5A0VA

Catalysis and 5' end sensing by ribonuclease rnase j of the metallo- beta-lactamase family
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
454
structure length
454
Chain Sequence
SHPHPELGRPPALPKGGLRVTPLGGLGEIGRNMTVFEYGGRLLIVDCGVLFPEEEQPGIDLILPDFTSIRDRLDDIEGIVLTHGHEDHIGGVPFLLREKPDIPLIGSKLTLALIEAKLQEHRIRPYTLEVAEGHRERVGPFDCEFVAVNHSIPDALAVAIRTPAGMVVHTGDFKMDQLPLDGRLTDLHAFARLSEEGIDLLLADSTNAEVPGFVPPERDISNVLRQVFANARKRIIVASFASHVHRIQQILDAAHEYGRRVAFVGRSMVRNMGIARDLGYLKVPPGLVVDVKTLDDLPDSEVVLVCTGSQGEPMAALSRMANRDHQIRIVNGDTVILASSLIPGNENAVYRVINGLTRWGANVVHKGNAKVHVSGHASAGELLYFYNICRPKNLMPVHGEWRHLRANAELGALTGVPHDRIVIAEDGVVVDLVEGKAKITGKVQAGYVYVDGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE J
publication title Linkage of Catalysis and 5' End Recognition in Ribonuclease Rnase J
pubmed doi rcsb
source organism Streptomyces coelicolor a3(2)
molecule tags Hydrolase/rna
total genus 149
structure length 454
sequence length 454
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 5a0vA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5a0vA01
5EW0A 1JJEA 2NXAA 1QH5A 4GCWA 5A0VA 2M5CA 3I13A 1P9EA 4Z60A 4U4LA 3JXPA 3RPCA 5ACRA 4D1WA 3ZR9A 5AHRA 4AX1B 4EYFA 3VQZA 5FQAA 5K4NA 2NYPA 3FCZA 1ZNBA 4NQ2A 3IOGA 3IOFA 4D02A 2FM6A 3ZQ4A 1VJNA 3PG4A 2Y8AA 3FAIA 4RM5A 2CBNA 4FR7A 4FSBA 2ZWRA 3R2UA 4AX0B 3IE2A 4EYBA 2I7VA 2WRSA 4HKYA 2QEDA 2BFZB 2QJSA 2FU9A 2BR6A 3T3NA 4XWTA 4NQ4A 3I0VA 3T3OA 2M5DA 2P18A 4AWYB 2BC2A 1JT1A 1SMLA 5A87A 1HLKA 4EXSA 3WXCA 3KNSA 2FU6A 4D1VA 4C09A 3A4YA 5LSCA 4JO0A 2YNVA 4TZFA 2QDSA 4RAMA 5HH6A 4C1DA 2FU8A 2YZ3A 5LM6A 4KEQA 4RBSA 5B15A 4HL1A 4Z5ZA 4ZNBA 5AEBA 1K07A 2BGAA 4EYLA 4Z6XA 3AJ3A 5ACVA 1L9YA 2Q0IA 1BVTA 3SW3A 2A7MA 5EHTA 4NQ6A 3IDZA 1KR3A 4TZ9A 4C1HA 4GYUA 4TYTA 1Y44A 5EV6A 1XM8A 2R2DA 5EV8A 4TZBA 3DHAA 3X2XA 4D1TA 3F9OA 1WUOA 5EVBA 2BG8B 4CHLA 4RL0A 3I11A 2Q0JA 1X8HA 2P4ZA 2DKFA 3DHCA 3LVZA 3SFPA 4UA4A 5ACPA 4BZ3A 5HIQA 5FQBA 5DPXA 3Q6VA 5A5ZA 4UWOB 4B87A 5B1UA 2OHHA 2OHIA 3ZWFA 5AYAA 1DD6A 3SBLA 5ACUA 4YSKA 1E5DA 2FHXB 4XWWA 5LCAA 5LE1A 3X2ZA 4C1CA 1X8IA 3AF6A 1YCGA 3ZNBA 5K0WA 5FQCA 5LCFA 5B3RA 4LE6A 3PY5A 4RL2A 2I7XA 1BC2A 2GCUA 2E7YA 2YNTB 4BP0A 2ZO4A 1WRAA 4ZO2A 1WUPA 4V0HA 4PVOA 1M2XA 4C1FA 2FU7A 2Q9UA 2BFZA 4UWPB 4C1GA 2QINA 1DXKA 1VMEA 4NQ5A 4ZEJA 4Z5YA 2GMNA 3BC2A 1X8GA 3P2UA 1KO2A 4Z7RA 5HH4A 3IE1A 2BIBA 4XUKA 5ACSA 2GFJA 2NZEA 1A7TA 1MQOA 2UYXA 2WHGA 3T9MA 2XR1A 4KEPA 5EVKA 2QDTA 2P97A 2BG2A 2Y8BA 2BG7A 3TP9A 4UWRB 4O98A 4F6HA 1YCHA 5HIPA 1ZKPA 2YCBA 5AXOA 5AHOA 5HISA 1JJTA 4UBQA 3L6NA 2H6AA 3RKKA 5ACTA 3SRXA 2YNWA 3MD7A 2WYLA 4UWSB 3IEKA 1BMCA 5HH5A 3QH8A 2P1EA 4DILA 1WW1A 5ACXA 2YNUA 4P62A 3VPEA 4RAWA 1VGNA 1QH3A 2FK6A 4H0DA 2DOOA 3ESHA 4Z67A 5LMCA 5KIKA 2OHJA 5IQKA 3ADRA 3I14A 1YCFA 2BTNA 5K4MA 2AZ4A 4DIKA 3BK2A 4ZO3A 5EVDA 3KNRA 4TYFA 4J5HA 4D1UA 4WD6A 2YNVB 4TZEA 5ACQA 2VW8A 4AWZA 2BG8A 3RKJA 2BG6A 2NZFA 5A0TA 5ACWA 5LCHA 4EFZA 5LLDA 2WYMA 5EWAA 4YSBA 4AD9A 3SPUA 1KO3A 2BFLA 3DH8A 2XF4A 4C1EA 4GYQA 3IELA 4PVTA 3IE0A 3BV6A 4HL2A 1ZTCA 2Q42A 2ZZIA 2HB9A 3KL7A 2FHXA 3DHBA 3G1PA 4UAMA 5LS3A 2WYMC 1XTOA 2ZNBA 1A8TA 4FEKA 2Y87A 2GFKA 4EXYA 3X2YA 5EH9A 4F6ZA 5K4KA 4J5FA 3S0ZA 2BFKA 3PY6A 4YSLA 5AXRA 4EY2A 3I15A 3SD9A 3BK1A 2I7TA 1DDKA 2YNTA 5HIOA 5KILA 3X30A 3IEMA 3AF5A 2GKLA 2BMIA 3H3EA 2AIOA
chains in the Genus database with same CATH superfamily
1H05A 1QMPA 4NBKA 4EJSC 2ZJ7A 4FZJA 1FUIA 3LCCA 1U1CA 4CYMA 3A37A 3RK1A 3B60A 4AWYB 3IKJA 2V4UA 2AC4A 1SUWA 3O91A 3AFMA 4AURA 1MTZA 1IMOA 1CNEA 4PN3A 1GUYA 1T9DA 3PXEA 3VZQA 1EUQA 5DEOA 1VSBA 1P2SA 3SS8A 1XKLA 4AZSA 5K8TA 3GGSA 3NWPA 4TRMA 4BMCA 2B82A 4BQOA 1XNGA 1LY1A 1Y81A 1YXMA 2P91A 2WD9A 3LW8A 4IP0A 4YMUA 1X8XA 4BVEA 3H9UA 2BFFA 1SM4A 3FDJA 3H16A 4UE2A 1L5LA 2BBTA 4NS1A 2EAUA 5K1ZA 3R9KA 3ZE8A 4KVAA 1Y8CA 3WZMA 5AKLA 3LUHA 1ODFA 3I58A 3QFRA 4FQ7A 4QQFA 5F78A 1YR7A 2H2IA 4YY3B 4LFAB 2X58A 2ZRPA 1T5SA 3N3BC 4CLDA 3KQVA 2YN0A 3B1ZA 4IMPA 1Q19A 3MT8A 5ICSA 5IM4A 3R23A 2A0WA 1SNYA 3O2JA 2MU1A 4IG9A 4EL5A 2XJ9A 2ZB4A 4W8HA 3FAIA 1FU4A 2UVPA 2V5UA 3LUGA 4Q4AB 4TKUB 3NVAA 4C22A 2VYND 1HTBA 3VU9A 2FEMA 4JOSA 2QINA 2IBTA 2ZI9A 2H1RA 1JPJA 4E15A 2XMQA 4B6FA 2YDYA 1E4YA 1KS2A 1AE1A 4UQPA 3U9SA 3VTKA 3H05A 2FXVA 3GJSA 1FY2A 1Z68A 3GBSA 3F8WA 1PEDA 3MAJA 4D9JA 4DNOA 3R2UA 4RSRA 2XOEA 4JODA 1A4RA 1ZINA 1A5AB 1QPZA 2BYTA 1UMBA 2BELA 1RJ9B 5DXJA 1YZLA 1K6XA 1XRLA 1T5TA 4OEHA 5TDHA 3GIDA 3OX2A 3FOAA 3QI7A 4YP9A 1RRCA 3SOPA 4HRAA 4Q7QA 5SYNA 2J3QA 2GOYA 3DFZA 2P6OA 3GCDA 4XPZA 5CTAA 5LOVF 1RXVA 3L8CA 2R1ZA 2X1MA 3PI7A 3HJFA 4WZBA 5EIBD 5H16A 4RD4A 1FQWA 1OPXA 2WYVA 3TUIC 3FOEC 1WSAA 1X7WB 4RESA 5IKXA 1ZJWA 8ADHA 3R7DA 2CFIA 2AXEA 5G41A 1XZQA 2XECA 2ZG6A 4RE6A 1TZKA 5AKJA 1U5BA 4G26A 4ZKEA 3RBZA 3SCZA 4ES6A 5L45A 4DV5B 1F7UA 2A0FA 2YVUA 3C3AA 1NVAA 3JR3A 4UQLA 3A04A 1XXHE 1EWTA 3QMPA 5AQEA 1K63A 2FFJA 4JUCA 4Q7LA 2PIAA 5H81A 4FD3A 3TTYA 1QGDA 1XMVA 3U39A 1V8ZA 4G0ZA 1NL3A 1DX6A 1K7FB 2AG1A 1SBIA 2DHQA 3M4YA 1X1RA 4QSHA 5AM4A 1YB1A 5E6UA 1UXHA 4YI3A 3SYLA 3WK9A 5B1YA 3SQXA 2I4TA 3A9WA 2HU8A 2GGSA 5JSZB 2QXTA 4BNIA 2ZXFA 3LPAA 3VR6H 3WRWA 4DREA 3B1FA 3D6VA 4BP8A 5CFZA 2W58A 3WLKX 3K9HA 4Y3UA 2JLRA 4LGYA 3N5KA 2IH4A 3SIXA 1L4GA 4BASA 1F2DA 2VPYA 2XTAA 1OF1A 2E49A 1A88A 3AL2A 1CUFA 3OU6A 3P2EA 3GQBA 4HX2A 4B76A 2QPTA 1OBCA 1R6UA 4OHRA 1ZO8A 6NULA 3NV9A 4YAOA 5FBWB 1W0JD 2KBFA 3LGAA 3LQYA 3PUWA 3TTSA 4DDTA 1P80A 3MBOA 4BNZA 1KOFA 2QG4A 3K5WA 2C58A 2QDSA 3P26A 2JI7A 1M5RA 4OLHA 4JBGA 4RSGA 3N8DA 2J5BA 3SZRA 2V0CA 4EG7A 1R66A 2CD7A 3TXAA 2VP4A 4YAIA 3EH2A 1ZSYA 4RXMA 2OFFA 3WDSA 5BQPA 2EYQA 1VRVA 2C0QA 2WAAA 1XNJA 1NY5A 2RARA 1Z47A 4XD7A 3TR5A 4ITVA 2Z57A 4X62B 1NE7A 3HP4A 4C0QC 1WXGA 3JY6A 4K87A 1F6DA 4QAQA 3TZHA 1RQLA 4KX3A 3WWOA 4E70A 4GI2A 3ZWPA 7ADHA 2FQQA 4YMIA 1XD2B 3H9JA 3CBGA 4IH4A 2ZSEA 3ZK9A 4Z7NB 2OCYC 2ECFA 4U2EA 3IP3A 3BIFA 4Q3OA 1P9WA 5DLPA 3KCNA 5JTTA 3GRKA 2RH5A 5I9NA 3MUFA 3FPSA 1I7SB 1JG1A 4BN5A 2FCRA 4PO9A 3R6LA 1PHRA 1U8CB 3DGEC 3G0IA 1ZOPA 3STWA 4DLRA 2EERA 1BXRA 1KMNA 2XTJA 4HKTA 4IYRA 5K4GA 2AOTA 4KI0A 4TZ9A 4YUVA 5DBHX 1RCFA 2JGIA 4A6DA 1PUIA 3FYUB 3MWKA 3BFKA 3LDUA 3MTGA 2MDTA 5HX7A 5IT4A 4K6CA 4KUEA 5T6MA 2X9GA 3K9NA 1P1HA 4C1NA 2MSLA 5H9WA 3ROEA 4DIUA 5BSHA 1CS4C 3DT8A 1XQ6A 3AFHA 3N39C 1R64A 4PTLA 3HB4X 2B1IA 4UMFA 3KWJA 1A8SA 2QJFA 3EXHA 1WETA 3UATA 3NPMA 3EDCA 1CJKC 3FTFA 3PQCA 3RQSA 3R7WA 2ZYIA 4UNRA 2DPGA 5BMVB 1ECCA 5AXDA 1VJDA 2ZULA 1HDCA 4D1TA 5K0BA 5HF5A 3HPRA 1W9HA 3E84A 4ENWA 1XAIA 4JV5B 3IR6A 5JYCA 4Y9UA 1XTUA 1Q84A 4MKFA 5C7IO 3LY8A 3PLAE 2YXNA 5JV5A 3AEQB 3RNLA 2FCAA 1ESEA 4RJKA 4E6EA 1T3ZA 2CDBA 3BICA 3ETCA 4GMFA 5EMLA 2Z5FA 3DR5A 4MULA 821PA 4EY6A 3EGEA 1X7XB 2GAAA 3O38A 4Y18A 2O19A 4UA4A 4FYWA 4KGDA 1D4FA 3VKVA 4WK4B 3SFPA 4CMBA 4O63O 1JAYA 5FQBA 4F5WA 4D42A 3KOXA 2P6RA 1F17A 3CW2A 2PQ2A 4JQSA 5DDIP 4FYMA 3S7TA 2NSHA 3HJNA 5HJ5A 1VLLA 2W43A 1B16A 4LRQA 4CVNA 3N6XA 2R62A 4G0XA 1KP9A 2ODPA 4BJ6A 5KNCH 1XL1A 4AZ3B 3MILA 1I3CA 4L5JA 3VU0A 3AERB 2IP2A 1CZOA 5DN6D 5IDWA 2I2FA 2J3LA 1Y33E 2P68A 2XDAA 1BOOA 3A6FA 4AO7A 4BMVA 4AY5A 3L6UA 4JD5A 1DZ3A 4KXXA 1NQ5A 1RBMA 2QSUA 3UAZA 4B40A 3KT3A 4WKBA 4DJFC 2ZYTX 3JQGB 4TLDA 2KJQA 2BZGA 4DZRA 4DQDA 1TB4A 2Y1FA 4MV5A 1P3DA 4LZLA 5EI5A 4DIDA 2XSZA 2GF2A 2D7JA 1NHGA 1NZFA 2FUG6 2JL1A 4RK4A 4U02A 1PIWA 3IB3A 5LB4A 3RSFA 4GW3A 4DZTA 5G0VA 3D8TA 4PTZA 4ZTBA 4NEQA 1OYWA 2K2QB 5AK0A 2ES4A 4YUZA 5I7OA 5TVKA 3WGVA 1UP7A 2B4QA 4KBYA 5TQ0A 3P9CA 4DXDA 4GRDA 1M33A 4B46A 3VJKA 4ZIRB 2AFRA 1P1RA 3GDGA 3BGVA 1V5IA 3BVPA 4RMGA 3NVKI 1Q1BA 4OLFA 2C83A 4M9XA 1FJ2A 5PGMA 4ALJA 4X9XA 3EULA 2IUEA 3TUJC 5KWVA 4ZEWA 2P65A 1UMCB 4IDGA 4LBYA 2VPTA 5JW6A 5JXJA 1T36B 1CJTC 3H9CA 3NAMA 2DJIA 4MRSA 1CDDA 2Z8ZA 3E4CA 3VOTA 3O03A 4MQMA 2UKDA 2FN9A 5EIBC 4IJMA 4NXNB 1GTJ1 3O0DA 5EZ6B 2F59A 3WBBA 5AKEA 4RNDB 2FF5A 1UOEA 2PEZA 4J07A 1YOVA 5KAPA 1B8PA 1X19A 2CF6A 1QBGA 1P4AA 3QKWA 3ZHRA 5B64A 3ZN2A 2C4VA 2HQ1A 3EFOB 3BHJA 2ZRLA 3T7KA 1VHDA 3QGMA 4JL6A 5DIZA 4UCFA 2Q9UA 1VE5A 2YY7A 1QYDA 2NYAA 1JJFA 4US1R 2AEEA 4U63A 5I9BA 3Q9UA 1IZ8A 3T9AA 3TIVA 3ER6A 4JOQA 2AHRA 2PH5A 2GMNA 3LC2O 4AKGA 4UBJA 2HSGA 1Q7GA 1MO2A 4ACAA 3GRAA 2A9FA 2HRBA 1BRTA 1OXSC 3RKRA 1ST2A 1YS4A 2QU8A 1C9KA 2QQFA 4J1TC 4YLEA 4HAUA 3OTQA 4CNBA 2RKWA 2H3HA 3LC1O 1QHXA 4EUKA 4MQEB 4RFSA 1O0BA 1SVMA 3WGKA 1VPVA 4DPKA 1HETA 3FOFC 2GYUA 2YKGA 1GG2A 3A36A 4FNGA 2BKXA 4UBMA 4CF4A 1WHSB 4GM0A 4BAZA 2VP3A 2B0CA 3PEUA 1SUEA 4W5HA 1EX6A 3DAHA 4DJTA 2AC7A 3FIJA 1XNQB 2VHCA 5K6AA 2A0XA 3ILSA 4DIMA 3BORA 4WK2B 4A10A 4GOJA 4QVGA 2XBMA 3IQIX 4RGBA 2AJ8A 3E15A 5CB4B 3ADCA 5A06A 3D1JA 4H4EA 3GAMA 4GMDA 3VPGA 2YFKA 4R2LA 3SMVA 4HGZA 4F9GA 4OAOA 4P3NA 3RUEA 5EKDA 2JIZA 2IU3A 1Z4IA 4N12A 2D8AA 4PO8A 5BW6B 1YVPA 4KO3S 3OZWA 2RDMA 4HDNA 1RZ3A 3R6DA 1JJTA 3L6NA 2V7WA 1D6SA 4F6RB 2UYYA 5E3JA 3HUTA 5DN9A 1EDBA 4M0UA 3VR4D 3AP1A 4RHUA 2OKGA 3MEQA 4TV9B 3SRXA 2VUHB 1J5EB 1RYFA 3GDWA 4N41A 3MD7A 4V02A 4ZO8A 2PZEA 5CYPA 3WK7A 3ZY2A 4E1VA 2KB0A 3VKWA 2FN4A 1ULTA 3TOVA 3O4RA 4PYJA 3E3MA 2LIPA 1J09A 2YWXA 2WLTA 3P97A 4PS1A 5IM5A 3SZLA 1RRMA 4BC1A 5I3CA 1XSEA 3FMOB 2B7BA 1KHHA 1UXGA 1UM9A 1A04A 3FNBA 3HDGA 4CMEC 3IKLA 2Y67A 3IQFA 4DILA 1WW1A 1ZVQA 3OY2A 1IY9A 3NUGA 4XUDA 4YPOA 3BL8A 4ZAWA 3KQUA 4QODA 3JD2A 7MHTA 4PG7A 4BNJA 1RPNA 4QYWA 4BLRA 1UODA 1P2TA 1K86A 2JJ8A 3QE4A 1OLOA 2BM8A 1ZVVA 1MJHA 3N76A 3QUTA 3X1WA 5HZMA 2AFHB 4EPXA 4LVUA 3RSSA 3UQZA 5FCDA 1PJTA 3PQ3A 1CRLA 5KIKA 1R9MA 5LQRA 3PP8A 1A76A 5BMOA 4Q7JB 1BO6A 3R5HA 1Z7YA 4X5OA 4RQTA 3VPDA 1R0LA 1RJEA 1O3YA 3OIYA 4MXDA 3ADRA 4JR0A 3HNPA 3D6MA 2QN8A 3F5FA 2CHVA 2ODQA 4Q34A 4E7OA 5C8YF 1S3IA 4IIVA 4UPEA 1KKMA 3OECA 2AMYA 1Y6RA 1SK9A 2F9FA 1BHJA 3FKJA 4KO8A 5FL7A 3KELA 1F9AA 1TTHA 2HY7A 4HH1A 4MYUA 4YAFA 1ZR4A 4B3SB 2ZU6A 5IZCA 4Z86A 1RWWA 4R2JA 3CWQA 4RYDA 5CU7A 3EEBA 1CQXA 1ID1A 4XIFA 2P4QA 2PWZA 3AR2A 4OUKX 1IXZA 4OM8A 4M0EA 4G2TA 4V0OA 2CMDA 3FHLA 4NBWA 5C34B 3MWDA 3PFNA 4KQEA 2BGGA 2O48X 4BKOA 3GZJA 4M0KA 4IWYA 1Z5GA 4JB3A 4K1XA 2WHPB 4OL0A 1FYXA 4OU4A 1Y7TA 1CK4A 3K2IA 5ICEA 1KFKB 2JFHA 3FGOA 4NLLA 3UWKA 4J0EA 3NNNA 5CVJA 1EG7A 5T8KC 2Y1CA 3VHLB 3ESXA 3DHYA 2G17A 3VZBA 3LF1A 2EP8A 4DJEC 1QUFA 2F8MA 1U0RA 1VL2A 4DLBA 2PRSA 3W3ZB 4E33A 4YMLA 2CLLB 1LTQA 1V39A 3QXHA 2OBBA 5FNVF 4XUCA 3S28A 3SC2B 2F64A 4N40A 3DVSX 3D7SA 3PFKA 3RC1A 3VAZA 4CMJA 5CRIA 4RH0A 3LFHA 2ESRA 1JQBA 3IELA 3K2QA 1KHTA 1KY5A 3RGWS 2P9JA 5AUOB 1N5MA 1Q5PA 2ZJAA 4PGGA 4FMDB 3KVNA 3OZBA 1JZTA 1NC1A 3KHTA 4IZIA 4RIHA 2XYGA 2JVIA 3E9YA 2Q42A 2UDPA 1JQAA 3W0LB 4IL5A 1P8AA 4PAWA 3UTCA 2M5DA 2DFDA 5TEWA 1P7VA 1RZRD 3QKSA 4LZOA 1JI0A 1SIUA 5CEEA 3FR8A 1LNQA 1SU7A 2FHXA 2XUKA 1TF2A 2BFDB 5BWBA 1XZGA 4MKHA 4BV3A 4R2XA 4NK5A 3G1UA 4GKBA 4JQYA 4ENUA 3ZIUA 2DBYA 3FROA 1PF7E 2O8EA 1GRVA 3QV1A 2FRVA 1GRQA 2LPMA 2OLKA 3QU7A 1SXIA 4Z9AA 2PSJA 3LDHA 1CF2O 2BFBA 1QXSA 1U3TA 1JWLA 4RQBA 5DOZA 3C39A 4LZWA 1K7YA 1U9IA 2ZTLA 4PHTA 3UGTA 2F1JA 1T2NA 3FDIA 4EXYA 5FOXA 3I5UA 2C3YA 2JJ1D 2ECPA 3PQ5A 3SM9A 1TGVA 3HU1A 1XVUA 2QRQA 4U3JB 1RCTE 1JUDA 3RUIA 4YACA 4EYQA 5AKHA 4TYPA 2PX4A 4QA9A 4XDGA 3BMOA 3RR2A 4F8YA 3QTLA 2P2LA 2IP4A 4TWBA 4B47A 1CR6A 3LUAA 3CVXA 1C5KA 1HDXA 4H4CA 4AUNA 3GI1A 4NV3A 1Y8ZA 4IRUB 1UDBA 3VVCA 4YUYA 4ARVA 5IAAA 2P77A 2ZWVA 2PLNA 1O0SA 3N6RA 4NSNA 3FSRA 4X65B 3MPOA 4JS0A 3G5LA 1S9DA 3F0TA 3X30A 1I9CA 4P54A 5K6RA 3ZHYA 2XEXA 5K3BA 2GN2A 3KKPA 1J2RA 2BMIA 5EXXA 1ZIOA 1UANA 1AQUA 3NP9A 4CEHB 1FLVA 3RE1A 4CG1A 3DHBA 4K40A 4BFZA 2XT0A 5K3AA 1W7AA 4OFWA 1E3LA 4A6XA 2GUWA 2JAUA 2NXAA 2REXB 2FZGA 3QVUA 4GH5A 4C2TA 1HZZA 2CXPA 5BOSB 1HQDA 1V7ZA 2WPDD 3LYUA 3AIKA 3OOHA 3VR5H 4C7VA 3T1QA 1JKMA 1YQWA 2RGUA 3HZRA 4MR8B 3TSYA 3DM9B 2VZ9A 4GOOD 1DHTA 4N4AA 4AZTA 1DUSA 4LG1A 4LHSA 5ACRA 3DC2A 3KT0A 1UBUS 1C4XA 1DINA 2BRUC 3CINA 1P9NA 1G63A 4JGGA 4YB8A 2QPOA 3HCCA 2H59A 4FT2A 3HCDA 621PA 1GDTA 4PBSA 2Z5GA 4YCAA 3VYTB 1ODJA 4IJWA 4I7EA 4NWIA 4MUJA 3UT0A 1YS2X 4JNKA 2ZAYA 3OE7A 3AL3A 3VV2A 3NT4A 3ELUA 3DOHA 3L8ZA 3BF7A 3PFGA 3UWSA 3CRQA 2WV9A 1YZYA 3Q5EA 1S01A 3KSRA 2HCRA 2FP4A 3PUZA 2PT6A 1O94D 1T2CA 1HKHA 2H7CA 2PMCA 4TRNA 2ZYDA 3UWPA 2Y77A 3ZQ4A 4HNUA 1Y42X 3B1YA 4UU7A 4NX2A 4CL3A 5EHZA 1F8GA 4GP7A 4O4HB 3RFXA 1NR1A 3ZJ4A 1PZNA 4IGFA 4NENB 4R1NA 1ZN7A 4XOUA 4KAXA 3PKZA 2HA7A 4GOLD 5HQTA 3OOSA 3GLTA 4JC8A 1QPBA 4TL6A 4MHTA 5A04A 3DS8A 1Y3BE 2VAPA 1XAGA 2J4FA 1KY4A 3AB7A 3SD7A 3CEAA 5IZ4A 4UHBA 4JCCA 1GHTA 2E89A 5ALYA 3DD5A 3OM1A 4LJ7A 4D9EA 1DKQA 3KEOA 4TZ0A 1BA2A 1YRLA 3I9JA 3RTCA 3SDSA 2AYXA 1HT1E 4O02B 5EHIA 2C2GA 1JSZA 3FRHA 3TL3A 2C5EA 1H4TA 3BTVA 3DYVA 4IRXA 3T4EA 2ZXUA 4BX3A 1D2RA 5KOHB 1M3SA 3NT2A 1V95A 2HRCA 1AN9A 2WOOA 1NJ1A 2BKVA 3FWKA 3OMXA 5HEKA 1QG6A 4OP3A 5P21A 3TW6A 3JR7A 5I9LA 1MB9A 2QJSA 2CNBA 2FU9A 3T4PA 1IVNA 4MP3A 1CYEA 3AO0B 4OQZA 5FKJA 1QNLA 4YAKA 5C8VA 4FGJA 1LDYA 1J42A 4XWTA 1ZRNA 1KK0A 3BAZA 4G6ZA 4DRYA 1G5HA 5JZMA 2XCSB 4NQ4A 1NMZA 1X86B 1U65A 3S2GA 3G5AA 3FVRA 3CUKA 3TW0A 5AW2A 1EDDA 4TTTS 1KO8A 1SEVA 1U3WA 2ZI6A 1ZM7A 3KOWA 1UC9A 1GLVA 3RWMB 2BR4A 1EVZA 2JGFA 3DTYA 3HB7A 1I2AA 3K2BA 4BNDA 2IQIA 4LISA 2F3SA 3B3FA 5K3DA 3A1SA 4IIJF 1TKAA 1SA0A 5D86A 1UDXA 2XGMA 2VH1A 3LY9A 4O1HA 5CLHA 1X38A 2J9FA 5JAZA 5HNKA 3Q3JB 4L8VA 3HYNA 1KETA 5EIHA 2FW9A 4AZ0B 5AJXA 1P1KA 3KPJA 2ZI4A 2A59A 4WXEA 4E2WA 4TXNA 1ZUWA 3BCHA 2V7XA 1PG2A 3ROFA 2J1LA 4D9GA 1UQTA 1TK9A 3AUUA 4WK6A 4V03A 5AKZA 3TXYA 3VM6A 3VSDA 5AHWA 3V8PA 2XE6A 4ZC1A 4WVFA 4BIIA 1HV8A 4DXHA 3W5HA 3N7TA 2BEUA 3VH3A 4EY4A 2OGZA 4MB0A 2H4WA 1RHJA 4GQAA 2ZUSA 4M38A 1V6SA 5EWMA 3RRMA 4TN1A 3VZCA 1IHYA 3IPCA 4RVCA 3DLIA 3KLPX 4M49A 4P4NA 3NIBA 4EBBA 5I7VA 2YNMD 3WSVA 3PVSA 4LSGA 5BRJA 1XTQA 3FPBA 2ZIGA 1CQIA 5B15A 5F3RA 4F84A 3KB1A 5A9SB 4MW2A 1VIAA 1BDJA 3F7NA 3WADA 4EYLA 1RHKA 2DLDA 1XA3A 4GUDA 4AKHA 2W5UA 3UKJA 3DEFA 2H92A 4OK6A 3TNFA 1KAMA 2YS6A 2J9ZB 2FSUA 4MW1A 4UM9D 2HSDA 1QO0D 5CT9A 4QWMA 1LB1B 3ZE7A 4F96A 5EWJB 5TJ9A 2Y1EA 2KLBA 4D98A 4L6CA 3KZNA 2BP7A 2G0NA 3ISVA 3VMFA 4DANA 4I9FA 3VVMA 2GLXA 1XXHA 2SCUB 4NBVA 2E5LB 1WEKA 3QNMA 3K0AA 2A1UB 1QOPB 2WU0A 3QVGA 5CR9A 2MR6A 1OV4A 3IT1A 4ND5A 3NYRA 3G9XA 1BU5A 1U04A 4HNRA 1IPHA 4LN1A 4CKWA 1JT2A 1OWLA 1V3VA 3N0RA 1RWPA 4JFAA 3U2QA 4DOMA 1TFUA 5TPZA 10MHA 1GRRA 2IY9A 2JFGA 1WS6A 4DCGA 1REQB 4R9NA 5IT5A 3B3AA 5HZKA 3N8HA 1ZL2A 2WU1A 1X1BA 4S05A 1EWVA 1ZD9A 3V9AA 2IYZA 4YAJA 2EL7A 1PTJA 3IXQA 4A0GA 3BE6A 2EU8A 3Q8WA 3QX8A 5J40A 3V2IA 1TYAE 4E3ZA 4MV1A 4G5XA 3MMZA 4EKIA 3D3WB 3KL7A 2CK3A 4OYLA 1ZH0A 1S2IA 4QNNA 2D5CA 3KLBA 2BJVA 4IM7A 3JD3A 3SM3A 4YVFA 2OO7A 2WSSA 5JDIC 3F9OA 5EVBA 5FXMA 1EQAA 1EP9A 1T6ZA 3BN3A 4J75A 4OJTA 1ONOA 1VKJA 3TE6A 4F21A 4YAGA 1QQBA 4CTKA 1TKCA 2BGWA 4OSPA 1YFLA 5ALEA 1WM1A 3T5BA 2HJSA 3VAYA 3GLIB 4YJFA 1L7MA 1YH3A 2GCEA 1HI9A 3T8YA 4M0CA 1OX6A 5AICA 2F00A 4XQEA 4IVRA 3UYLA 3PX2A 1K7XB 3LUBA 4OIMA 5D3QA 4DS3A 2ATEA 1Y3IA 3HBLA 2JD1A 4O4JF 4IIFA 4QDXA 2J0VA 1GRNA 5PNTA 2HMYB 1SOAA 2ZZNA 2PXAA 3IO5A 4LRXA 3RAPR 1GFZA 1MZPA 1DX4A 1SCJA 4PC2A 1O9HA 4YAUA 1DEOA 1FRNA 1HRDA 3KBOA 2FW6A 3GBPA 2EF1A 1GGHA 4MV0A 2I6XA 5KYVA 4B87A 1H9AA 3S6JA 5ADHA 5LXTB 2DC1A 2UVQA 4REOA 2B0JA 2OHHA 4KWTA 1JBEA 3ENZA 3DBOB 5LNK1 2ZI7A 3FBWA 1KFCB 1DD6A 3B8EA 1BH2A 3C15C 1CUCA 2C4HA 1RT9A 2X6TA 3FMFA 3COZA 5HBRA 3SBLA 1G7SA 1IZYA 3P9PA 1HLPA 1B23P 2R85A 4CMCA 3TEMA 1UBHS 1ISSA 2FG5A 2NO6A 1DTSA 2NTVA 5I3ZA 2V3WA 4BQEA 4M1MA 3WAJA 1GL7A 1XA0A 3D0QA 4XKJA 2EX4A 1N1EA 4U7HA 5D2CA 4ZO4A 5K3CA 4BVKA 4BFLA 1GPKA 2ABWA 2PZFA 3BMXA 1YCGA 4Y1EA 4NCAA 2O5RA 3E1SA 2C4KA 3RREA 5C46F 2PT5A 4BWGA 1YR2A 4HDCA 3I01M 2V58A 2OFPA 3BDIA 1D6NA 3BMQB 4MW9A 3T3IA 1NXXA 2NXCA 1EFDN 3KKLA 3RC9A 3KZXA 3H04A 3R3JA 4OQEA 1QHIA 4RGYA 4OXXA 3VKFA 4PNHA 2WTBA 5HIJA 5C8DA 1XPJA 1ZK4A 2FMXA 2MWMA 2HDHA 5B4VA 1UM8A 1YGYA 3HCNA 1ZHOA 3L8FA 1C3OB 1ZGCA 5J2TA 2CJXA 4HAZA 4BNMA 1USGA 2DCMA 3A4TA 4FHZA 1UQRA 4BQPA 2ORWA 3LGXA 1TVEA 1X9HA 2ZTMA 3AF4A 1PWZA 3DTVA 4EFDA 4CMKA 1E9FA 1FXSA 5K8JB 1AGPA 3WJ1A 4CLXA 4MHOA 2YWFA 3GOHA 4RY2A 2CFSA 3I39X 4X85A 2AIRA 3JWJA 1GKLA 1Y4AE 4LSWA 4OXKA 1N9GB 4PFKA 4Q01A 1ZS9A 4XEHA 5K0GA 2Z3ZA 3ZDAA 1ZEMA 3R41A 3HTXA 1V8FA 1U2PA 2QV0A 5K5EA 1GNPA 3NTXA 2IH5A 4LX0A 1DXKA 2O07A 4Y6RA 1IQUA 1NY6A 5DT9A 2X23A 2FUCA 4DDWA 3JYOA 1E6UA 2GCGA 1TTTA 2HD4A 1R0CA 2OEPA 3E03A 3KHSA 1KH2A 1A9XB 4BBAA 1W4AA 2LP4Y 1BW9A 5CHEA 1T4MA 1YZFA 4M1KA 5F77A 4QPNA 1PV1A 1E2EA 3DAOA 4ANFA 5BVHB 2QRGA 1PVOA 3OPQA 2GFJA 4DWVA 4HTFB 2P9QA 3KOUA 1Z08A 1I7DA 1BE1A 2C2KA 1NNUA 1R18A 3WLRA 3ZWMA 3WFZA 4ZYUA 4KXFB 3OIDA 1PSDA 4KREA 2PMFA 5BYJA 2IZZA 2PSEA 4MRAA 4H7KA 4S0ZA 5DXFA 4DLYA 2LV8A 1TA0A 2AV6A 1WVIA 2VSNA 2CW5A 5ALWA 1GOTA 5EE3A 3ZWVA 3JTEA 1FBTA 1SVLA 1MEEA 3DQZA 1L7NA 5EVJA 1JLKA 2PD3A 1PR0A 4J0JA 3K6JA 3HABA 4GMKA 2PV7A 3PYXA 5AHOA 1SC3A 4G0UA 4NPAA 3QPDA 1FFWA 4KRGA 1XKXA 4O59O 4P5EA 4QFDA 4U6NA 1E99A 1H2FA 4B4WA 5IJZA 3RIMA 1EFTA 5F2OA 4F86A 5JNSA 3NGLA 4YRRA 1A77A 1YQ9A 1NQWA 1BHQ1 3WGIA 2ODAA 1BMCA 4EG5A 1E66A 3W8RA 3VR1A 3WGUA 4ID9A 2F8SA 2A7QA 2YZGA 1IBRA 4G5YA 2FZEA 1EFPB 2I3ZA 1QLWA 3KUKA 3LFUA 3MXTA 4FOOA 1DKOA 3G0DA 3HBAA 4G0OA 4HGQA 2W8BA 3MS7A 2QT9A 1U8EA 3U44B 3IVRA 4A8TA 3J81A 1X92A 1IOWA 2Y2VA 4UNSA 3IA2A 4OXYA 3T7EA 2OHGA 1KMQA 1L5OA 2YNUA 1L7RA 4AJNA 3R6WA 1GG8A 1UFOA 3LQ1A 4QDOA 1SD5A 3DWIA 3JQFC 3AOEC 1JQKA 2CF5A 1EVJA 1W2GA 4WCFB 4XGNA 3TRFA 1U2GA 1IB6A 5FUXA 5KJCA 3I9LA 3KVYA 2EX0A 4Q1VA 1PD0A 4RKYA 5LQNA 2FK6A 5K0LA 1V2HE 4RLSA 1C4WA 1L5HA 2ZGVA 4KU4A 3UAOA 5LU8A 2HWKA 3ZNQA 1G4HA 3ESHA 3V32A 2E48A 2E85A 4N0MA 5DNYB 5JY6A 3FCEA 3PXDA 2D1QA 4UZFA 1Z0JA 5EXPA 2INGX 3CWZA 3E05A 5KHOC 5HUQA 3L43A 1L5YA 1JLHA 3DE1X 4C78A 3H99A 3B5JA 3I14A 4RUKA 3WMXA 5EWLA 3O3OB 2JFBA 5B7QA 3IOEA 3EASA 4G5HA 4B84A 5SY6A 1NHWA 4F8EA 4O29A 4ZO3A 2XCRB 3L06A 3FPAA 2G1JA 1WZNA 2XTNA 4X1IB 4DIFA 3OQ1A 1P6XA 1R6AA 4J5HA 5KWIA 5FNVA 3EDMA 1L7OA 1X3LA 1CF4A 5AHKA 3W7BA 1R5JA 1ZVMA 3SS9X 2I4NA 3QEBZ 1U0NA 2GYVA 1YHZA 1QCDA 2C7OA 3NVDA 2HJGA 3DWFA 2VUIB 2QG6A 4MS4A 4J9UE 1QP4A 2FSFA 4WESB 1QVVA 2AKAB 4M88A 3CZPA 4C9BA 2W6ID 2IEYA 4WFQA 1GTSA 3CNQS 1Z5PA 3EDOA 2WC1A 3SQOA 3E4DA 5LZ8A 2QD3A 1HG0A 5L4NA 4D6PA 4EB3A 5C18A 3W90A 2XQJA 3IJEB 2AJLI 3J7TA 1M8KA 4R69A 3DE4X 2QNRA 5JU6A 3UWOA 2IZ6A 2OWDA 1QYVA 4LX8A 1BVHA 2PD6A 3ZE6A 1JSXA 1S2MA 1DDGA 2A58A 3DFUA 2V59A 3G59A 4LDNA 1UBCA 4XX0B 2FSGA 5EP1A 3N7UA 2DERA 3K9QO 4LHYA 1O8BA 4DCNA 1USIA 3IPXA 3LO5A 1JG3A 2Q4DA 3ESAA 4ZYLA 4HYQA 2XZOA 3TLMA 4D4JA 4BRZA 3VBCA 3DZDA 1U02A 4P3PA 1XHLA 3KQNA 1LDEA 2EBUA 2HDNB 3OJ0A 3OF3A 4OQFA 4DGSA 4OLBA 2YUTA 1YAHA 1C9EA 2ZT5A 1P19A 1HFEL 3BB3A 4UAMA 2WOJA 1Q0SA 2Y05A 1CX9B 1U8XX 4DDMA 3OWOA 5CA1A 1ORVA 5BSFA 1EDOA 1PWYE 2A1TR 2HA5A 3QFSA 2G1UA 3MFQA 4ZI2A 2VAWA 2R00A 3AVQA 1DIHA 5JYEA 3M0EA 4IQ0A 3DCJA 4M36A 1U3DA 2WWFA 1W6UA 2IEBA 2I1QA 3HWX1 1XDWA 1KQFA 2WHEA 2NX2A 3EFBA 4H16A 4MKXA 1CHNA 1UPUA 1YSCA 3CWCA 4X3PA 4BDSA 3BK7A 4KLAA 4MR9A 2B20A 1H2HA 2YC4C 2Z30A 3H1GA 1GGKA 3Q5DA 4YXWA 2XGJA 4KYVA 3UV6A 4C7KA 2CFOA 4Q4HB 4KE6A 4DKXA 1T9GR 2FY8A 4G07A 3ER8A 3HNOA 3IUPA 5A7FA 2VHZA 3TLZA 4QUDA 1IXRC 3WX0A 1SCQA 5D5PA 1KYVA 5H1YA 4ZEOA 4B6SA 1TLLA 1FYVA 1NNLA 3G8YA 3EMKA 3NB0A 5KINB 3KVRA 2XKBA 1M6HA 4GYWA 1N6OA 3KQYA 1RYMA 3JAWB 5LOVB 5FLXA 5IJAA 2CVFA 1OTYA 3PJGA 3DOJA 3ZX5A 2AIOA 3BFXA 3HEMA 1YR6A 1L5KA 4WK0B 2VP5A 2NZWA 1VYUA 4R5MA 4AKSA 2GKLA 4OXIA 4MI3A 1TQDA 2I2WA 2I3BA 3JCZA 3K0EA 1U8TA 5MHTA 2AFIE 2FK7A 2YY5A 3T1YB 3NAZA 1M2OA 2IHVA 1IAVA 3EWSA 4O2AB 3C45A 4L9WA 1QH5A 4D6XA 2C9MA 1NJ2A 5DCUA 2W48A 3NX4A 1P31A 3HNRA 1TFRA 4Q3EA 2JAOA 1EZZA 2QUJA 4KAAA 1E59A 4BNGA 3UUGA 4PZUA 1BCRA 1YMUA 2HC9A 1GT91 4LFCB 4LYFA 3TBFA 1A2OA 1CY6A 3DW1X 3VR2D 1T5IA 3GFSA 3GLSA 5EE9A 1T25A 1A8UA 3ESDA 3KQWA 3NIFB 2CV0A 4M87A 2BE7A 5AVOA 2OL4A 4EY7A 2R7AA 1WVGA 3B1JA 3ND6A 2HDWA 4G1BA 3COPA 4JI7B 2J9GA 1G4UR 4NNPA 4EDHA 3PTAA 1R8YA 5D8DA 1NW3A 3AUXA 3TLGB 3HDQA 3TDNA 3P4UA 2V54A 4B73A 3AHFA 4KHZA 4G0VA 4G4SP 4LI3X 1NXPA 3WL8A 1D0SA 4HNAB 3ZW7A 3KK0A 3WGGA 2GR9A 5ITZB 2WBLC 1YS6A 3OESA 3M5WA 5FTJA 4ZT4A 4EZIA 5CLIA 4YEDA 3IODA 5DBIA 5FF9A 4DLSA 2FM6A 4EF6A 2IXGA 3PG4A 1D6JA 1LA2A 1T9AA 5DHTA 4RX1A 2VDNB 5FNZA 2FG6C 5FFFA 4YYZA 3ESYA 4AFNA 3AR8A 1E96A 2XWJI 3A7EA 4LHXA 4D57A 4EJ2A 3LUKA 3QPWA 1GAEO 4Y6GB 3TB4A 1HDYA 3GAFA 2R7LA 3R0ZA 2XQKA 1GAXA 5KYKA 2FN8A 1I7QB 1P0IA 4H17A 4JP1A 2OV6A 3E35A 1O96A 3IE2A 5I45A 2XGOA 1DIBA 3DUFB 5GADl 1YKFA 3T4XA 3EVEA 121PA 3QVKA 4OHPA 5CP8A 3K6KA 1LUAA 1DO2A 4K8OA 3ZLVA 1YDEA 1COZA 3NUQA 1CE8A 2GRUA 1MC4A 3ZU6A 3SLKA 5FAXA 5FPSA 4AX4A 1G2QA 4BC0A 4ENPA 5LYJF 4W99A 1R3DA 1FX1A 2WRZA 3OBIA 3K0HA 5B6PA 3KYDA 3TPZA 5HFNA 2EKLA 4IIJA 4S2EA 1AK9A 3HY4A 5JS7A 2NQTA 3HKDA 1GO2A 3PUVA 4XJVA 2QRPA 4CETA 1H6CA 1QFZA 4FP9A 4ZVKA 3UHOA 4E1BA 2IV2X 5GIPE 1EX9A 1PJ4A 1A7UA 2OO3A 3H7IA 4EMUA 3GBVA 4HWGA 4QDTA 4WDQA 2GBLA 4MGEA 2VTDA 5A02A 2WNSA 5EIWA 4HLNA 3TRIA 2WB4A 2GEKA 1QBKC 1AQJA 3KWFA 4FYJA 1ZVKA 1GZ7A 2GZMA 1A7AA 4BQNA 5HFJA 3HM2A 1BGVA 4GIBA 4ILKA 4RZUA 1L0BA 5B3LA 1CQJB 3UF0A 1KYZA 2FZWA 1BWRA 2XF2A 2JCGA 1WD5A 3EAFA 1Z0FA 4KK4A 4LHEA 4UCXA 3SEFA 1E0SA 2WPNA 3KUXA 1KQPA 2JFZA 2XT6A 3AI7A 3HR4A 3ISJA 3G5UA 2N42A 4BP3A 4CIWA 4NAHA 4ZVOA 3CBQA 4DABA 1EFRD 4POOA 3MD9A 3A4YA 3IEXA 4LDJA 1JFRA 1KXZA 3S99A 2NTNA 3TUZC 3H6KA 2QRZA 3H11A 4WT7A 3GD7A 1VE9A 2D74A 2FETA 5ICCA 5HS6A 3WA7A 2ZQ5A 3TW4A 1LJLA 3SE7A 2NZYA 5M5BA 3JU3A 4WXYB 3M6FA 2GD1O 2II6A 3F78A 1U0BB 3K32A 1YTUA 5HUJA 4HRYA 4ZVVA 2B2CA 2W6QA 1ST3A 2WIBA 1QIDA 2BUCA 5LM6A 2UZ3A 4FDUA 4MVJG 4J0DA 2IOFK 1FUKA 4JA2A 1RWMA 4R1LA 2NU8B 4HT3B 1WHTA 2ZBUA 1C8KA 1S4QA 2XI4A 1IXSB 3D0RA 4JI2B 1TC1A 3NDPA 3E9DA 1GNRA 3JVDA 3P2YA 4LBVA 1RXCA 4PIPA 4YJFB 3R7FA 4F71A 1D2HA 2O0HA 1IY2A 3D7NA 2OBLA 5ALKA 3I9MA 5HCNA 4HO1X 5CJ2A 2Q0IA 1WDTA 4B0OA 4Y0AA 2GF0A 3NC0C 5J2UB 4G84A 4KXQA 4K3UA 2GZ2A 2G7ZA 1PJAA 2BPOA 2VEDA 4YT5A 3V00A 4NQ6A 4OFZA 2X86A 3LRTA 4PGHA 2D2IA 2NLOA 2CCGA 2PUHA 1C14A 3A3OA 1Y4DE 3ZU4A 4EATA 2PGAA 2ZPTX 4B2PA 1F1JA 3GV0A 4JROA 4GPBA 1NQVA 2PS1A 2GD2A 4EI7A 2WP0A 4HGYA 5F5LA 1D03A 4CHGA 4TYTA 5AXCA 5AMXA 1I6MA 2B7CA 2E0IA 2HCBA 1RE0A 4BMXA 1FUYB 2O05A 4U7FA 1DAIA 4O4JA 5EV8A 2P9HA 1S3SA 3C3WA 1N1DA 2QXUA 4X1KB 2AD5A 4HMOA 3ILHA 5AVYA 4JK3A 3U7EB 3BXFA 1NW5A 3DT9A 1UWKA 3KZOA 4TGLA 3TMKA 2QTTA 4BLWA 3LH5A 4MMXB 3QBDA 5AI4A 3B6KA 1PGPA 5BPHA 1Q92A 1V1RB 2MMCA 3EVBA 1ECGA 1QB8A 1QLHA 1RLJA 4B74A 3DLPX 2OCXA 1KNXA 1SVWA 3O9MA 4NI5A 4Y0VA 1YMQA 3OE4A 3WTBA 3SY8A 4BX2A 5CA0F 3LVZA 2IT1A 3HEBA 4UUOA 4DADA 5JAIA 3RC2A 1KPIA 2QTLA 4WUTA 1E6LA 4MS1B 5FBRB 2IITA 3AGPA 3WLSA 3RYCB 4C7OA 3GRPA 2GWHA 4LYHA 3T9DA 1TVMA 3D2AA 4OOEA 5FEUA 5B1EA 3PUKA 3DL7A 3M8KA 3ZIDA 4UW9A 4X7RA 3U49A 2XYPA 1KH3A 2X76A 1JAHA 3I83A 5FV4A 1IBMB 3MJEA 2XBUA 5BYBA 3BHIA 5CLFA 4EB6B 2WYUA 3K9GA 1EM8B 1G7CA 1FSFA 1I4TD 2I6QA 2VP2A 5EQJB 1VHLA 5FP0A 4C2AA 2OHIA 4CV2A 4ZMSA 1PE0A 2YXEA 3FUVA 3BXZA 3TVYA 3UY4A 5A9TA 4UU8A 4TKZA 4CM9A 2FR8A 1DJMA 3GP8A 3G0CA 4OHZA 5ACUA 3OFND 2E5FA 5FTNA 3K1ZA 2I33A 4E11A 5I4BA 3HJHA 2HXGA 3PC4A 1JPUA 3PVZA 2VJQA 3JATA 1OFTA 1KMHA 2WMDA 2ZSJA 1WR8A 3B78A 3GRVA 1BMQA 3RUCA 2GVNA 3GVHA 3Q3EA 1FLNA 2WZQA 4IDHA 3JQ8A 4WLVA 1AQYA 5JZSA 5JI2E 2Z1MA 4KO1S 3IEPA 1E2LA 1HBJA 5GZ3A 5ALXA 5E2BA 2WYMC 2G9NA 5ES4B 2ZCJA 3BRWD 3Q11A 3PXUA 5JCPA 3E48A 4QTZA 1AO3A 3PC6A 1AY0A 2HJHA 3LGSA 4HNGA 3RVSA 3QP9A 3MG9A 4M1QA 4IKOA 3SHFA 3SVTA 4PXSA 2R8XA 1DG1G 2QRHA 3PY5A 3I9NA 3JZDA 2HA4A 4K3VA 1YR8A 1OGJA 2J07A 2I55A 4KXLA 1Z82A 2WT8A 3NBYC 4QRIA 4D82A 1QM5A 6LDHA 2WVJA 4AJJA 3LCRA 3WJ7A 5DK6A 5LA6A 2AMJA 3ZV6A 3VX4A 2Q0XA 1PR1A 3HV0A 4JBWA 2IWHA 1VBKA 3C87A 2JCSA 1R4AA 2C5LA 4JOCA 3RKSA 3RS5A 8GPBA 3V2GA 4ZJZA 3CF0A 5GIOE 1LZKA 4NV0A 2MMGA 1IOZA 1E4EB 2AR0A 3PDUA 4MV4A 4ZO2A 1QH1A 4DUGD 2QM8A 5FUWA 3RF6A 5F98A 3EA5A 2EGUA 4Q3NA 2I9PA 1UAAA 2BFCA 4YMSA 3SF8B 2J08A 3ORSA 1ACLA 1H6DA 4HQLA 2OM6A 2G9RA 4ZHQB 1NAIA 4IQGA 3K0FB 2H2HA 2DTEA 1PGOA 4C08A 5C35A 3ZWKA 3RHZA 4RD6A 3UIEA 1TUBA 1LSSA 3JAKB 1U6KA 2CZCA 2EKDA 3H2GA 4GVXA 2XZTA 1UEJA 1C9MA 1SFRA 4Y2QA 1OZ0A 2XNCA 5SZIA 4LXXA 2VUSA 3H5NA 2C8KA 1ZK2A 2H00A 4K46A 5AVSA 2B69A 1SOMA 1T0HB 2Q49A 1W5AA 3EODA 5HF6A 4ILEA 4E2FA 5LIPA 2YUIA 4D74A 3D54D 4YP0A 1QV7A 1V3TA 3IAAA 3M9LA 4N8DA 1BHSA 5C8YB 2ACKA 4QU0A 3V4FA 5DV9A 1UEXC 2WD7A 3C3JA 4FNAA 4GZ3A 1ZXBA 2JVJA 2FGJA 4FVTA 1JQDA 2F1IA 4WVLA 5FV7A 2FRXA 3DQQA 4BXOB 4TTIA 4MUXA 1I3LA 2HTEA 4OQQA 5B4UA 2HOQA 1XTSA 2D4AA 2R47A 4B7XA 1IDN1 4I66A 3BT7A 4QTTB 2JFOA 3BE8A 3OC0A 5IUJC 3K05A 4PXAA 4TLAA 5EE1A 3UUFA 1HLGA 3I6QA 1T4BA 2WYOA 2EHJA 1L6RA 1OBOA 4G0QA 5FBHA 3NOVA 1LPOA 1K75A 2QIPA 3FTNA 4H15A 1J70A 1W47A 5BWOA 4OX9B 1ACMA 5A6SA 2CNOA 4QJIA 5JCOC 1R15A 2ID8A 3DMPA 3GDOA 4WXMA 1ISFA 1MC5A 3F7OA 1P8JA 4Q16A 3HADA 2PBRA 1DE0A 2ZIUB 2R1VA 3GEHA 4KXUA 4ZK6A 3SBXA 5ACTA 1W0KA 3A25A 2OZVA 3FUWA 1RACA 3KL4A 2G70A 3OM0A 1NBOA 4R9VA 1HM5A 1U7DA 4HDMB 2CDNA 3RAJA 2C2OA 3JRXA 1GUDA 2AQ8A 4IXNA 4KIGA 2JFQA 4F12A 3IESA 2H5EA 5KNDD 1X3SA 1K6EA 3KQTA 3ROPA 3JPWA 3OIUA 3UPTA 3DHNA 1XRSB 3AXTA 3MIZA 4XAQA 2JRCA 2OCPA 5AD1A 4W5WA 1AHHA 1UBSB 4G25A 3C5HA 4HLCA 2YQ5A 4EECA 1Z6GA 3TMAA 4HS4A 2HJRA 1W0CA 2YWDA 1B8OA 4ARIA 1TUGA 3G0GA 4DLPA 2CXOA 2XRMA 2M1XA 4EAAA 5EZQA 1DDOA 1M2VA 3BD9A 2NT4A 4OGKA 2C4NA 5LQUA 4YT4A 1KI6A 4JEUA 5EYPA 1A8QA 3F5QA 3ZGZA 2I99A 4CL8A 1XZIA 3D4BA 5E7QA 1J97A 2HU5A 2Z1NA 3IOMA 2XZLA 3KVVA 3LQQA 4FE4A 4EMSA 3Q2IA 2OHJA 2OB1A 3BRCA 3F7TA 2R65A 1ZNQO 5GOTA 2XUAA 5G4LA 3CONA 3UTDA 1XNRB 2IYPA 2BHRA 2G6TA 1Y1RA 3X1JA 3ETGA 2BKUA 2ZRQA 4UNIA 4RDCA 2W2VA 4D8YA 1CXZA 1T9BA 2A9PA 2BM9A 3QPAA 4NJMA 2D7CA 3D7MA 4OHUA 4DCUA 4JXXA 2EHDA 1DKLA 1J20A 1TMKA 2BSQA 3BCRA 4HFNA 5KBYA 4BTLA 3KQLA 2OBFA 2XV1A 2VXBA 3EZ6A 3PGKA 1ZITA 1BDHA 4DFDA 2P90A 2CYBA 1WMEA 2QY9A 2RGGA 2VRCD 3A6HA 3QW4B 5TXGA 1ESZA 3RH0A 1G6OA 3SR3A 1RWNA 3O7MA 1EUCB 1KEEB 4GPAA 3LBFA 4NMXB 3VVLA 2VW8A 1NMEA 3PGXA 2XWBF 1C7IA 5L4SA 3GMSA 4MUAA 3BFPA 2C8LA 2J30A 1VCOA 4TVKA 2ZRBA 1PJZA 3LE8A 4E5PA 1NUSA 1VB3A 1HEIA 2G0TA 4HQKA 4TL9A 1V8BA 2NZFA 2GAFA 3KR0A 5A0TA 1WQ1R 2NU7A 4P3XA 1KO4A 3JQCA 2PZMA 3IUJA 1AB5A 2EJTA 2NMVA 5ALSA 1GGMA 5FBQB 5JMOA 1IC6A 5E7IA 3BA6A 1J2TA 1NUAA 4EITA 5HVNA 4PVTA 2NU9A 3IQXA 4LNHA 2CL6X 1FFYA 4HL2A 2VWGA 3EVTA 4YR7A 1XQ9A 3TE7A 3LECA 4CM6A 2JZOA 1VIMA 3QWHA 5I4IA 2CLSA 3CC8A 2FSVA 2ZZIA 3OD1A 1J07A 2M9MA 1UKAA 3BSWA 4IIXA 4H3KB 4CDNA 1XMJA 1TM2A 1HKUA 1SU6A 1DS6A 1UKCA 1V35A 3TH5A 2X5NA 3CS3A 3RVLA 5HUHA 1E8NA 3WNDA 4UOQA 1N36B 1GGFA 4LOLA 2AOUB 4W5QA 3ECCA 4H3HB 3VNBA 3CXUA 3LXRA 3NHSA 2Y3IA 4XDHA 5LPNA 4BWFB 3WYBA 2D2FA 1XTOA 4Z99A 1N2HA 1RHUA 1LBTA 3ADPA 3JWHA 5BR7A 5JRDS 5JG7A 2E3JA 4PTYA 2TYSB 4ZAFA 1KI9A 5JLAA 4K86A 4BFCA 4CFZA 1DTEA 5AOBA 2XA2A 1H2BA 4DV3B 3UBTA 2EWWA 2RKBA 2Y71A 5T5QA 2X9QA 2CCKA 4CTMA 1FNSA 5A9RA 1W34A 4YROA 5DGHA 5K4KA 2WF9A 3JXPA 3LV8A 2VSXA 5FA5A 4Y2SA 3TQQA 4ALNA 4AZVA 1OH8A 4XGRA 3LKDA 2B2XA 1SCIA 1Z4MA 1PNQA 1X80A 3KAKA 5EHGA 5FFMA 1RMYA 4C21A 5DLDA 3ZI4A 3UOGA 1FVOA 3FKSA 2V7VA 3AHJA 4X1OA 4EG6A 1NJGA 4BNWA 2BGUA 1I4OA 5JHHB 3ANTA 4HXGA 2ILVA 1B8VA 2IEDA 4YRNA 2HX1A 4I3GA 3IBGA 1CUDA 1EPUA 2WHRA 4I19A 1K97A 4IIYA 4PONA 3ZHCA 1H1LA 3SIRA 3QELB 3DEKA 4PPFA 1RKVA 1SELA 2F3TA 3KQOA 2GAJA 3O3NB 3NKVA 4Y6SA 4XB2A 2CDRA 3I2YX 1FW6A 4H7HA 4S12A 3NW9A 4BO1A 1L8LA 3FSGA 3JPYA 2I29A 2CVOA 3RLIA 3Q7TA 1H2WA 2HB6A 4P82A 3LD9A 4DIEA 5A0VA 1CUIA 1UQUA 4J6EA 1I3MA 1CUZA 3I30X 4F9TA 1EJ6A 2QP9X 4CEIA 1WZUA 3I9OA 2XUHA 4OF4A 3I13A 3L8GA 1JFTA 5FPPA 4Y2YA 1NUUA 2HA6A 2QQGA 3O1IC 3JRWA 2NOAA 2WJ6A 2AZTA 4P0TA 4Q12A 5KI6A 4AC9A 4UOZA 1XLTA 1H94A 3BMNB 5BY2A 3TOZA 3BGSA 4MJ7A 1AT1A 1TQ8A 4BU1A 3A1TA 1TI7A 3H4MA 4EFLA 2XH8A 3ND8A 2XB9A 4I5DA 4J7AA 4AX1B 5CIYA 2QSYA 3VQZA 1AF7A 1UIRA 2C1XA 6REQB 1V5WA 2QWXA 1YDWA 1PLKA 1Q3TA 1DB3A 2JF0A 4O2BF 1PW7A 3PL5A 3BWCA 5IJ9A 3CNOA 1TJNA 4MR7B 3EEQA 1AO0A 2A1TS 3QVXA 3V8VA 5L95A 2O7NA 3GLGB 3KUUA 2ZUUA 5AR1A 1PR4A 3E22B 4XARA 2IGBA 2I22A 3MCZA 1RYBA 2F3PA 5CB6A 1TQ2A 3CRNA 3ZCUA 2NVOA 2ZE5A 5GJWC 1P33A 1TO2E 2NM0A 2OORC 3TTXA 3UANA 4D79A 2X4LA 2HU2A 3D3NA 4HN2A 3I0ZA 2Q07A 2YTZA 1E92A 1PBTA 2GS9A 1MX5A 1JIUA 2Y99A 3ZQ6A 2R86A 2X9LA 4FU0A 4XOIA 1RWVA 2XMSA 4BATA 2VYNA 1JZSA 4E21A 1EFVA 3TFOA 1KPHA 4GS5A 5CDTA 1JS1X 2WKRA 1NC3A 1OJLA 4CMIA 1Y5NA 3D2LA 4RETA 3ZV4A 3DL0A 3ZNPA 3JSAA 1JKFA 1T24A 5IW8A 5K8IA 1QR6A 1GEGA 5F35A 5JH7B 4KYTA 2AFIA 3U9TA 2EATA 3HUFA 2D5BA 1ZD4A 2JBAB 4DR6B 1SG6A 2QS9A 1GPDG 1QE0A 4LS3A 1VJ1A 1XMQB 3QHPA 2PJDA 1EP2B 5HIKA 1NJ8A 1W29A 4NE2A 3H8VA 4D9HA 1H1TA 1SCAA 3MT0A 2BR6A 1ATIA 1KMMA 2ZUBA 1TJ3A 1IHOA 3GRYA 3L01A 1T2FA 3IUQA 4M0DA 5FA6A 2ETXA 2PNFA 2EDAA 1GA6A 5F1YA 2P18A 2ANCA 4HYEA 5ALIA 3T5MA 1ISMA 1AMNA 4KLRA 3C7TA 2OGUA 4CEJB 4E5DA 3JQEA 4PPGA 5ADVA 1W5FA 4OY3A 3LBIA 2EC5A 5IRCD 1CVLA 3IUSA 3KJZA 5FEMA 4EPRA 1KI3A 1NOKA 1X1AA 5ESWA 5KAMA 4EXSA 1MO4A 3R5FA 4JP3A 3L4JA 1HYHA 4FYKA 3HUEA 2Y1OA 1EWYA 1EE2A 2B6NA 2RG1A 1WMFA 1QR2A 2V7UA 4HF7A 1R0YA 2VBFA 2Q3CA 1XEFA 2X7XA 3RHTA 3RM3A 1BEZA 4C09A 3GLVA 2AN1A 1EHIA 3G8BA 3ZW8A 1JIQA 2DPMA 4J1TA 4Z7QB 3EOZA 2V9ZA 3EBPA 4KH0A 2X0FA 4JO0A 2GJ4A 4HFJA 4DV0B 3UJ9A 1H8ED 3BCUA 1U9JA 2QSJA 4DEYA 3PNVA 2G76A 2Y1GA 2QY6A 1F2VA 1VL5A 2I5PO 2HSJA 2IEIA 3HP7A 3RWOA 1XJCA 2ZJZA 3UT5A 1SR8A 1SC4A 5FOSA 4GI1A 4RAMA 3CLSC 1XDSA 3HKCA 4O3FA 2ZQZA 3VSCA 2WIGA 3D5EA 1SUDA 1UDWA 2GXQA 2QT0A 2MSKA 4IILA 5C1BA 5TQVA 3T38A 4EDFA 3DBLA 5AW7A 5AW4A 1JW9B 2NQ2C 3A6PC 2V6GA 1NDHA 1ODCA 4EH1A 3E23A 5ITSA 1K7CA 3SYTA 1PYOA 5FUMA 2XWSA 1Y1PA 1VKNA 4OTZA 4JVOA 5HR5A 5IK2D 1MJNA 3PE3A 5FLKA 1OFUX 3ZZ0A 3AM3A 5IVKA 4DE5A 1P2UA 2C7GA 3THYB 5DK4A 1UJ2A 2NNWB 3IP6A 3F47A 3MT9A 1BCSA 4TV8B 3WGYA 1DQZA 5TLSA 2J3HA 4G01B 3VJLA 2YR0A 1ZCFA 1XE3A 1PS8A 2C7VA 2RIPA 2WF7A 2QEQA 4LZAA 2DR2A 1DKMA 3EXIA 2G9VA 2Q4OA 4MUGA 4C2UA 1T6NA 5ALLA 4Y98A 1JDSA 3ZV5A 3GRFA 1RJFA 1R9NA 2Z95A 2ZBFA 3RFTA 1TAQA 1P9RA 3W8NA 2A6PA 2WU4A 1ODLA 2ZRGA 5FA8A 1I4DD 3PHIA 4WLNA 1E6EA 5BR1A 2REOA 3EUWA 1HO3A 4L0CA 4NCHA 1EU1A 2IOHA 2L2QA 5T57A 4F1JA 4Q9NA 5T4HA 2G9ZA 3KJIA 2R97A 5HKOA 1GILA 3TFWA 4C6TB 4DBZA 1Y80A 3I0MA 1PR6A 3A1NA 1Q7TA 3GFTA 4MQUA 2JGRA 4RORA 4EGSA 4BX8A 4BFWA 2Q1SA 4GLJA 4M46A 5EJMA 5E9WA 2E82A 2WUVA 3I11A 3PFHA 1JECA 1PK7A 1H5QA 2DM6A 5KYWA 1NR5A 3DOEA 3IDQA 2QX9A 3NEPX 2VDUE 3B9PA 4PZ9A 2X3UA 3PC8C 5ER6A 3C3EA 3PJDA 3DT6A 3N53A 1Q3HA 1XVLA 3S1AA 1Z6TA 2V6BA 2BSAA 4YXFA 3VV3A 4BVLA 4F7WA 1JLSA 4J1SA 1HNWB 2H85A 1LK7A 3WYAA 5DPXA 1PT8A 3FSEA 2HIGA 4ATNA 2KW5A 1L3BA 4I8IA 2C03A 2DUJA 3L5KA 3SNHA 3VTFA 4CWAA 1MCZA 2XMDA 4BV8A 2TMGA 4UWOB 2PUVA 4CM7A 2JHAA 2FFQA 4GOND 2FA9A 4TM7A 3ND7A 2B6HA 1SPXA 1TW2A 1DIAA 2BMVA 1LPBB 1RABA 2IYVA 2MYTA 2ZWOA 4D99A 5JOQA 3D8NA 2XAAA 1G64A 4P0PB 4GXRA 1A72A 1SVKA 2HPHA 2P6PA 3GUZA 4A91A 5CVTA 4O1MA 5DEIA 3E82A 2EP7A 3OUTA 3VOSA 2QE7D 2BEKA 1HMYA 3L79A 4YRTA 3ZHBA 1I6KA 3M6VA 5JSUA 1G21B 5HWSA 4W9RA 2X0NA 5DN6A 3W2FA 3M49A 4X95A 4CG0A 3P9SA 3L49A 4KVZA 2GQ0A 2W90A 3I23A 2IGTA 1F9EA 4YV0A 1P45A 3P19A 3VR5D 1R0XA 2PZGA 2NPOA 4RD1A 1CLEA 5IVPA 1JB1A 1H23A 1Q6ZA 4NZMA 4R2MA 5ALRA 1NQUA 3JW8A 4FMCB 2IX3A 5K0WA 1YWGO 5EXEA 5K8LA 3AOGA 1HE8B 5J5AA 1YQQA 1KYIA 5BW4A 2RGAA 1DBQA 2D8MA 3OM8A 1HLDA 5HE8A 2C2WA 1RAHA 2FF7A 1CIJA 2ZBVA 3F1KA 3M33A 1V5EA 4OMFG 3TM4A 1VM6A 4R2WA 3ESBA 4FYXA 2D4HA 3P7MA 4N47A 3UNXA 4EJSB 1USKA 1NMQA 5KJ6A 2FFBA 2NV0A 4NBLA 2GF9A 5DYTA 2AEMA 5JUWA 1SK8A 1Y9AA 4AJ9A 1KYTA 5TJHA 4HX9A 3RYIA 4RIEA 1ZOIA 2ERXA 4C0SA 2YIDA 2F1KA 1ZESA 1FP4B 5HKBA 4R98A 3DBRA 1KMCA 4RMJA 3WV4A 1IYZA 1BWPA 1F4LA 3HDVA 2WP8J 4IX9A 2UXBB 1N6HA 4FGSA 2WUWE 5JI3E 2EFHB 3FPEA 3OICA 4J91A 5JJKA 2X0EA 1TNDA 4IDAA 4UTVA 1NONA 3TRJA 6Q21A 3G2OA 2BFZA 3FFBA 3FHCB 1XO1A 3LRPA 3VZPA 4QLBA 1P3Y1 1B0UA 5HK8A 5FB3A 1AK1A 3RTAA 1BQ4A 2OT3B 3VGPA 4OIFA 1LBSA 1N6KA 3P2UA 4PG6A 3DAGA 1E1RA 1W93A 1XWFA 1T34A 5YASA 2GCOA 4YCCA 1AX9A 1JXMA 4NH4A 5A4DA 2JLUA 5CM8B 3J80A 1YK0A 3A9CA 4YGYA 3W6NA 1YQTA 5KYYA 5CX1A 2OPHA 2IFTA 1IOVA 1YO6A 4YAWA 5A71A 1A7TA 2Q8QA 4X94A 4R3UC 4R4JA 1U8AA 4ZCPA 5GJBA 4UAGA 2G82A 4QG3A 1Y37A 1RXUA 3ZS9A 4AF8A 2H17A 3MOGA 4AMUA 1P6UA 1HFJA 4IFIA 3RHFA 4MS3A 3U7QB 3V55A 3F71A 1G17A 1KE1A 3PE6A 3DZJA 3TN7A 2VF8A 5E95A 3HVUA 3VHXB 2JJYA 4M1ZA 3EQ9A 3J7AC 1G9SA 3WK5A 4RULA 5A03A 1XTVA 4DY4A 2FPGB 1N6NA 2BGJA 4C29A 3FUUA 4S3MA 3HP1A 4P32A 4D8WA 3AKDA 2OQIA 5ED4A 1JJIA 1ZKPA 1NWHA 1YVRA 1XTPA 4ZEVA 4UFOA 4TKVA 5INTA 3DV0B 4X97A 2FSSA 2BRUA 3ZGNA 1PWXA 1P74A 2G80A 2W6OA 5EPUA 5K2MA 3IP7A 3VGJA 3RADC 3HKBA 1QTIA 1M6NA 4JVMA 1KC1A 2VHUA 3H5AA 2JHCA 1Q57A 1BXGB 1EP1B 1IE3A 3U56A 3PNKA 5DX1A 1GP2A 2H51A 1K7EB 1GTZA 1CZKA 2RIRA 2UZAA 3HJUA 2AYYA 2PX5A 3F5SA 3KTAA 4HUQB 4Q1EA 4FCWA 4WY5A 3C70A 4ZD6A 3NHWA 2ORIA 3RJ9A 3VR4A 4HCJA 1NU8A 1IN4A 1RWKA 4HI0E 5H68A 4C01A 5BV0A 4KWCA 3T3PB 4PN7A 2C42A 2QW0X 1CUEA 1VI5A 4MDEA 3P1JA 3W5DA 1VFNA 5AJHA 1C50A 3OKCA 2FR1A 2WIJA 5IHPA 1S2NA 2B8EA 3AQIA 1J5PA 3FAKA 3VZDA 1B2LA 3E9ZA 4CI0B 3FFXA 1E3EA 3WB0A 1ITZA 1N4AA 4EFMA 3URKA 5GQSA 1I8TA 3B9BA 5K05A 2BIFA 1S6YA 2EJWA 3BG5A 2ZRKA 2RAVA 4JHLA 4H0DA 3V4RA 2WFMA 3BD6A 1VE6A 4PG5A 4WV3A 1H0KA 3EIOA 2V6IA 5LP6B 1W73A 1E18A 4MJ3A 2D1RA 2QTVA 4D8VA 5DKFA 2FPPA 2SHKA 1FQKA 2FE1A 3M6XA 1OXUA 2V03A 4XYEA 3THWA 3ZDEA 3ZTYA 4V24A 3VYWA 5BUQA 3FWZA 2QLJA 1TO1E 4XE5A 1EXMA 1W1UA 1YCFA 2Y2UA 3AWDA 2ZJ4A 4BEBA 4QRDA 4S1OA 2ZW9A 3AFGA 2WINI 3REOA 3U48A 4IZHA 5CB8A 2DEUA 3A1EA 2FPWA 3ODGA 2FHSA 2WD8A 3SF0A 3RO7A 3ZCSA 1ONBA 1Z62A 2IYYA 3G0BA 3HU5A 3W7VA 3RAGA 2UU9B 1B3BA 5FWAA 4GZ5A 2CB9A 1XU9A 2AUMA 4YRQA 1L4FA 3BX1A 3EVGA 5F2KA 4HYTA 3USES 2XYVA 2ZUEA 3EIXA 3COVA 4GG1A 3TVDA 2MSEB 1WB9A 1SVUA 4RKQA 3FFTA 4EG0A 3CUTA 1GXSB 1JIIA 4C4RA 3ITNA 3OCXA 4F56A 4BO0A 4B7ZA 1RPAA 3AX6A 1F2UA 4XCQA 3IULA 4G5FA 3A1VA 2D6FA 1CB0A 4GL4A 4MWOA 2B8NA 3OX1A 2FWPA 4LJ5A 5K0CA 3L7LA 1F2TB 5JJBA 4EFZA 3FPLA 3ROMA 2X6RA 3KSUA 3L05A 1DBSA 1VBNA 3ZY3A 4FJ0A 1SU8A 1DAMA 3L1UA 4JLJA 3V1KA 421PA 4QDUA 1PZXA 2Z2KA 3PHHA 4QT4A 2Z6UA 4DRXA 1PFKA 4X44A 3CIOA 4DKJA 3FBGA 3HPQA 2IK8A 1VLJA 4OKNA 5IEJA 5KOJA 4YQFA 5KJFA 4X41A 1ID8A 3ZK7A 1AH2A 3D02A 3WLJA 5ULLA 5JS1A 2O1XA 1E5TA 1XT6A 3S2EA 1SQ0A 5CH3A 3HYSA 5JASA 2A0UA 1MFPA 2IIQA 3JQAD 3L7YA 5E2AA 1G8GA 1UXKA 4CKCB 5HBGA 1Q22A 3PYLA 1YF3A 3GJYA 1TUIA 4UKDA 1XMSA 4HB0A 1UAYA 1RZRA 2DWPA 4IDCA 4EPVA 5G1PA 5E7MA 1QIJA 1HOTA 3AESA 1DKUA 1L1EA 2GAIA 3FNHA 1VGRA 1G8SA 4Q4DA 4WNIA 5C5DA 5KHAA 2X3FA 4RGQA 2P5UA 4ZEXA 4DUYB 1NULA 3M1YA 3ZVMA 2PVSA 4ENQA 5IYZF 1R6VA 4CV0A 1V8PA 2JJ2D 3EY9A 2BMDA 4PLFA 2HI0A 4OJQA 2JJ1A 3T1OA 4Z9FA 4XYGA 4CM4B 2CVHA 2OM2A 4II7A 3D8SA 2HV8A 2AI2A 2MIIA 2YMQA 3VI4B 1I6WA 1XZBA 3DZGA 1IUNA 3O4IA 5BUSA 1XRRA 2NO1A 1KIAA 2Y66A 1Z4OA 2UYCA 2GKGA 4MWTA 1W44A 3ZWOA 4NDNE 5EC8A 2BHLA 4TS1A 3ZYZA 1Y8AA 4C0BA 2UZ4A 4DGQA 3TG8A 3BWEA 1AF4A 1CULC 5B53A 5LFAA 2AOXA 3IVGA 5K03A 5LYJB 4M7PA 4QFCA 3ETHA 3I6ZA 1NI4B 2VJLA 2QV7A 4Y1RB 1YJ5A 1ZIYA 5LKAA 4WN3A 4BV2A 2IS6A 3H3EA 2XE4A 2DX7A 1WXXA 4Z8YA 1OH6A 1YDHA 4QTUB 4Y6QA 2BCGY 1NATA 3AIMA 4DNXA 5CCXA 3I64A 4R9RA 1N4DA 1L7BA 1O7JA 2J33A 4QJBA 4KAFA 1J21A 1F38A 1E9AA 1OAOC 2NQ8A 1TW3A 1YRBA 1TIKA 4M60A 5EIFA 1ZOSA 1YE3A 3CPSA 2QGZA 3ED5A 3VPXA 5J4HA 5BSMA 2AR9A 2HGZA 5IP5A 5KUTA 3MWYW 4Q37A 5G0TA 1ADGA 2WPDA 1BS2A 3STXA 2H2AA 5GZ1A 5KWJA 3ISTA 2VDRB 1JTVA 1QONA 3MFYA 4L28A 4MI9A 2EZTA 2JGAA 4MVJP 4IAOA 4A8JC 2RGDA 3NM4A 4H7PA 5E9AA 5GWXA 1VLHA 1NYLA 4L8LA 4U9HS 1ZEJA 2CLCX 1GZUA 1XQYA 2EIXA 2GZSA 2NUPA 5IUKC 3ZVRA 4MDHA 3OLXA 3OPNA 3RD5A 4KQCA 2B3TA 2WUEA 3LYHA 3CY6A 3WIOA 1R6XA 1OWMA 1LF0A 1U7ZA 1DJQA 2IHJA 4LSZA 4GQBA 4FSHA 3JQQA 4I4TB 1SC1A 2VKQA 1P4GA 1FX0A 3EN0A 4KSYA 3C8HA 4EPWA 4N6GA 2F1OA 1WMDA 3OLZA 5I7RA 1O94A 2I66A 2FUEA 1KDZA 3TQSA 1ZRSA 3LX5A 5EMHA 1DWOA 2B5OA 3KJQA 1UMDA 4KQIA 2ORYA 1X2EA 3FBTA 5REQB 1RHRA 3G9QA 4I4NA 3D6JA 5K0TA 4AX0B 4TLMB 2LXNA 4CKEA 5KTOA 1XV5A 3I9KA 1C29B 2EGGA 3T5GA 4IOKA 2XNSA 5JAPA 1A4IA 1T10A 2BMWA 4AY4A 4DCMA 1TKRA 5CT5A 3EGWA 4MW4A 1B2RA 3EIWA 4NONA 3OI7A 3ME5A 5LBTA 1WDKA 3ZVLA 2LTAA 3JZAA 2YW2A 1J8YF 2ZZKA 4GWKA 3WY9A 2F55A 3MOSA 1CVRA 4LNUB 2R68A 5M3BA 3DMNA 1YKGA 3MGKA 5IX8A 2QUZA 4EA7A 1OASA 1UOPA 3NOQA 3GRZA 4Y2TA 4G0NA 1ZC4A 2ZJOA 4F04A 5L51A 3ILXA 1QGUB 1KJJA 5EP2A 4ZVRA 4JJGA 1QP7A 4GKKB 2P62A 4MAFA 3HWRA 1SUCA 4IDQA 3KWMA 2PUDA 2RJOA 2ATVA 3BEDA 1DAFA 2VSQA 4E4YA 1KIMA 4F8JA 1YZKA 4WBNF 1G3MA 4EX7A 2GX6A 3OVMA 3ROKA 3HJCA 5BR4A 4YJ3F 5CDSA 3S8YA 3MBIA 3KPWA 4NE7A 5FL3A 1TADA 4GI5A 1Q1QA 2ZITA 4E5VA 4I81A 3L46A 2R4UA 3Q8KA 5KVSA 1XU4A 4YH1A 3KR1A 3BMCA 1S9HA 3GF4A 3BQNB 2OOSA 3FHJA 1Z17A 2WW8A 1NF2A 1ODIA 4UHJA 1FFSA 2JK1A 5JSHA 2FOXA 1P7ZA 4MCAA 5FUQA 3BM5A 1RAEA 3QLTA 3GA7A 4RM2A 3X44A 3DOFA 1Q1AA 3FOCA 3L5OA 3IB6A 4TTJA 1N2GA 3K35A 3P27A 4DARA 1JEYB 3BWVA 5KOIA 3BTSA 4UVGA 3AUSA 5CA0B 1FNBA 4V38A 1W36D 3OA0A 5ICGA 4JP5A 4G4SO 4ZN6A 1HE4A 1HQKA 3RRYA 4BKMA 4PC7A 1Q44A 1JHDA 2A35A 1N3YA 2G08A 2HJWA 1RQ2A 4JLUA 3QRWA 4MW7A 4PRZA 3WIEA 4B48A 2G9QA 1SKYE 3K72B 4IZ6A 1FQOA 1FS4A 1QANA 2O7SA 3LCMA 4HZUB 2OCAA 2V1UA 1OCEA 2O3TA 1ND6A 4BNNA 3EUFA 2YHIA 1X0VA 3OOWA 4N5MA 3GZNB 3BKXA 4RLHA 3ZDYB 3ZHZA 5IARA 4ZNBA 1Q91A 4KLCA 1F8XA 1T3GA 3RFUA 2ZUDA 3NLLA 3SFZA 5C51B 3R6GA 4ZCIA 1O95A 1BFKA 2YNMA 5L3VA 3G2PA 3QVMA 3QFCA 3NH6A 4FN4A 3OMLA 3FXAA 4NF2A 2IXFA 3MXOA 4C88A 4CR7A 2ACVA 4MVCA 1YKSA 2HN9A 2Y4NA 1YZUA 2XJ4A 3GPDG 4Z1MD 2C78A 3L84A 3FX2A 3L0CA 1D2MA 1V4NA 4BKUA 4KQGA 4LRYA 2F3UA 4B33A 4DB4A 1Z5NA 2FB9A 4TKLA 4KFCA 5KZMB 1TM7E 1QV6A 2PCJA 1WO8A 4N18A 1FDTA 3O4VA 2VAVA 3S3TA 1YV9A 1ZL0A 2GTHA 2Q5JA 3HGTA 3PLNA 4F2GA 2HZ7A 1XRNA 2JHGA 3NATA 3RU2A 2LZ0A 5HGJA 5JQGB 1UDCA 3AEXA 3AOEA 3JQFA 1MN6A 3GN2A 1ZNYA 1UCFA 4YDSA 1I1OA 1MZVA 2RI0A 3K4HA 5TRTA 2FRDA 4CN9A 2F43B 1JJBA 1S8NA 1XBTA 2VLBA 4I2NA 1NBHA 2HXSA 2YASA 4IF6A 4IV5A 4LC9A 3SFTA 5DTIA 2ZR8A 3N58A 3CUSA 4R9SA 1BYUA 5TPWB 4PX5A 4LKRA 1SHZA 4INPA 3R74A 2J31A 4MLCA 4NL4H 3WQBA 5K8VA 5JZ9A 2VJPA 5CJPA 5AJUA 3KPYA 4EW3A 1NYQA 1TZCA 3EXAA 2PZJA 3CJRA 3MERA 4PWYA 1YQEA 4ZCLA 3RKUA 1X14A 4JBYA 1K88A 5KS2A 3HXOA 4N48A 4JI6B 4Y9TA 3PQ6A 3JALA 4PZYA 4XWOA 1PG5A 5KCMA 4XDZA 4AMYA 4OHWA 2P0EA 2XUPA 2P5SA 1MJ5A 1XMIA 4PEVA 4CTOA 5A5ZA 5T41A 5JD3A 4P7JA 1ADCA 1CUAA 1TMGE 2YBDA 1CY1A 3TD9A 1SUBA 1ZLXA 1ZQ1A 2COUA 1M1YE 5DYWA 1E5XA 4DUZB 3DYBA 2CB0A 4C6SA 3HXMA 2GB4A 4Q1CA 1AZWA 5FL7D 5IC6A 1U4NA 5FUYA 3VISA 3JASA 2F1HA 4N3AA 4D80A 3QQPA 1OR8A 1C8VB 4YN3A 2BGKA 2V98A 2H18A 2GN0A 3Q7PA 4ZCMA 2C92A 2EFGA 4FHCA 4PC6A 4W5RA 1A2BA 4N8SA 4HLQB 2ZE8A 4JJ6A 2JGMA 5KPDA 2Q2WA 5G53C 4EOGA 2ZS8A 4TQUS 1NVTA 4X90A 1S8OA 5B3JA 4XUGB 3WKCA 4A2WA 4F5EA 4AV7A 5LMZA 2QI9C 4GPEA 3DZKA 4LDRA 2XMGA 1AHPA 1O1YA 2MINA 3GXOA 3IAM1 3F6EX 3E1KA 4XYMA 3KJEA 4U7GA 4FDLA 3SR0A 3B1KA 1G5FA 1YI0A 2ZSFA 3ZNBA 1HE3A 3C1UA 1UBRS 1IEQA 4WUVA 1PTKA 1PGNA 4Q9LA 3DQPA 3TOCA 1OU0A 5LCFA 3ZZ1A 1ZR2A 2RD2A 4QJ3A 5HXAA 5EMNA 1RM3A 1O5TA 4LHZA 3LX6A 1E0AA 4JKYA 1CQWA 3PGVA 3NHFA 4JSRA 4AY3A 1F3OA 1Q7BA 3AH8A 3B7PA 4X7MA 2CLHB 4YONB 2VJMB 2WM2A 1IAQA 2PS9A 2JIQA 1TC2A 1PZGA 3OZTA 4WLEA 1NVEA 5FI1B 2CXNA 2QJTA 2XE8A 2YH2A 2ZSAA 5IBRA 5HM8A 1FNCA 3CJQA 1KP3A 4MB6A 5IBQA 2VHTA 1N2JA 1FU7A 1SQ5A 4BEJA 1E1KA 5LN1A 2WJHA 2WWTA 4W5NA 4K05A 1QYCA 3RPEA 4ED9A 4Z0TA 4E07A 4MUHA 1EMDA 4Q48A 4FGZA 1UDRA 4P8RA 1Z4LA 3TF5A 1M1NB 1E79A 1W85B 1WP4A 4IH1A 3CJTA 4RVUA 3OJWA 4YHBA 1MD9A 3V1UA 1B4DA 2HTFA 3GLHB 2Z8XA 4S35A 1FZQA 1RTTA 5IABA 4BMNA 1LVUA 3W8EA 3KU4A 3B7WA 3I76A 5ALFA 1M76A 1ZGAA 4I6JA 1H2RS 4B71A 3SFVA 4M0PA 4ARZA 2QRNA 2VHQA 1K4YA 4D9FA 1BG6A 1YNSA 4C3ZA 1ISIA 5DMHA 4BFVA 3QF4A 5CEFA 5KTSA 4KSBA 5HOEA 3BD7A 2H5LA 3H5LA 1X2BA 2FUNB 3PJFA 3IE1A 3SQNA 4EUFA 3K6SA 3PXXA 2R5WA 1ODTC 3M5CA 3ULKA 2IYNA 5CBKA 3PDHA 5KTMA 5JAMA 2XB4A 1DC8A 2NZEA 1J25A 3QA9A 5F7ZA 3P0FA 3DZCA 3UFXA 1M2NA 3JYQA 4H7FA 4MYHA 3F4BA 1AURA 2IKQA 1LRJA 2PXCA 2X7JA 2J5XA 3HHPA 2RHHA 2ZSDA 1FMJA 4H08A 3GVCA 4RJIA 3N70A 2H11A 1NI3A 1OX4A 3WGZA 1T9HA 1OLSA 3U62A 2ZJ8A 3UENA 4KEPA 3TG2A 1N57A 2O57A 3DBHB 3UJ8A 5H02A 3IYLW 3OEHD 1XEAA 3UCXA 2HHAA 2QKYA 5F52A 2Y92A 4UUQA 3UJ7A 2VSFA 1DV1A 1E2BA 1QF9A 2WTEA 2XEDA 1OB5A 5TQ2A 4JWTA 1M5TA 1SXPA 2P1RA 3AY0A 1W46A 4MI1A 4OJMX 5AXOA 4G86A 1O9GA 1AZSC 3SC3A 1C8BA 5JARA 4RS3A 3T3EA 3PNBA 3CGWA 4DC1A 5D7BA 2WA1A 2XMRA 2K2WA 2QENA 3EZ2A 4HAIA 4K81B 1ZH2A 5JXIA 1D2GA 1FVHA 3DMRA 5JVDA 5K6AC 4LDAA 3MTIA 4PGMA 1D5WA 2QIOA 3EPPA 4REQB 4LMAA 5LQMA 2RGCA 4ZRDA 2PV0A 1Y8RA 3FHOA 4MB2A 5HK9A 1XA4A 2WTMA 1QYXA 1LFAA 5FULA 3DBIA 2EKZA 5I8WA 4X84A 5F76A 2G25A 2P2SA 3DKPA 1VG1A 2OCBA 3OZUA 4LUCA 1GA4A 2P9YA 4DLUA 4MVJM 1NW6A 3LTEA 1YVDA 3W7AA 1P72A 2BCJQ 4AM8A 4GX5A 4JKOA 1P73A 1X1CA 1OWOA 1TM3E 5DWVA 2NZXA 3GFFA 1MB3A 4I08A 2Q1XA 5G02A 3CVWA 2GHTA 5H59A 2OAP1 3VSBA 2O0MA 2B4TO 4LV6A 2RK6A 4NCIA 3HH8A 4ZZ0A 1CPYA 2JIMA 3N2GA 3VNAA 4Z67A 4CGZA 3HVRA 1Y4UA 3NYQA 4QE3A 3BXPA 2MOKA 3UGJA 1PJ8A 1N2EA 1WKBA 2QX7A 5MDHA 5JNUA 1YOBA 4ESEA 3RYHB 4KGVA 4PAMA 4F7DA 2PZBA 5DTMA 5JC8A 1EIWA 3PIDA 4B6PA 5H82A 4D45A 5JJ5A 3PKJA 2X6QA 3HB1A 2GM5A 3B52X 1VJTA 2LWIA 1OI7A 3BK2A 3HYTA 2ZTVA 1R5BA 1ECBA 3AEKA 1SCNE 4YJHA 5J5CA 5BNZA 5LLTA 3BYZA 4K6MA 3SXUB 2I8LA 5C3MA 3BXHA 1J49A 4Q93A 1AKUA 1C7FA 1C81A 2IYOA 3OCYA 3WIDA 3OPXA 2VUTA 3WBKA 2SBTA 2BG8A 1CIPA 1ORTA 3TZKA 3F46A 2CHEA 4WXHA 3FVTA