPA 4JR1A 1I7DA 4TRNA 5H16A 1KMHA 2F3PA 2V5VA 3PQ7A 1KDZA 3H42B 2NTYC 3QEMA 3OFNA 1W9HA 5K0EA 1GYQA 2C3UA 4DYDA 1HMYA 3HN6A 1CY6A 1LNQA 3BGWA 5ILQA 5B4VA 4OBEA 2HGSA 2PQ2A 4MA5A 1ZH0A 1TT5A 3TVTA 4PEVA 3AZPA 1LCIA 3OWHA 1GAJA 3BD8A 4F3CA 5CT9A 1NFQA 3PDWA 3LBIA 3K5IA 4R1LA 2FQYA 1R6VA 7GPBA 1BDJA 2X58A 3B8HA 5JDIA 5J1SB 3D6FA 5J1TB 2XD4A 5LJIA 3AVYA 5BWNA 2FJUA 4MVJM 1WVGA 3CONA 3BQMB 4H0DA 2IYSA 4OY3A 4WBNF 3RUAA 1NRWA 4X1YA 1P31A 1FNDA 1OQAA 3PPXA 2JD2A 4IV5A 1BWRA 3JTMA 3L9WA 1H2EA 1UAAA 4U2BA 4ZQIA 1MH1A 3DT6A 2WPDD 2YV5A 4R3UC 4UM5A 3CRRA 2FEAA 1NMXA 4UDOA 5FBRB 4E2XA 1BGXT 3AKDA 1V26A 4IEIA 1XN1A 2BKXA 1PEYA 3BJIC 2ETVA 2FE1A 4V3BA 2JHAA 1KGSA 3GPDG 1RIFA 2C31A 5EAIA 2VZ9A 1VIVA 4AC9A 1XU7A 3MWKA 4OXIA 1M6VB 3IP1A 3AJ8A 3FVQA 3URKA 4AMYA 3MWFA 1Y3DE 3ZN2A 4BO4A 3ZW8A 3JSAA 3IDQA 5KSZA 4ZEJA 2E4AA 2I3DA 1JX6A 1RBZA 4B84A 3TF5A 2MSNA 1DP4A 3ECAA 2VWQA 1QU3A 4CIWA 3T1YB 2FG7C 3SKYA 3G23A 2A0FA 4WAUA 1PO7A 3B1KA 3D4LA 3DW1X 2C5FA 3DBRB 2H0QA 4JFAA 5CGQB 1DSSG 1SG6A 5LA6A 1UT8A 2GA9A 5AW3A 5ER6A 5JRJA 2GF2A 5IJ9A 3WOVA 2NVBA 4DR7B 4NJOA 2VLIA 2QTTA 1RHKA 2BEUB 1G7CA 2NZ2A 3NH9A 5IS2A 4QPZA 1N6KA 3ONEA 5T6BA 3QI2A 4BLPA 1HL3A 2O2DA 1DBWA 4YP9A 5K8VA 1UANA 4RD3A 4YMSA 1QC5B 1UMCB 5ICMA 4KPFC 3GVIA 2GERA 3IHKA 1EFVB 2HQRA 1B2LA 4G5XA 2Y93A 3MLBA 4FWBA 4RAOA 1GCAA 2IWRA 3ZU3A 4YMTA 3WLRA 1KWGA 3JWJA 3HCRA 1HTTA 2NXWA 1SZJG 1C9DB 4U7GA 1RIIA 3KQHA 1JEDA 3WGHA 1HORA 4YT5A 3WDKA 3PL1A 2R1TA 4EYOA 3AEQA 4DY4A 2J33A 1PD1A 1FJHA 1J2YA 1M8JA 4MTCA 4X44A 2ODNA 3KB8A 5CFRA 2BUAA 1JHOA 2FXVA 4NV0A 2ZOSA 4C5CA 5JJIA 4XKJA 4AXBA 2AW3A 3I2IA 1F06A 3GJZA 3GGJA 1WPXA 2KE5A 4NYJQ 5AHOA 4RENA 3TVYA 2XZLA 1A9TA 3AUTA 3DOIA 4KQJA 4O1MA 3S4YA 1KVSA 2XT9A 3ROXA 1B0ZA 2VP9A 2X4LA 4UVEA 5ERYA 3RRJA 4M8LA 1NBOA 2FYTA 2QD4A 3RSCA 2NSDA 3FZEA 2BMJA 1RHQA 4NBLA 3T3GA 1N0UA 2VYNA 2WAYA 1L1QA 3ELWA 1NMSA 2Q27A 5J5CA 3V8VA 4YXFA 1EVJA 4WCDA 3WNQA 3VH3A 2SKDA 1E6CA 2VQSA 2E4ZA 3PIRA 2C7GA 2ZWPA 3F9RA 3RT7A 4DBLE 4DWJA 1X9GA 2BIBA 1CV2A 1J1UA 1KVRA 3PEEA 4Q1AA 1BRTA 4HEQA 1CDDA 4YCBA 4W1QA 4LSZA 1L7BA 3ZLBA 2GWHA 1PJQA 5KTTA 2I4TA 3G85A 5DI9A 3V7WA 2BDTA 4LMRA 1PJRA 1CUZA 4TQ9A 4XVCA 1D04A 2QJWA 1XIVA 4P22A 1Z6AA 1FUYB 1ZZGA 3K8QA 4ZVVA 4GD3Q 2WIKA 1ABEA 4AJ9A 1B1CA 3UUEA 2HI0A 2NO4A 4EJ6A 1Z74A 1J9EA 4TMXA 4RPJA 3S2ZA 3H5NA 1TJ5A 3RSZA 2HO4A 1I4TD 2WVHA 3AOEC 3GJ6A 3L7CA 4HATA 1JI0A 3TX2A 1A9QA 1O9GA 1NMQA 3BMNA 3E7DA 3V2HA 1A7AA 2PWPA 1Q7EA 1BN6A 2NXNA 2YL2A 4P7BA 2QJRA 4EF6A 4ZRDA 4LGYA 4LXUA 3PDHA 1LPPA 2B37A 3C43A 5IAJA 1Y5RA 2I6FA 2Z08A 2GAJA 4K8OA 1FNNA 3JW8A 4B47A 3HL0A 3PE3A 5JAZA 4HTAA 3VVLA 4HMOA 1B8UA 3QV1A 1YACA 1KERA 4ZOLB 1T4CA 3FNHA 3BIWA 4OP3A 5AIAA 1M1NA 2WWVD 2Q21A 1J33A 2W8BB 4OCZA 3R0JA 3E3NA 3UA4A 4EFDA 3MWJA 2N1MA 4TL9A 5CDYA 2ISQA 2M2IA 5BY2A 3TQTA 5KOHA 1ENPA 3OZDA 3PITA 4JJEA 3GEDA 4MS4B 3AJAA 4V3CA 3V1UA 1DEXA 2YBEA 3OA0A 4YO7A 1NVVQ 4RH3A 4V03A 4ON9A 2X6RA 2IYRA 5CDHA 1E8DA 2HRRA 2IUFA 2ZIWB 3CMMA 1A9YA 1XRPA 2NNWB 4IIXA 4N6GA 4E15A 3TXXA 3QF7A 3KEQA 5TQVA 3QRWA 5E7QA 1MO2A 2P2ZA 2XTNA 3E27A 1TM4E 3DHVA 4KGZA 4ZRMA 1NP7A 3IQIX 2C0QA 3K0EA 4EXSA 2FPIB 2RGRA 3IR6A 5M29A 5IM4A 1QIDA 4XIFA 3IQXA 3A05A 1YRLA 4QU0A 5ENZA 2VR1A 4DBVO 5C3MA 1ILEA 3WV4A 4NENB 3AWDA 1Y4ZA 1WCIB 2YWFA 3C3XA 3G1TA 2GM3A 4Q9AA 4CUZA 5B7PA 1IDOA 3CLTD 1MJ5A 4R1OA 1F8UA 1N2CA 4MLCA 5HG0A 5KPDA 1ZKPA 3VC1A 1DJOA 2FFBA 2QAIA 1RWBA 2ZSDA 3HWSA 4TMKA 3K4QA 1SC9A 1K5HA 3T9BA 1E3TA 2NAPA 3BHIA 3BTUA 2FEOA 3F8TA 3HYLA 3FE2A 4TTIA 3P2EA 3DS8A 4XD7A 4I50F 3IEPA 5A0TA 1V47A 4GYJA 4EM6A 1M76A 1R9GA 1E2NA 4ZODA 5FBHA 2X8JA 3DA8A 1S2MA 1W1UA 1SZDA 4YMVA 1QK3A 4L9SA 2K7ZA 4XWWA 4GW3A 3C7CB 2ZPTX 1N0VC 3F1LA 3G5TA 4LNUB 3IPRA 4R1SA 4Q0MA 1DLIA 1UJ6A 4YCSA 5BOSA 1J24A 1W1WA 2XODA 3ZU2A 2D1YA 4WACA 2IFTA 5AK4A 3TO5A 4C03A 1F9EA 1D5CA 1FFXB 2HSJA 2J0VA 2MSWA 2XUOA 5HZMA 1GNRA 1DQZA 3EVCA 2W4MA 1ZI6A 1T5IA 4M37A 4LOHA 1GQYA 1XTJA 4DLZA 4E5KA 1QHFA 2LGJA 3RSOA 5C46F 1ECFA 2BGJA 4OYHA 4C1DA 2KBEA 3OY2A 4NMWA 2C8KA 5LDGA 4PC3A 5DOVA 1MRSA 1U8XX 2PVPA 2PZJA 2QS9A 2RCNA 3DE0X 4FYYA 3DONA 4E4RA 3DE7X 2XNCA 1CP3A 3LBHA 4Y3UA 4GYKA 2OXRA 5BSRA 4BZWA 1N2BA 3TG8A 1Y8RB 2NWQA 2WA2A 4Q15A 1JKJA 4IUYA 5HKKD 4QUDA 4JGBA 3PQ4A 1DNPA 4ME6A 4W5RA 3L7OA 4D81A 2WJAA 1FF9A 3H9BA 2ON6A 4U6SA 5TR9A 3UV6A 3ZZ1A 4EW1A 2CL5A 5GJWC 3GD7A 1FMTA 4JU8A 3SDZA 2ATVA 4MKHA 1ID1A 2A7XA 1BX0A 1VPVA 3F6SA 3PXUA 4G5SA 3X2ZA 2H3EA 4RZ2A 2VTKA 2JAWA 1YSCA 4H1WA 2AXQA 4KPUA 5TPWA 4PICA 3ZGYA 3M6IA 3NNSA 1ODTC 4D4KA 3COVA 4HL2A 1NQVA 2PZLA 2BFOA 3D3KA 3L1JA 3P9QA 4PYQA 5F7ZA 3IUSA 2II6A 3LP6A 2D0OB 1O5IA 5EIXA 3I5YA 1N7IA 2ESRA 3N2GB 3I52A 3QA3E 4DXHA 4CF4A 4PYOA 1KWKA 2B1JA 3V4PB 4C0SA 1H2WA 2GCGA 2VP4A 5LSAA 3M6AA 1M2KA 3LG2A 4HHEA 3LJKA 2PNFA 4N5MA 4NI5A 4C7JA 4D4LA 4F06A 5DE3A 4WJLA 3W34A 3SIWA 3WKEA 1K6XA 3NTLA 1TYCA 2CDRA 2R6JA 3MN1A 3RVOA 4JI2B 1NDHA 1N1GA 1OC4A 1SHZA 4L3VA 4NYMQ 4C2BA 3UGTA 4KXMA 1EJBA 1K0UA 2CW5A 4M0EA 1WU7A 1NYLA 4DWWA 1NX6A 1NP6A 5AKLA 4ZXFA 2YWRA 4P4UA 4QG3A 2NYPA 1C7FA 1ZUIA 2W2KA 4KNVA 3C3KA 1LTHR 3U19A 3H3FA 1P8AA 3FI9A 1OF1A 3DBRA 4FR0A 1C81A 1ZM4A 2G0NA 3MJFA 3TQCA 1WCYA 4ERNA 3BC2A 2WKQA 2R1VA 4OQYA 1U6IA 1JYSA 4RIEA 5T4BA 3JQDA 3OEWA 1ZNQO 4KQ2A 2B21A 2ZJ4A 1KK2A 2D2IA 4NURA 3CQ9A 4KDRA 4YDHB 5CA1B 1LBQA 1YS6A 2FR8A 1WB5A 4D9MA 1BIFA 1JPNA 2OB2A 1BVUA 2ZIGA 2FJPA 4I4TF 5D3ZA 2O2ZA 3WV5A 1F1JA 4KO2S 4Y0VA 2IS1A 1OYWA 3U7GA 2J8ZA 4RORA 2UUAB 1X92A 4HNRA 3GFQA 1E2GA 3QOXA 4BVAA 2QUJA 1BG6A 3H9EO 5KVQA 5TS2A 3W3AD 2QTVB 4ESOA 2JFFA 3X1YA 2H1SA 5T7BA 2XQKA 1V7ZA 2DPHA 5ILGA 3MILA 4ND8A 2WIGA 1QIFA 3PHIA 5JZBA 1BWQA 5T67A 4ER3A 1HG1A 1HZZA 5LMNB 4BMPB 1FSFA 2SHKA 3UFBA 5IWAB 1NBMD 1QNFA 3ABQB 4CBVA 1U0BB 3GA0A 1P9WA 4NBKA 2C04A 4LRTB 5TQ2A 1PF7E 5CA0A 1NLMA 1A76A 2PXXA 3DVAA 1MMFB 5AI4A 4CYMA 1QLJA 4QX6A 3OBIA 3P26A 4ALJA 1KP9A 4BLVA 4ZJZA 5AW0A 2WWIA 5I47A 2PO5A 5EJ5A 1E1MA 2FU5C 2ZNBA 1T1GA 2NZEA 4BNXA 4CM9D 2ZVDA 5SY9A 1AMNA 2X8AA 4V2UA 3H8WA 4MPJA 1B42A 4RZHA 1OZAA 4Y2XA 1U2DC 3Q10A 4M0LA 2A5JA 3M9LA 5EJ2A 5HF9A 3FIUA 4ZNBA 3ENVA 1GKYA 1F20A 3RTEA 4HNAA 2GRUA 3I8SA 3KWFA 8LDHA 4EMTA 2UZ1A 5TDHA 2QROA 3EH1A 5HGXA 4HYTA 1TDJA 3DTVA 4QPNA 1H4VB 3AZQA 3OCCA 1I2DA 2IDKA 3R4VA 1VGQA 4JJ4A 1M1UA 3AMVA 3E22B 3FTPA 1VIYA 2Z56A 3BXGA 3OM1A 5GJCA 3UJBA 3ZX4A 4CM1A 4EB6B 2SKCA 5KTRA 2IS6A 1XG5A 4EPXA 5DU2A 4J7UA 3ZNBA 4CKZA 3GN2A 3K32A 3TZBA 2F55A 4CGYA 1FTGA 1N0WA 5I5GA 1P45A 1R37A 3GNSA 5C51B 3TW0A 1G6KA 4DADA 2WP0A 3S1LA 1NUTA 3BDVA 2BFEA 4MZXA 4XH9B 2BMAA 3QXHA 4DBLC 4ZCTA 3V4OA 4RSGA 5I8PA 4KTVE 5KQLA 4GWGA 2OXEA 1Q7BA 1RLIA 1TQHA 3TNFA 4CUJA 2ZRHA 3ZY6A 1K68A 1WWKA 2AGVA 1X9HA 2P9GA 2YFYA 1CY1A 1KH1A 3E3OA 1XZGA 4KMSA 1CJCA 4I5FA 1SHLA 1U28C 1ZMRA 4K9KA 3PHGA 5JROA 4LJKA 2FW8A 3VSDA 3C7TA 1Y0BA 2Q4BA 3C8HA 3I3SR 3NHBA 3PUHA 4UDNA 1FQWA 5DO9A 4F3YA 3JYHA 1T8YA 1QK4A 2F1HA 2BFAA 4M46A 3AF5A 3VVCA 3OEHD 4F2WA 1DADA 3IUPA 4MW6A 1R74A 3W5BA 3S5UA 4UTVA 4UHBA 5E9WA 3PNLA 1UXGA 1U90A 4GRIA 1TEXA 4JOBA 5LD2B 5EJ8A 1HDZA 3L92A 1CU1A 2IW1A 3IGFA 4LRQA 4PVOA 5C8YA 3KL2A 3NHAA 1JLLB 2ZRAA 2ZG6A 4B7UA 1E7QA 2WRSA 3L0DA 2Q7XA 1WIWA 1M5UA 4CU5A 1GKKA 3IBYA 2DH6A 5H70A 1A9XB 4UWSB 3P0RA 4II7A 4K6OA 3NHWA 5FX2A 1NW8A 3BA1A 3TLEA 5LBUA 4X93A 3RH0A 4XRGA 4TVBA 1V11B 1EVIA 3U4IA 3QJGA 7MHTA 4M0PA 1LY1A 3QVKA 1ZVJA 2VYVD 2MT9A 1VBFA 3WOHA 2AYYA 4A0SA 3AVPA 1TK9A 3EZLA 3ILHA 4ATNA 4EA7A 4KG7A 3NYWA 3IEMA 3OPQA 2W6ID 1P1IA 4OQPA 3TBFA 1ZNYA 1U5CA 2QW0X 2X3FA 3W3AA 4DS3A 3R7WB 3NGMA 1KDOA 4X8MA 2JJMA 4QJ3A 5JCJD 2VF2A 4FZJA 1D4FA 2BMDA 3WQQA 4CUKA 3AUUA 5C9ZA 2J5XA 4KXFB 2XXBA 4FFMA 1BQEA 4CM8A 3U7EB 4WHMA 4L0DA 2L17A 1OYOA 1MQAA 3PXGA 3UJ9A 3QPWA 4OHYA 1CUUA 1Q11A 1DE0A 2OAGA 5H82A 2FWMX 5F9HA 1C7JA 1PGQA 3DD1A 4MUFA 1SUCA 1Z0JA 4GVPA 4YVFA 3TM5A 5KHLB 1C0LA 2N1BA 2Y0PA 2CLSA 1KPIA 3CKLA 2G7ZA 2OOKA 4QNRA 3FBWA 5FV4A 5HJ5A 4OLBA 1CE8B 4AG5A 5EMNA 4ARZA 2GZHA 5IAAA 1XTQA 4GLOA 4AQDA 1PG0A 4ZYLA 1MQOA 2Q45A 2X7XA 4L8GA 5AXAA 4C6HA 4MSUA 1X7WB 1ZITA 4FHFA 2WB4A 2FLWA 2MR5A 1ZKDA 2JBWA 2QTRA 4GG1A 3ETDA 4LNUA 2O2CA 3VRHA 1NU6A 1SB9A 1ZA1A 2JD1A 3K5PA 3MUOA 1Z18A 3RC7A 3HSKA 3CJTA 3GLHE 3UFXB 1K8ZB 5TY0A 1PL7A 2OO3A 2W22A 1Q1GA 3QUSA 4G1BA 1QKJA 5CLQA 1YMVA 4GR5A 1ODIA 2OBBA 2OXIA 1A7TA 1DC5A 2SECE 2QD5A 3TSAA 5HKLA 4A26A 4O5OA 4LHEA 2VIIA 3O8NA 1VYTA 4KE7A 1XZJA 4RLQA 1R0RE 1X80B 1YQ9A 1VBNA 2NV0A 2OO5C 3CO0S 4AJLA 3IR5A 4B3BA 5HJEA 3HXMA 4WFKA 1Q7TA 2P9JA 1HDIA 4RTOA 2PX6A 3FRIA 2ACVA 5C53B 3O47A 4QOIA 4OIFA 4DRZA 1JKJB 2WWRA 4Q21A 3RYHA 4G25A 1F6WA 1IOZA 2C4HA 1JT2A 3C7DB 1T34A 4HFJA 3K0CC 3AM3A 3EUFA 2B69A 2Z8YM 4Q7LA 1CY2A 1H42A 1NSTA 1OXBB 5I9MA 3SBOA 4QAQA 1W49A 1SKBA 4HI0E 5FCDA 5AOBA 4TV8B 5C3UA 3GVXA 1G21A 1JH9A 5JS6A 2V6BA 5AXCA 4Q4HB 2HBQA 3BCRA 3CYFA 2D4HA 4PO3X 3LDAA 1YASA 4TKZA 5ACUA 3Q7EA 2FSGA 1ISFA 1HE8B 1R8XA 4OQ4A 3FJ1A 3A25A 1APBA 1MW8X 1E5LA 5CVUA 3JQAA 1W5SA 2D3TA 2Z8ZA 1K3TA 1TM5E 1VBMA 2ZUWA 3IIIA 4MV0A 2BGKA 4M6WB 1ZD4A 2B35A 3LX8A 2NO5A 1UP7A 4YR7A 5HMLA 4Z4EA 2CNNA 3E70C 3F4LA 4J0HA 3N3BC 4LFCB 1AA6A 2J5QA 3GJYA 3G8DA 4AZ3B 4CF6A 4CHGA 2WIAA 3D4BA 3CWZA 3I23A 1XC7A 3AHFA 4JB3A 4JWKA 5JRDS 2IBTA 5AM4A 5TGZA 4K9SA 5DTEA 2W2OA 1RCTE 1YQEA 4G0YA 1IJBA 1CJKC 1CQJB 4U7FA 2ZIUB 4J0EA 2NP7A 2YFQA 3P0IA 3TINA 4DY6A 5JH7B 1NBAA 5IWCA 2XIJA 4XLLA 2NU8B 4TKMA 5AUNB 1WTAA 1YU6A 3A3YA 4L15A 1T10A 1XRQA 3ADOA 1TLLA 1N57A 1PL6A 2IOFA 2XAAA 1U1FA 4OB6A 4TTAA 1HFJA 2AEMA 4QA9A 3PD7A 4JVLA 3B53X 1XEAA 4M8KA 1VKZA 5ELXA 3TECE 3HKBB 4HV4A 2QHXA 4M0DA 2C59A 3E1GA 4IS2A 3TBKA 3WZ2A 2LIPA 4YV0A 2NQTA 3NVDA 4D9BA 4X20B 1N7GA 1MO6A 4EO4A 1Q21A 1THMA 4B6PA 3NTRA 1Z0KA 5L51A 3QQPA 5CA1A 2ZWRA 2WHXA 1KSHA 2YV3A 4I50A 4IJWA 1UJMA 4R1NA 3TOCA 1AUVA 1EG7A 5EPOA 1XXHA 2LZ0A 1E4YA 5JCJA 2ADOA 2BDUA 1C9MA 1SU7A 1ONOA 5CNKA 4UE2A 121PA 3OX4A 1TJ4A 4CM4A 4G86A 4RU1A 5EJ7A 3SHVA 3CLHA 4ABYA 3F4KA 5L6MB 1B41A 2RH9B 1L5HB 1DHRA 1X1DA 2PMEA 2RGNA 2QX8A 4IHAA 4CLOA 3FOWA 2FPSA 2PWBA 3EISA 3IHTA 1M2HA 1PAUA 4KN8A 4DVJA 1K89A 4H1VA 2RI0A 1N75A 2BKLA 1EWTA 3PRKE 2C7QA 2YZKA 2QTFA 3VR0A 3NUQA 3NORA 2ZUVA 3IUEA 2CF5A 3CNHA 4L16A 2A6PA 4HH0A 3ZCRA 4YS6A 1PV2A 2OFFA 4ZO9A 4Z9BA 1QV6A 3EX7C 4AO7A 1YBVA 2GEBA 3ZWPA 4AX4A 3DLHA 4X8OA 3WWCA 3EIWA 3JY6A 4UARA 1YR2A 2JLYA 3KFVA 2WD9A 3VVBA 2YXPX 3WGVA 1XYYA 2A57A 1NVEA 2VNHA 1GGHA 1POWA 3OLQA 4JNKA 1GZHB 2HDWA 4Y30A 1E3LA 5CPFA 2F48A 4BP1A 2G76A 1UDRA 3H86A 3IE0A 3H4MA 3RT9A 4A0HA 2ZUFA 3ZHXA 4GYUA 3NHSA 3V4RA 2PS1A 5LVAA 1V37A 2BPOA 2GKSA 1GL6A 2W48A 2DKOA 2Z2ZA 3KKPA 4IEEA 4LRUA 5EUCA 2CBXA 2NW6A 3DBHA 4TZBA 3O0DA 4GE0A 3PY6A 5BUZA 4JXZA 1PR5A 5ALWA 3SJUA 3D4IA 4I55A 1PS0A 1XTPA 5C7IO 1RHMA 3Q0TA 1UM9A 2XTZA 4WFIA 1T6NA 4ZVLA 1OH5A 1IFXA 4RPKA 2EBFX 4GUAA 1I2MA 3WIVA 2ZK7A 4CF5A 4H3VA 1T5HX 1P1BA 1QSGA 4CQNA 1T5LA 1RR6A 2B7CA 2BC9A 3E05A 4DA6A 1MC8A 4Q1EA 3U60B 5ALRA 4EYBA 5TV2A 1W35A 1WBJB 1GPAA 3PDJA 1DXQA 1JTEA 5G2OA 5BVGB 4HLUC 4A8JB 2PUDA 1DHTA 4J4BA 2WHGA 1PWHA 2R8ZA 2PO7A 1G8KA 1AXGA 2C2GA 2IHBA 5DW3A 1FC0A 2Q5EA 3SC4A 3EIHA 3IOBA 3Q6IA 3R7LA 4XEUA 1KQFA 4FOLA 3GZNB 2GK7A 1YI8A 1WS6A 1D7OA 2DPMA 2HMTA 3H16A 5KX5A 1C3EA 3LSTA 3NAMA 3VPAA 1G2PA 4X8LA 1JAIA 2GO7A 4UU1A 4CT0A 1FW8A 4V02A 1IHPA 1BROA 5A06A 3H7AA 1JZQA 1M7BA 1PT7A 4GICA 4I1RA 4ZV9A 4D1YA 5K2MA 3EHDA 3U4QB 1TUGA 3T1NA 1B0UA 3ZGLA 1H2BA 1MX9A 2DTXA 1KDTA 1CHNA 4MUEA 4D3ZA 3OT5A 1JVSA 2HAEA 2FWIA 1SBIA 4RDIA 2QE7D 2HMSA 2XOKA 3SJZA 1ND5A 2OT3B 4WKBA 2LKCA 3X3HA 1XCBA 3RHFA 1F8XA 3P20A 4UHFA 3IQEA 2J0SA 1WCIA 2RIRA 2AG8A 4KIFA 3F6RA 4HDAA 1WF3A 2CXOA 5ARCA 1F3LA 4X3PA 4PLTA 4LOAA 4G9GA 5JD4A 3TW8B 1NBMA 1A7KA 3V6LA 1JEOA 2CLEB 3DCIA 1N5RA 2CHVA 4FYPA 3TBHA 3PR2B 3H2BA 8ATCA 1FTNA 2FPPA 4C4YA 4KQGA 3P4UA 3VAZA 3EVDA 1N5MA 2R5NA 3JALB 2I6UA 1FTYA 2GUWA 5I8WA 4NHEA 4AB1A 2WZDA 4TSKA 3JS5A 2A0XA 3GLUA 3VR2D 3I9V6 4PHGA 3V1KA 1NVWQ 4KB5A 4JXKA 2A4MA 1HQCA 3G5AA 4UU8A 2I7TA 4UULA 4BRUA 5LOVB 4KO4S 2Q5CA 2NU7B 3UXEA 3O2SB 1CR6A 1ONNA 1QF9A 1VL0A 4P4LA 2ZEJA 1PR3A 2KYRA 3HNOA 2ATIA 3T4XA 1NHWA 3EG9A 3DHWC 3NVMB 4KVGA 3Q2IA 2VSYA 4YJ2F 4PXAA 1UEXC 2O5VA 2DMRA 3ODPA 3WZLA 2R7KA 5K45A 1VJRA 3KXPA 5DGHA 3FYDA 3WSVA 2PR2A 3F8SA 4YDRA 2ZAOA 3UH1A 1FJXA 4B74A 4QZVA 2VYFA 1M66A 3LM8A 1SZCA 2A86A 2YHIB 1FUIA 4FN5A 1TMKA 4DMHA 5JEDA 1P1RA 3RTCA 1BFDA 1QFSA 1SOMA 1QQ5A 1T9BA 2ZSAA 3FPEA 4LQ4A 4MAMA 4FBLA 3PFFA 3CZAA 1B00A 1Q6YA 4P3KA 4OU5A 5LN1A 3MVEA 3MTJA 2EKZA 5GADl 1KRWA 2W2LD 3GQBB 2AXPA 2HA2A 3WA7A 3UPUA 1IBSA 2QV0A 1M1NB 3MRTA 1C7ZA 3ZJUA 2WWHA 1TFUA 1AGPA 1Z2PX 5HIKA 5IVHA 1PFUA 2ONCA 2JEOA 4NP6A 1I7NA 1XZCA 3BWCA 3UMVA 3T5AA 5IW8A 1OX5A 1X87A 2OV2A 2XJ4A 2XE4A 2AHRA 1O97C 421PA 4BV2A 4CM9A 1TZCA 1BWSA 2X13A 4U9HS 1FFAA 1E0SA 2GFQA 2I66A 1BC5A 2V96A 4NE7A 4CCYB 1ZAYA 1L5YA 2QR5A 4G81A 2J08A 1MQSA 3RRXA 2I5PO 1G5IA 4MVYA 4WKOA 1P29A 2BHRA 4GI3A 1X80A 4ZI7B 4QUKA 1E89A 3JWPA 1Z0DA 2DPLA 2JIZA 2VOEA 3E8XA 4FLMA 4P53A 1I6WA 2INGX 4ETNA 3KFLA 2XOXA 3NETA 3F0TA 1QH8B 5FHQA 1FXWF 3PV0A 4KFSA 3RTDA 2C42A 3NHFA 1SKYE 4S04A 4B79A 1H8EA 3KPUA 1QG2A 3EXIB 3RS0A 3I28A 3W90A 4AIIA 1O96A 4IZIA 3I11A 5TVKA 1CF4A 2WTEA 4J5FA 4L5JA 4PO9A 5KYWA 4KAJA 2OV4A 3EWIA 2P9TA 4NCHA 2CHGA 2PQ6A 3SD7A 4ZDJA 2FRVA 2I1QA 2I54A 3MYRA 1E9AA 3TJZA 4EKYA 5A3QA 1JKXA 4F12A 1F7VA 4NS1A 4F6RA 1Q0UA 4KIGA 4CU2A 1RWKA 4LV8B 1W85A 3THWB 1N6NA 3DDUA 1WBBA 1QUEA 1ZK2A 4WSOA 4PAWA 3H5AA 5KBYA 4FHGA 3W6NA 3TG2A 3GWZA 4FQ7A 5EXDA 3RSLA 2NUTA 2M5CA 4Z9XA 1WVIA 1FVXA 2CXNA 5B2ZA 3WDLA 5E6SB 2VZEA 1KEUA 4PO8A 2AC2A 3O93A 2RH8A 3B9QA 5BN4A 1ZMOA 1CUWA 4XX1A 2ZPAA 4Q4DA 4Q4LA 1DU4A 2AFIB 3FZYA 5FI3A 5E1MA 2EZ4A 3QGMA 1E7SA 3IHWA 3FH0A 4ALIA 2UYHA 2EW8A 3Q9UA 1IN1A 3KD2A 2WILA 1UPTA 5IK2D 2IXEA 2YDXA 3LCUA 1BOOA 3HO6A 3JQ7A 4CKEA 1C9YA 1JIIA 5LYJF 5J23A 4L9RA 3IVAA 3IALA 3OSUA 5EJ6A 3CVOA 4DUGD 2P4QA 1S1CA 5EVCA 1USGA 5J40A 4KQCA 5TMPA 5GAJA 1TYAE 1U7ZA 2UYOA 3F3MA 1FW6A 2O8FA 4I6EA 1E2LA 2J6HA 2XR1A 3HACA 4RF4A 4L51A 3DAYA 2RAVA 3MWYW 4H0CA 2P9EA 4EHDA 1J8QA 1ZC3A 1VRWA 4FJ1A 5INTA 1N78A 2TS1A 1PNOA 5AKIA 4RWZA 1UQUA 1SUWA 4FR2A 1LPAB 1WPGA 2P65A 4AKEA 2EFCB 1B26A 2JLQA 3GLFB 2JLCA 4PR0A 1UADA 3DDWA 1XU9A 2A5FA 3M2PA 5EMLA 4MR8A 3JQBA 5AT1A 3TLZA 2VZLA 1KY2A 1C0PA 1M10A 1RJ9A 2PEZA 3TDMA 4A4DA 2H48A 5J4VA 2JLXA 3CN7A 3A3NA 3JAKA 4RK1A 5DWQA 1G8FA 5LIRA 2PKRA 1YVDA 3PVSA 1NXQA 3I2FA 1YO6A 2Z57A 2VUSA 4J1SA 3PNQA 3BILA 1O08A 4QJBA 1QHHA 5IAKA 2G67A 1RZVA 3JZDA 4LHZA 2SBTA 4HD8A 1KS2A 5FA8A 4EA9A 1FDIA 4FNAA 1BDBA 3I2JA 5CK4A 5TQ0A 1LXCA 4QL3A 1LNSA 2DCUA 1FLNA 1YZTA 2ZRQA 2EWMA 2PGLA 3I5UA 4HVTA 4QBTA 5F33A 1N4AA 3QU5A 5IT0A 5ES3A 1K97A 4QTXA 3BFXA 1FYEA 3KJEA 2JNWA 3NGXA 4Z4GA 3SOPA 2K87A 2IUTA 4LPKA 1GNLA 2NVUB 1GTRA 2XMCA 1RP7A 2Q5IA 3KOZA 4Y1FA 1I2BA 4YJFB 4JI3B 1JDPA 3UCXA 1IPFA 1C8VB 4F8JA 3AERB 1YDEA 4P54A 2YZ3A 2H0AA 4PVCA 4ZU3A 4B1FA 1XRRA 3OE4A 4FQ8A 4GZ5A 1U7UA 4R2JA 1IZZA 3Q5DA 1T6BY 1TOAA 2BONA 5HFAA 4GLFA 4BNHA 3C45A 3PL5A 2OAQ1 3HSYA 2I7CA 5FQCA 2Q0HA 3AR8A 3W1EA 4BN0A 1KQOA 4GSLA 4ZQHA 3ROGA 3T7JA 1DARA 3O21A 4J3JA 3VXKA 3KR2A 4ENVA 3VTZA 4NV1A 4OG2A 5EIWA 1UM8A 5IKPA 5H0IA 5KZMB 2OC4A 1E1YA 3JQ6A 4O3FA 4NH0A 4ZP1A 4TLAA 4I8IA 2HMAA 4WOKA 4U3JA 1T36A 3KCNA 3V4VB 4YCLA 4XQ9A 2AYZA 4D9HA 5BRJA 2OWDA 2A33A 5C5IA 3LPCA 4CF7A 3WWOA 3RAGA 4QQKA 3GO4A 3EB9A 3PEYA 1OJ7A 4DPKA 1J49A 1U0LA 5G40A 1K63A 5B1HA 3RU7A 3LRXA 4MR7A 5DNCA 4OUDA 2OHIA 1U2PA 1JI3A 1DKRA 2W70A 4KFRA 1DQSA 2NLOA 4CV3A 3B85A 3Q9NA 2PPVA 2PZBA 2VA9A 2AK2A 2BY4A 1ZUWA 3PCTA 4AK9A 2NIPA 3E35A 2L19A 4HQNA 5DBEX 1WX1A 5ALSA 4KR0A 2WEKA 3PDUA 5KYYA 1JFVA 1KTVA 1WXIA 2W6JA 3VH4A 4F56A 5KVAA 4R3WA 1RXUA 4ZT2A 2H4FA 1FU4A 1K7FB 2ID9A 4KODA 2YMPA 1N6HA 2XGSA 3E0XA 1YTLA 3HXKA 3TIXB 4C14A 4B3JA 2CYBA 5AJLA 4F71A 3E1SA 2V1UA 1OE0A 4YJDA 1KE2A 4MO9A 3IKJA 4P82A 5GY7A 3O74A 3EDOA 2O4UX 2WIBA 1GD1O 1Z17A 3OQIA 3DVSX 4GXNA 3BEDA 2ZRPA 4E32A 4QE3A 4ZJPA 3E5MA 3I58A 1XXLA 2P6MA 2PM8A 3RVPA 1UC9A 3AY0A 3DWGA 1JG2A 1K3UB 1DTWA 4NOMA 4UHJA 2ZXFA 3TQQA 5DSTA 4GZ3A 5BSVA 2Z4SA 3WGLA 3EZNA 3BRQA 3DEJA 3GAZA 3GD5A 3R24A 3CJQA 1OLUB 1TUIA 4O2BB 2J45A 2MWMA 4QVKA 4RKQA 2VH1A 4XD2A 1GLNA 3T35A 1X7ZA 2J5RA 3SLKA 4F4IA 1PJLA 4K6CA 4DV1B 5KC9A 3EA4A 1HO3A 3UJDA 1H4SA 4IRMA 1LK7A 4YXWA 3E9YA 3K2QA 2AMLA 3K2EA 4XQCA 1NXSA 4H6PA 5LZ9A 5UKDA 2GN8A 1JT1A 3AUFA 1KMCA 5EZSA 3C98A 3T0IA 3UXMA 4DCVA 4R16A 1P2BA 4HRVA 1ULTA 2I62A 1HT2E 2FU8A 4LZLA 3L4BC 4D8UA 3U4GA 4UNIA 1FQKA 3GCGA 3HCDA 1S8OA 3MFYA 1IMOA 5EUMA 1VE1A 2WK1A 4G0QA 4BX2A 3W5IA 4EB0A 5JS8A 3N6VA 4RTMA 1RWVA 1MH9A 2J7PA 2Y6VA 4B8ZA 3TJRA 1RC0A 2LDXA 2Q1UA 4OB7A 3THYB 5SZJA 5EVDA 1PBTA 1QB8A 5DLQC 4WJKB 5KQGA 3KWMA 2GZ1A 2ACEA 5LQJA 3DO5A 1J0XO 4NC9A 4WZBE 3SWWA 5ENDA 4R1MA 4G41A 4R2HA 3ZW9A 4BQOA 4F9TA 5CCEA 4YJGA 1HKHA 2Z5FA 3SEQA 10MHA 4ZHQF 2PXAA 2OV1A 4FJ0A 4G65A 4H7IA 5AQEA 3H8VA 1YAHA 4R01A 5EERA 3K6SA 4OQFA 3E4DA 2VXCA 4O0MA 2XMBA 3TR0A 3EQ9A 3NU1A 4IICA 2H08A 3UBMA 1BSVA 4Y8VA 4O4LF 4CCSA 3L4JA 4EUKA 1SRQA 3CNQS 4YR9A 5K03A 4XWKA 5JNTA 1HUQA 3BVPA 4EARA 2B1IA 2GKOA 5I7WA 4HXEB 1W5TA 4EKEA 4MUHA 4A91A 3KSMA 3KPVA 4L5BA 5TC4A 5C80A 4YAKA 1E2FA 1D2GA 5ITVA 5ETJA 5I9LA 5I7UA 4HRAA 3SQOA 2CL6X 1Y63A 1O03A 2IL1A 4ZVUA 3CPEA 1P19A 2QRQA 3EVAA 1GOTA 3OJXA 2QM8A 4RMJA 2J3EA 4C89A 3DZJA 4PCUA 4FCWA 4MV1A 3BTSA 1QH9A 4Q18A 3VTFA 4YFYA 1US8A 4QUBA 1V11A 3N9IA 1YBHA 2VYND 5IBQA 5FA5A 3X2SA 3E0QA 2AN9A 2XYQA 5JAPA 5PGMA 2P0EA 5EZYF 1JP7A 1W4ZA 1THTA 1DAHA 4IHQA 4WCFB 1O2DA 3FJOA 4KHZA 1I7PA 2IPOA 1FYXA 4HQLA 3W1WA 3SNKA 4R2LA 4AWBA 1VHLA 1OH7A 4HAYA 4XWGA 3WB1A 4BB6A 1IM5A 1K6JA 4MNTA 2GN1A 1GIAA 2PR7A 1E6MA 1AT1A 3UXHA 1KRXA 4XCQA 3DT8A 4GKAA 4F5EA 4D45A 4BYGA 3CZPA 2NTEA 3GF4A 3Q7PA 1RQGA 1EI9A 1GPLA 3GA7A 1GFWA 2FZVA 3R5KA 4O59O 5EE1A 4EG3A 3GLVA 1QVWA 1Z25A 1RTKA 2XE7A 3PXDA 1XOIA 4DLYA 1U80A 1Z6ZA 1Z28A 2NTJA 2QTBA 3O03A 1STOA 3QVUA 3TI9A 3M4NA 4E13A 4EGFA 1V16A 4TV9B 3PFKA 5IC5A 4X20A 3ZDEA 1Z5GA 3GJSA 2AJDA 1GPNA 3NG1A 1PTJC 3KQSA 1IOLA 2JGNA 2F64A 4X41A 4DDWA 1U2GA 1T1SA 1KRHA 4GOLD 1TCVA 3V1NA 5E7JA 1CDOA 1SD1A 3D0OA 3K2BA 4MPDA 2ROQA 1TEZA 3EAQA 3CU5A 4XDHA 1R5JA 2HMYB 5EE0A 2FU9A 3VU9B 4BP0A 2OCYC 1E2MA 2HLDA 4LTNA 2WP8J 4HDOB 5A3RA 4Z1MA 3M3PA 1GZ4A 1IMJA 4I5EA 2P9BA 3C85A 1RM3A 2AOTA 3IT3A 4RZSA 4YJ2A 1AKTA 4N5IX 2BGIA 4IG4A 3OWXA 2C4WA 2ABWA 4FBGA 1CQIA 4GX0A 4N4AA 3ZWDA 4F3RA 3N59A 5M7EA 1U1IA 4J16C 1U99A 4QT0A 5CM9C 2UDPA 1NMEA 3JATB 5IDYA 1ZSYA 1J39A 3PUZA 1KZ1A 2I87A 5EIEA 3NP7A 1X8JA 3H11A 4ZHQA 13PKA 2Q5LA 1EFRA 2AOUA 4CV2A 3HI6A 4M1YA 2FRXA 1Y5IA 3ETJA 4BBZA 2VWHA 3IIKA 4H27A 5CM8B 2OFWA 1Z8HA 2YHAA 3CUEF 3KJGA 2G5TA 1XFAA 2X0DA 3SZLA 4AUEA 4F4UA 4ZYTA 3PTAA 4LVOA 4GT1A 3D1LA 5F78A 4ZC1A 1P60A 4N01A 3ZHBA 5KPJA 1OXKB 2ZBGA 3MUEA 3EEYA 4E1BA 4O2BF 2ZWMA 4CFYA 4ZGWA 2YWHA 4I6JA 4LCBA 5G0VA 1CS0A 3Q1LA 4RFLA 4DUPA 3HUFA 1O4VA 1VMDA 5ACWA 3ZCVA 1M34A 3A1NA 4MKXA 1C30A 2AI3A 3AC0A 4FKZA 3CRMA 3W2FA 3KOYA 4BQFA 1XQ6A 1LVUA 3IHLA 4F84A 5A5GA 4AECA 3QXXA 4BVJA 4J0QA 5A03A 4QDXA 1M5RA 1YQXA 1T26A 4OX9B 4ESVA 1UPCA 4TS3A 2ZR7A 1E3QA 1ZW6A 2XMDA 1FUKA 3JQ9A 1CEYA 1CRQA 1NN1A 3AERA 2NXAA 3G0IA 4I9NA 4X95A 2B9VA 1ZVMA 4LE1A 5ALLA 4BP8A 4EPWA 1Y8CA 4D3FA 1O77A 1R88A 1MUUA 3MS7A 1XX6A 3JD2A 3H5RA 3PX3A 4MA4A 4MB0A 1JIQA 2X19A 1RYDA 4P31A 3ZLVA 4Z7NB 1F6DA 3L1KA 2O06A 4HLCA 4NMXB 1T4CB 1DAKA 2XWPA 2J9RA 1UBCA 3K9HA 5JG7A 3UUGA 2BFDB 4EDHA 4J0DA 3ZKWA 3WNCA 1PZNA 1U7TA 4GGOA 4KN5A 4XLZA 2GARA 3GDFA 2N46A 1QRAA 3PPYA 5DI3A 1AKYA 1Z2AA 3FB1A 5JXGA 1QAOA 2NZXA 4OH1A 3DVAB 3LFTA 4D4IA 4G8DA 5EJIA 2ONKA 3WLTA 3WAKA 4ZJUA 2AX4A 1QLHA 2NSHA 1VP9A 4K88A 5DGXA 5KNCD 1Z4QA 5IARA 1Y8AA 3UXYA 2C5HA 4AM8A 2OR3A 2OHGA 3EE6A 1KC1A 3O3CA 3IXQA 5CW1A 2H8GA 3NCTA 4RUKA 2CXHA 2PLNA 2WYMC 5FTJA 2QTLA 4JP5A 4K6MA 5ESXA 3NCHA 3KJFA 4YCDA 1R6DA 2Q5OA 3GJQA 5F3WB 4CLOB 5IX8A 5LP6B 4RA6A 1AMUA 4RM3A 3T1VA 3D59A 1GKLA 1GPJA 3IERA 4QG7A 3CF6R 2IYOA 3S2YA 2RARA 4A5OA 4BTVA 4CR6A 1RABA 1RHRA 1XNJA 2Q6KA 3TYXA 1XPOA 5A4MS 3USCS 4E3ZA 1Z5OA 2KJQA 1S9HA 5DPXA 2ILTA 4C4XA 3LVZA 4YSBA 2FSPA 3ZE8A 4WJZA 2E55A 1KI4A 3FR7A 2G8NA 1SXJC 2XXAB 1D2HA 3DXXA 2NSYA 2NU7A 4NCJA 4A16A 4CLRA 3LF1A 4G9EA 4DPLA 5SZIA 1A82A 1AGNA 3GA5A 4XSGA 3N5KA 4A6XA 2GCOA 2OO5A 2WUEA 1PW7A 4G1MB 4TSFD 1WUHS 3NT4A 1XV5A 1EHIA 4N47A 3RRBA 4JL5A 4OQEA 1R4AA 1XYVA 1EUZA 1DG3A 2AN1A 2ORVA 3KKEA 4IMRA 4LYJA 2IGBA 4MRSA 4QUAA 3ZWCA 4C08A 4UEQA 2D5LA 3KJNA 5JSKA 4BO0A 1RDFA 3R3WA 5LQKA 1MLDA 2B2CA 3EDRA 1NNI1 4JLKA 1QGDA 3OH8A 1ZINA 1VSBA 4BIMA 1G2OA 3DEFA 3Q3GE 2LKDA 3OQBA 4D1WA 1ZCAA 4PZYA 1A8UA 1T0PA 2YJ3A 2BRUC 4YSLA 1P9NA 3UATA 5JCOC 5FQBA 5LCHA 2ANCA 2WJ4A 5C34B 2XUHA 5DZSA 1KE1A 3P2OA 1RI2A 3DO6A 2IV3A 1AQ6A 2RJOA 1NYQA 2PX2A 1IK4A 1ZEMA 5BRAA 1AKWA 4E1VA 3LL7A 4TWZA 4EI7A 4ZCMA 5JS7A 4S1TA 4KR6A 1A3CA 3GOQA 3UIEA 3LT4A 3KJXA 1NZFA 3M5WA 1JSCA 4MRVA 3UK2A 4B3DA 5L3VA 2WPNA 3QIVA 5EQDA 1F2DA 1Y8RA 2YS7A 2DC1A 3DULA 4CCYA 3B78A 3OOYA 2B8NA 4JU9A 3A04A 1C9NA 1ZNWA 1GILA 2DSNA 1RAAA 1E3WB 3L6CA 2P97A 3EPJA 3JVUA 1YDWA 2X8LA 1CY7A 4U0JA 1ISJA 1JN0A 1JEJA 3OE7D 4CFZA 2V6IA 3FN4A 4JENA 1UXOA 1XDBA 3I9NA