2WYMA

Structure of a metallo-b-lactamase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
340
structure length
303
Chain Sequence
MSKVKSITRESWILSTFPEWGSWLNEEIEQEQVAPGTFAMWWLGCTGIWLKSEGGTNVCVDFWCGTGKQSHGKLQPNLRTTPFVLDPFAIRQIDAVLATHDHNDHIDVNVAAAVMQNCADDVPFIGPKTCVDLWIGWGVPKERCIVVKPGDVVKVKDIEIHALDAFDMDDRAVNYLFKTPGGSLYHSGDSHYSNYYAKHGNEHQIDVALGSYGENPRGITDKMTSADMLRMGEALNAKVVIPFHHDIWSNFQADPQEIRVLWEMKKDRLKYGFKPFIWQVGGKFTWPLDKDNFEYHYPRGFDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords L-ASCORBATE-6-PHOSPHATE LACTONASE ULAG
publication title Molecular Architecture of the Mn(2+)Dependent Lactonase Ulag Reveals an Rnase-Like Metallo-Beta-Lactamase Fold and a Novel Quaternary Structure.
pubmed doi rcsb
source organism Escherichia coli
total genus 94
structure length 303
sequence length 340
chains with identical sequence B, D, E
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13483 Lactamase_B_3 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2wymA00
1BVTA 2YNUA 4DILA 4AD9A 3KNSA 1ZNBA 4HL1A 5ACRA 2NZFA 4D1VA 1A8TA 2I7XA 2BFZA 1XTOA 4AX1B 4D1WA 3DHBA 2Y87A 2GFKA 3R2UA 4C1GA 4UWPB 5LLDA 4YSBA 4UWOB 5AYAA 3WXCA 3ZR9A 2ZZIA 1Y44A 2BFLA 3IE2A 4Z67A 3AF6A 2YCBA 3BK1A 3X2ZA 3FCZA 3SFPA 5AXOA 5K4MA 4C1EA 1X8IA 1DDKA 1QH5A 2NYPA 3KNRA 4F6ZA 4XWTA 2VW8A 4C1CA 4TZ9A 2YNWA 2FU6A 5EWAA 4RL0A 5ACSA 4U4LA 5LMCA 2Y8BA 2M5CA 4C1FA 5B15A 3X30A 2YZ3A 3AF5A 1P9EA 3MD7A 3ZWFA 4NQ5A 5FQCA 2HB9A 4UWRB 5HIOA 4AX0B 2WHGA 1VJNA 2ZO4A 4TZBA 3TP9A 2FU8A 1ZKPA 4DIKA 4F6HA 5EH9A 5HH4A 1JJEA 3G1PA 3BK2A 3IOGA 5ACVA 2WYMC 5LE1A 2BG2A 2I7TA 3IE1A 1BMCA 5ACQA 5AHRA 2AZ4A 3ADRA 2Q0JA 4LE6A 1QH3A 5A5ZA 3IOFA 3DHAA 2BIBA 4EYFA 5ACTA 2ZWRA 3T3OA 2YNTA 2BG7A 5B1UA 4EYBA 5HIQA 3F9OA 4NQ2A 3PY5A 2QDTA 5ACXA 4O98A 5K4NA 1MQOA 5ACWA 2Q9UA 4RAWA 2YNVA 2OHHA 4D1UA 5A87A 5A0VA 4Z7RA 4P62A 5EVKA 1M2XA 3SBLA 3RPCA 3FAIA 2WRSA 4EFZA 2BFZB 5ACUA 2BR6A 3S0ZA 2I7VA 3ZQ4A 3PG4A 2ZNBA 2OHIA 4RAMA 2BMIA 2GKLA 3AJ3A 4AWZA 2A7MA 3DHCA 4ZO3A 5LCHA 4H0DA 3IEKA 5LS3A 3RKKA 1BC2A 2FHXA 3ZNBA 5EW0A 2WYMA 2Q0IA 2DKFA 4D02A 5HISA 4J5FA 4D1TA 4FEKA 3P2UA 1SMLA 4BZ3A 3BV6A 2BFKA 3JXPA 2XR1A 2H6AA 2BGAA 1A7TA 5IQKA 4BP0A 1JT1A 5EV6A 4AWYB 3ESHA 5FQBA 4PVTA 2UYXA 5HH5A 2M5DA 2CBNA 5AEBA 4C09A 1WRAA 4HKYA 4ZO2A 2DOOA 4J5HA 3Q6VA 4KEPA 5EVDA 3SD9A 3X2XA 2GCUA 3L6NA 3IELA 4FR7A 3SRXA 2E7YA 1K07A 5K4KA 2BG8A 2QJSA 2BG8B 3IDZA 3VPEA 4UAMA 3QH8A 1X8HA 2YNTB 4GYUA 2QINA 1ZTCA 1E5DA 4PVOA 4EXSA 5LCFA 2YNVB 4Z60A 4GYQA 3KL7A 2QEDA 1KO2A 2QDSA 5DPXA 3BC2A 1L9YA 4UWSB 1YCGA 4YSKA 4NQ4A 5LM6A 1VGNA 5FQAA 4Z6XA 5KIKA 4Z5YA 3I15A 4Z5ZA 5A0TA 4TZEA 2FHXB 5B3RA 4EXYA 4RBSA 4JO0A 4CHLA 2P4ZA 3LVZA 5ACPA 1XM8A 1X8GA 4EYLA 2FU9A 3A4YA 2XF4A 5AXRA 1VMEA 4V0HA 2Q42A 4XWWA 2GFJA 3T9MA 4B87A 3I14A 5EVBA 3X2YA 4ZNBA 3SW3A 4KEQA 4NQ6A 2BC2A 2Y8AA 5KILA 2NZEA 2BG6A 1YCHA 3SPUA 4TZFA 3I13A 4TYTA 3I0VA 4C1HA 2AIOA 2P1EA 3IE0A 4RM5A 3PY6A 4ZEJA 1KR3A 1DD6A 5AHOA 5HH6A 2R2DA 5LSCA 2FM6A 3T3NA 2P18A 5K0WA 2BTNA 1JJTA 1HLKA 3VQZA 1WUPA 2OHJA 1WUOA 4WD6A 1WW1A 1YCFA 1KO3A 2NXAA 5EHTA 4EY2A 4HL2A 2WYLA 4RL2A 2FU7A 4YSLA 3DH8A 5HIPA 3H3EA 3RKJA 2GMNA 5EV8A 3IEMA 3I11A 4C1DA 4FSBA 5LCAA 4XUKA 4GCWA 1DXKA 2FK6A 4UA4A 2P97A 4UBQA 4TYFA
chains in the Genus database with same CATH superfamily
1BVTA 2YNUA 4DILA 4AD9A 3KNSA 1ZNBA 4HL1A 5ACRA 2NZFA 4D1VA 1A8TA 2I7XA 2BFZA 1XTOA 4AX1B 4D1WA 3DHBA 2Y87A 2GFKA 3R2UA 4C1GA 4UWPB 5LLDA 4YSBA 4UWOB 5AYAA 3WXCA 3ZR9A 2ZZIA 1Y44A 2BFLA 3IE2A 4Z67A 3AF6A 2YCBA 3BK1A 3X2ZA 3FCZA 3SFPA 5AXOA 5K4MA 4C1EA 1X8IA 1DDKA 1QH5A 2NYPA 3KNRA 4F6ZA 4XWTA 2VW8A 4C1CA 4TZ9A 2YNWA 2FU6A 5EWAA 4RL0A 5ACSA 4U4LA 5LMCA 2Y8BA 2M5CA 4C1FA 5B15A 3X30A 2YZ3A 3AF5A 1P9EA 3MD7A 3ZWFA 4NQ5A 5FQCA 2HB9A 4UWRB 5HIOA 4AX0B 2WHGA 1VJNA 2ZO4A 4TZBA 3TP9A 2FU8A 1ZKPA 4DIKA 4F6HA 5EH9A 5HH4A 1JJEA 3G1PA 3BK2A 3IOGA 5ACVA 2WYMC 5LE1A 2BG2A 2I7TA 3IE1A 1BMCA 5ACQA 5AHRA 2AZ4A 3ADRA 2Q0JA 4LE6A 1QH3A 5A5ZA 4AXHA 3IOFA 3DHAA 2BIBA 4EYFA 5ACTA 2ZWRA 3T3OA 2YNTA 2BG7A 5B1UA 4EYBA 5HIQA 3F9OA 4NQ2A 3PY5A 2QDTA 5ACXA 4O98A 5K4NA 1MQOA 5ACWA 2Q9UA 4RAWA 2YNVA 2OHHA 2YHEA 4D1UA 5A87A 5A0VA 4Z7RA 4P62A 5EVKA 1M2XA 3SBLA 3RPCA 4NURA 3FAIA 2WRSA 4EFZA 2BFZB 5ACUA 2BR6A 3S0ZA 2I7VA 3ZQ4A 3PG4A 2ZNBA 2OHIA 4RAMA 2BMIA 2GKLA 2CFUA 3AJ3A 4AWZA 2A7MA 3DHCA 4ZO3A 5LCHA 4H0DA 3IEKA 5LS3A 3RKKA 1BC2A 2FHXA 3ZNBA 5EW0A 2WYMA 2Q0IA 2DKFA 4D02A 5HISA 4J5FA 4D1TA 4FEKA 3P2UA 1SMLA 4BZ3A 3BV6A 2BFKA 3JXPA 2XR1A 2H6AA 2BGAA 1A7TA 5IQKA 4BP0A 2CG2A 1JT1A 5EV6A 4AWYB 3ESHA 5FQBA 4PVTA 2UYXA 5HH5A 2M5DA 2CBNA 5AEBA 4C09A 1WRAA 4HKYA 4ZO2A 2DOOA 4J5HA 3Q6VA 4KEPA 5EVDA 3SD9A 3X2XA 2GCUA 3L6NA 3IELA 4FR7A 3SRXA 2E7YA 1K07A 5K4KA 2BG8A 2QJSA 2BG8B 3IDZA 3VPEA 4UAMA 3QH8A 1X8HA 2YNTB 4GYUA 2QINA 1ZTCA 1E5DA 2CG3A 4PVOA 4EXSA 5LCFA 2YNVB 4Z60A 4GYQA 3KL7A 2QEDA 1KO2A 4PDXA 2QDSA 5DPXA 3BC2A 1L9YA 4UWSB 1YCGA 4YSKA 4AV7A 4NQ4A 5LM6A 1VGNA 5FQAA 4Z6XA 5KIKA 4Z5YA 3I15A 4Z5ZA 5A0TA 4TZEA 2FHXB 5B3RA 4EXYA 4RBSA 4JO0A 4CHLA 2P4ZA 3LVZA 5ACPA 1XM8A 1X8GA 4EYLA 2FU9A 3A4YA 2XF4A 5AXRA 1VMEA 4V0HA 2Q42A 4XWWA 2GFJA 3T9MA 4B87A 3I14A 5EVBA 3X2YA 4ZNBA 3SW3A 4KEQA 4NQ6A 2BC2A 2Y8AA 5KILA 2NZEA 2BG6A 1YCHA 3SPUA 4TZFA 3I13A 4TYTA 3I0VA 2CFZA 4C1HA 2AIOA 5AJLA 2P1EA 3IE0A 4RM5A 3PY6A 4ZEJA 1KR3A 1DD6A 5AHOA 5HH6A 2R2DA 5LSCA 2FM6A 3T3NA 2P18A 5K0WA 2BTNA 1JJTA 1HLKA 5AIJA 3VQZA 1WUPA 2OHJA 1WUOA 4WD6A 1WW1A 1YCFA 1KO3A 2NXAA 5EHTA 4EY2A 4HL2A 2WYLA 4RL2A 2FU7A 4YSLA 3DH8A 5HIPA 3H3EA 3RKJA 2GMNA 5EV8A 3IEMA 3I11A 4C1DA 4FSBA 5LCAA 4XUKA 4GCWA 1DXKA 2FK6A 4UA4A 2P97A 4UBQA 5A23A 4TYFA
chains in the Genus database with same CATH topology
1BVTA 2YNUA 4DILA 4AD9A 3KNSA 1ZNBA 4HL1A 5ACRA 2NZFA 4D1VA 1A8TA 2I7XA 2BFZA 1XTOA 4AX1B 4D1WA 3DHBA 2Y87A 2GFKA 3R2UA 4C1GA 4UWPB 5LLDA 4YSBA 4UWOB 5AYAA 3WXCA 3ZR9A 2ZZIA 1Y44A 2BFLA 3IE2A 4Z67A 3AF6A 2YCBA 3BK1A 3X2ZA 3FCZA 3SFPA 5AXOA 5K4MA 4C1EA 1X8IA 1DDKA 1QH5A 2NYPA 3KNRA 4F6ZA 4XWTA 2VW8A 4C1CA 4TZ9A 2YNWA 2FU6A 5EWAA 4RL0A 5ACSA 4U4LA 5LMCA 2Y8BA 2M5CA 4C1FA 5B15A 3X30A 2YZ3A 3AF5A 1P9EA 3MD7A 3ZWFA 4NQ5A 5FQCA 2HB9A 4UWRB 5HIOA 4AX0B 2WHGA 1VJNA 2ZO4A 4TZBA 3TP9A 2FU8A 1ZKPA 4DIKA 4F6HA 5EH9A 5HH4A 1JJEA 3G1PA 3BK2A 3IOGA 5ACVA 2WYMC 5LE1A 2BG2A 2I7TA 3IE1A 1BMCA 5ACQA 5AHRA 2AZ4A 3ADRA 2Q0JA 4LE6A 1QH3A 5A5ZA 3IOFA 3DHAA 2BIBA 4EYFA 5ACTA 2ZWRA 3T3OA 2YNTA 2BG7A 5B1UA 4EYBA 5HIQA 3F9OA 4NQ2A 3PY5A 2QDTA 5ACXA 4O98A 5K4NA 1MQOA 5ACWA 2Q9UA 4RAWA 2YNVA 2OHHA 4D1UA 5A87A 5A0VA 4Z7RA 4P62A 5EVKA 1M2XA 3SBLA 3RPCA 3FAIA 2WRSA 4EFZA 2BFZB 5ACUA 2BR6A 3S0ZA 2I7VA 3ZQ4A 3PG4A 2ZNBA 2OHIA 4RAMA 2BMIA 2GKLA 3AJ3A 4AWZA 2A7MA 3DHCA 4ZO3A 5LCHA 4H0DA 3IEKA 5LS3A 3RKKA 1BC2A 2FHXA 3ZNBA 5EW0A 2WYMA 2Q0IA 2DKFA 4D02A 5HISA 4J5FA 4D1TA 4FEKA 3P2UA 1SMLA 4BZ3A 3BV6A 2BFKA 3JXPA 2XR1A 2H6AA 2BGAA 1A7TA 5IQKA 4BP0A 1JT1A 5EV6A 4AWYB 3ESHA 5FQBA 4PVTA 2UYXA 5HH5A 2M5DA 2CBNA 5AEBA 4C09A 1WRAA 4HKYA 4ZO2A 2DOOA 4J5HA 3Q6VA 4KEPA 5EVDA 3SD9A 3X2XA 2GCUA 3L6NA 3IELA 4FR7A 3SRXA 2E7YA 1K07A 5K4KA 2BG8A 2QJSA 2BG8B 3IDZA 3VPEA 4UAMA 3QH8A 1X8HA 2YNTB 4GYUA 2QINA 1ZTCA 1E5DA 4PVOA 4EXSA 5LCFA 2YNVB 4Z60A 4GYQA 3KL7A 2QEDA 1KO2A 2QDSA 5DPXA 3BC2A 1L9YA 4UWSB 1YCGA 4YSKA 4NQ4A 5LM6A 1VGNA 5FQAA 4Z6XA 5KIKA 4Z5YA 3I15A 4Z5ZA 5A0TA 4TZEA 2FHXB 5B3RA 4EXYA 4RBSA 4JO0A 4CHLA 2P4ZA 3LVZA 5ACPA 1XM8A 1X8GA 4EYLA 2FU9A 3A4YA 2XF4A 5AXRA 1VMEA 4V0HA 2Q42A 4XWWA 2GFJA 3T9MA 4B87A 3I14A 5EVBA 3X2YA 4ZNBA 3SW3A 4KEQA 4NQ6A 2BC2A 2Y8AA 5KILA 2NZEA 2BG6A 1YCHA 3SPUA 4TZFA 3I13A 4TYTA 3I0VA 4C1HA 2AIOA 2P1EA 3IE0A 4RM5A 3PY6A 4ZEJA 1KR3A 1DD6A 5AHOA 5HH6A 2R2DA 5LSCA 2FM6A 3T3NA 2P18A 5K0WA 2BTNA 1JJTA 1HLKA 3VQZA 1WUPA 2OHJA 1WUOA 4WD6A 1WW1A 1YCFA 1KO3A 2NXAA 5EHTA 4EY2A 4HL2A 2WYLA 4RL2A 2FU7A 4YSLA 3DH8A 5HIPA 3H3EA 3RKJA 2GMNA 5EV8A 3IEMA 3I11A 4C1DA 4FSBA 5LCAA 4XUKA 4GCWA 1DXKA 2FK6A 4UA4A 2P97A 4UBQA 4TYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BVT A;  2YNU A;  4DIL A;  4AD9 A;  3KNS A;  1ZNB A;  4HL1 A;  5ACR A;  2NZF A;  4D1V A;  1A8T A;  2I7X A;  2BFZ A;  1XTO A;  4AX1 B;  4D1W A;  3DHB A;  2Y87 A;  2GFK A;  3R2U A;  4C1G A;  4UWP B;  5LLD A;  4YSB A;  4UWO B;  5AYA A;  3WXC A;  3ZR9 A;  2ZZI A;  1Y44 A;  2BFL A;  3IE2 A;  4Z67 A;  3AF6 A;  2YCB A;  3BK1 A;  3X2Z A;  3FCZ A;  3SFP A;  5AXO A;  5K4M A;  4C1E A;  1X8I A;  1DDK A;  1QH5 A;  2NYP A;  3KNR A;  4F6Z A;  4XWT A;  2VW8 A;  4C1C A;  4TZ9 A;  2YNW A;  2FU6 A;  5EWA A;  4RL0 A;  5ACS A;  4U4L A;  5LMC A;  2Y8B A;  2M5C A;  4C1F A;  5B15 A;  3X30 A;  2YZ3 A;  3AF5 A;  1P9E A;  3MD7 A;  3ZWF A;  4NQ5 A;  5FQC A;  2HB9 A;  4UWR B;  5HIO A;  4AX0 B;  2WHG A;  1VJN A;  2ZO4 A;  4TZB A;  3TP9 A;  2FU8 A;  1ZKP A;  4DIK A;  4F6H A;  5EH9 A;  5HH4 A;  1JJE A;  3G1P A;  3BK2 A;  3IOG A;  5ACV A;  2WYM C;  5LE1 A;  2BG2 A;  2I7T A;  3IE1 A;  1BMC A;  5ACQ A;  5AHR A;  2AZ4 A;  3ADR A;  2Q0J A;  4LE6 A;  1QH3 A;  5A5Z A;  3IOF A;  3DHA A;  2BIB A;  4EYF A;  5ACT A;  2ZWR A;  3T3O A;  2YNT A;  2BG7 A;  5B1U A;  4EYB A;  5HIQ A;  3F9O A;  4NQ2 A;  3PY5 A;  2QDT A;  5ACX A;  4O98 A;  5K4N A;  1MQO A;  5ACW A;  2Q9U A;  4RAW A;  2YNV A;  2OHH A;  4D1U A;  5A87 A;  5A0V A;  4Z7R A;  4P62 A;  5EVK A;  1M2X A;  3SBL A;  3RPC A;  3FAI A;  2WRS A;  4EFZ A;  2BFZ B;  5ACU A;  2BR6 A;  3S0Z A;  2I7V A;  3ZQ4 A;  3PG4 A;  2ZNB A;  2OHI A;  4RAM A;  2BMI A;  2GKL A;  3AJ3 A;  4AWZ A;  2A7M A;  3DHC A;  4ZO3 A;  5LCH A;  4H0D A;  3IEK A;  5LS3 A;  3RKK A;  1BC2 A;  2FHX A;  3ZNB A;  5EW0 A;  2WYM A;  2Q0I A;  2DKF A;  4D02 A;  5HIS A;  4J5F A;  4D1T A;  4FEK A;  3P2U A;  1SML A;  4BZ3 A;  3BV6 A;  2BFK A;  3JXP A;  2XR1 A;  2H6A A;  2BGA A;  1A7T A;  5IQK A;  4BP0 A;  1JT1 A;  5EV6 A;  4AWY B;  3ESH A;  5FQB A;  4PVT A;  2UYX A;  5HH5 A;  2M5D A;  2CBN A;  5AEB A;  4C09 A;  1WRA A;  4HKY A;  4ZO2 A;  2DOO A;  4J5H A;  3Q6V A;  4KEP A;  5EVD A;  3SD9 A;  3X2X A;  2GCU A;  3L6N A;  3IEL A;  4FR7 A;  3SRX A;  2E7Y A;  1K07 A;  5K4K A;  2BG8 A;  2QJS A;  2BG8 B;  3IDZ A;  3VPE A;  4UAM A;  3QH8 A;  1X8H A;  2YNT B;  4GYU A;  2QIN A;  1ZTC A;  1E5D A;  4PVO A;  4EXS A;  5LCF A;  2YNV B;  4Z60 A;  4GYQ A;  3KL7 A;  2QED A;  1KO2 A;  2QDS A;  5DPX A;  3BC2 A;  1L9Y A;  4UWS B;  1YCG A;  4YSK A;  4NQ4 A;  5LM6 A;  1VGN A;  5FQA A;  4Z6X A;  5KIK A;  4Z5Y A;  3I15 A;  4Z5Z A;  5A0T A;  4TZE A;  2FHX B;  5B3R A;  4EXY A;  4RBS A;  4JO0 A;  4CHL A;  2P4Z A;  3LVZ A;  5ACP A;  1XM8 A;  1X8G A;  4EYL A;  2FU9 A;  3A4Y A;  2XF4 A;  5AXR A;  1VME A;  4V0H A;  2Q42 A;  4XWW A;  2GFJ A;  3T9M A;  4B87 A;  3I14 A;  5EVB A;  3X2Y A;  4ZNB A;  3SW3 A;  4KEQ A;  4NQ6 A;  2BC2 A;  2Y8A A;  5KIL A;  2NZE A;  2BG6 A;  1YCH A;  3SPU A;  4TZF A;  3I13 A;  4TYT A;  3I0V A;  4C1H A;  2AIO A;  2P1E A;  3IE0 A;  4RM5 A;  3PY6 A;  4ZEJ A;  1KR3 A;  1DD6 A;  5AHO A;  5HH6 A;  2R2D A;  5LSC A;  2FM6 A;  3T3N A;  2P18 A;  5K0W A;  2BTN A;  1JJT A;  1HLK A;  3VQZ A;  1WUP A;  2OHJ A;  1WUO A;  4WD6 A;  1WW1 A;  1YCF A;  1KO3 A;  2NXA A;  5EHT A;  4EY2 A;  4HL2 A;  2WYL A;  4RL2 A;  2FU7 A;  4YSL A;  3DH8 A;  5HIP A;  3H3E A;  3RKJ A;  2GMN A;  5EV8 A;  3IEM A;  3I11 A;  4C1D A;  4FSB A;  5LCA A;  4XUK A;  4GCW A;  1DXK A;  2FK6 A;  4UA4 A;  2P97 A;  4UBQ A;  4TYF A; 
#chains in the Genus database with same CATH topology
 1BVT A;  2YNU A;  4DIL A;  4AD9 A;  3KNS A;  1ZNB A;  4HL1 A;  5ACR A;  2NZF A;  4D1V A;  1A8T A;  2I7X A;  2BFZ A;  1XTO A;  4AX1 B;  4D1W A;  3DHB A;  2Y87 A;  2GFK A;  3R2U A;  4C1G A;  4UWP B;  5LLD A;  4YSB A;  4UWO B;  5AYA A;  3WXC A;  3ZR9 A;  2ZZI A;  1Y44 A;  2BFL A;  3IE2 A;  4Z67 A;  3AF6 A;  2YCB A;  3BK1 A;  3X2Z A;  3FCZ A;  3SFP A;  5AXO A;  5K4M A;  4C1E A;  1X8I A;  1DDK A;  1QH5 A;  2NYP A;  3KNR A;  4F6Z A;  4XWT A;  2VW8 A;  4C1C A;  4TZ9 A;  2YNW A;  2FU6 A;  5EWA A;  4RL0 A;  5ACS A;  4U4L A;  5LMC A;  2Y8B A;  2M5C A;  4C1F A;  5B15 A;  3X30 A;  2YZ3 A;  3AF5 A;  1P9E A;  3MD7 A;  3ZWF A;  4NQ5 A;  5FQC A;  2HB9 A;  4UWR B;  5HIO A;  4AX0 B;  2WHG A;  1VJN A;  2ZO4 A;  4TZB A;  3TP9 A;  2FU8 A;  1ZKP A;  4DIK A;  4F6H A;  5EH9 A;  5HH4 A;  1JJE A;  3G1P A;  3BK2 A;  3IOG A;  5ACV A;  2WYM C;  5LE1 A;  2BG2 A;  2I7T A;  3IE1 A;  1BMC A;  5ACQ A;  5AHR A;  2AZ4 A;  3ADR A;  2Q0J A;  4LE6 A;  1QH3 A;  5A5Z A;  4AXH A;  3IOF A;  3DHA A;  2BIB A;  4EYF A;  5ACT A;  2ZWR A;  3T3O A;  2YNT A;  2BG7 A;  5B1U A;  4EYB A;  5HIQ A;  3F9O A;  4NQ2 A;  3PY5 A;  2QDT A;  5ACX A;  4O98 A;  5K4N A;  1MQO A;  5ACW A;  2Q9U A;  4RAW A;  2YNV A;  2OHH A;  2YHE A;  4D1U A;  5A87 A;  5A0V A;  4Z7R A;  4P62 A;  5EVK A;  1M2X A;  3SBL A;  3RPC A;  4NUR A;  3FAI A;  2WRS A;  4EFZ A;  2BFZ B;  5ACU A;  2BR6 A;  3S0Z A;  2I7V A;  3ZQ4 A;  3PG4 A;  2ZNB A;  2OHI A;  4RAM A;  2BMI A;  2GKL A;  2CFU A;  3AJ3 A;  4AWZ A;  2A7M A;  3DHC A;  4ZO3 A;  5LCH A;  4H0D A;  3IEK A;  5LS3 A;  3RKK A;  1BC2 A;  2FHX A;  3ZNB A;  5EW0 A;  2WYM A;  2Q0I A;  2DKF A;  4D02 A;  5HIS A;  4J5F A;  4D1T A;  4FEK A;  3P2U A;  1SML A;  4BZ3 A;  3BV6 A;  2BFK A;  3JXP A;  2XR1 A;  2H6A A;  2BGA A;  1A7T A;  5IQK A;  4BP0 A;  2CG2 A;  1JT1 A;  5EV6 A;  4AWY B;  3ESH A;  5FQB A;  4PVT A;  2UYX A;  5HH5 A;  2M5D A;  2CBN A;  5AEB A;  4C09 A;  1WRA A;  4HKY A;  4ZO2 A;  2DOO A;  4J5H A;  3Q6V A;  4KEP A;  5EVD A;  3SD9 A;  3X2X A;  2GCU A;  3L6N A;  3IEL A;  4FR7 A;  3SRX A;  2E7Y A;  1K07 A;  5K4K A;  2BG8 A;  2QJS A;  2BG8 B;  3IDZ A;  3VPE A;  4UAM A;  3QH8 A;  1X8H A;  2YNT B;  4GYU A;  2QIN A;  1ZTC A;  1E5D A;  2CG3 A;  4PVO A;  4EXS A;  5LCF A;  2YNV B;  4Z60 A;  4GYQ A;  3KL7 A;  2QED A;  1KO2 A;  4PDX A;  2QDS A;  5DPX A;  3BC2 A;  1L9Y A;  4UWS B;  1YCG A;  4YSK A;  4AV7 A;  4NQ4 A;  5LM6 A;  1VGN A;  5FQA A;  4Z6X A;  5KIK A;  4Z5Y A;  3I15 A;  4Z5Z A;  5A0T A;  4TZE A;  2FHX B;  5B3R A;  4EXY A;  4RBS A;  4JO0 A;  4CHL A;  2P4Z A;  3LVZ A;  5ACP A;  1XM8 A;  1X8G A;  4EYL A;  2FU9 A;  3A4Y A;  2XF4 A;  5AXR A;  1VME A;  4V0H A;  2Q42 A;  4XWW A;  2GFJ A;  3T9M A;  4B87 A;  3I14 A;  5EVB A;  3X2Y A;  4ZNB A;  3SW3 A;  4KEQ A;  4NQ6 A;  2BC2 A;  2Y8A A;  5KIL A;  2NZE A;  2BG6 A;  1YCH A;  3SPU A;  4TZF A;  3I13 A;  4TYT A;  3I0V A;  2CFZ A;  4C1H A;  2AIO A;  5AJL A;  2P1E A;  3IE0 A;  4RM5 A;  3PY6 A;  4ZEJ A;  1KR3 A;  1DD6 A;  5AHO A;  5HH6 A;  2R2D A;  5LSC A;  2FM6 A;  3T3N A;  2P18 A;  5K0W A;  2BTN A;  1JJT A;  1HLK A;  5AIJ A;  3VQZ A;  1WUP A;  2OHJ A;  1WUO A;  4WD6 A;  1WW1 A;  1YCF A;  1KO3 A;  2NXA A;  5EHT A;  4EY2 A;  4HL2 A;  2WYL A;  4RL2 A;  2FU7 A;  4YSL A;  3DH8 A;  5HIP A;  3H3E A;  3RKJ A;  2GMN A;  5EV8 A;  3IEM A;  3I11 A;  4C1D A;  4FSB A;  5LCA A;  4XUK A;  4GCW A;  1DXK A;  2FK6 A;  4UA4 A;  2P97 A;  4UBQ A;  5A23 A;  4TYF A; 
#chains in the Genus database with same CATH homology
 1BVT A;  2YNU A;  4DIL A;  4AD9 A;  3KNS A;  1ZNB A;  4HL1 A;  5ACR A;  2NZF A;  4D1V A;  1A8T A;  2I7X A;  2BFZ A;  1XTO A;  4AX1 B;  4D1W A;  3DHB A;  2Y87 A;  2GFK A;  3R2U A;  4C1G A;  4UWP B;  5LLD A;  4YSB A;  4UWO B;  5AYA A;  3WXC A;  3ZR9 A;  2ZZI A;  1Y44 A;  2BFL A;  3IE2 A;  4Z67 A;  3AF6 A;  2YCB A;  3BK1 A;  3X2Z A;  3FCZ A;  3SFP A;  5AXO A;  5K4M A;  4C1E A;  1X8I A;  1DDK A;  1QH5 A;  2NYP A;  3KNR A;  4F6Z A;  4XWT A;  2VW8 A;  4C1C A;  4TZ9 A;  2YNW A;  2FU6 A;  5EWA A;  4RL0 A;  5ACS A;  4U4L A;  5LMC A;  2Y8B A;  2M5C A;  4C1F A;  5B15 A;  3X30 A;  2YZ3 A;  3AF5 A;  1P9E A;  3MD7 A;  3ZWF A;  4NQ5 A;  5FQC A;  2HB9 A;  4UWR B;  5HIO A;  4AX0 B;  2WHG A;  1VJN A;  2ZO4 A;  4TZB A;  3TP9 A;  2FU8 A;  1ZKP A;  4DIK A;  4F6H A;  5EH9 A;  5HH4 A;  1JJE A;  3G1P A;  3BK2 A;  3IOG A;  5ACV A;  2WYM C;  5LE1 A;  2BG2 A;  2I7T A;  3IE1 A;  1BMC A;  5ACQ A;  5AHR A;  2AZ4 A;  3ADR A;  2Q0J A;  4LE6 A;  1QH3 A;  5A5Z A;  3IOF A;  3DHA A;  2BIB A;  4EYF A;  5ACT A;  2ZWR A;  3T3O A;  2YNT A;  2BG7 A;  5B1U A;  4EYB A;  5HIQ A;  3F9O A;  4NQ2 A;  3PY5 A;  2QDT A;  5ACX A;  4O98 A;  5K4N A;  1MQO A;  5ACW A;  2Q9U A;  4RAW A;  2YNV A;  2OHH A;  4D1U A;  5A87 A;  5A0V A;  4Z7R A;  4P62 A;  5EVK A;  1M2X A;  3SBL A;  3RPC A;  3FAI A;  2WRS A;  4EFZ A;  2BFZ B;  5ACU A;  2BR6 A;  3S0Z A;  2I7V A;  3ZQ4 A;  3PG4 A;  2ZNB A;  2OHI A;  4RAM A;  2BMI A;  2GKL A;  3AJ3 A;  4AWZ A;  2A7M A;  3DHC A;  4ZO3 A;  5LCH A;  4H0D A;  3IEK A;  5LS3 A;  3RKK A;  1BC2 A;  2FHX A;  3ZNB A;  5EW0 A;  2WYM A;  2Q0I A;  2DKF A;  4D02 A;  5HIS A;  4J5F A;  4D1T A;  4FEK A;  3P2U A;  1SML A;  4BZ3 A;  3BV6 A;  2BFK A;  3JXP A;  2XR1 A;  2H6A A;  2BGA A;  1A7T A;  5IQK A;  4BP0 A;  1JT1 A;  5EV6 A;  4AWY B;  3ESH A;  5FQB A;  4PVT A;  2UYX A;  5HH5 A;  2M5D A;  2CBN A;  5AEB A;  4C09 A;  1WRA A;  4HKY A;  4ZO2 A;  2DOO A;  4J5H A;  3Q6V A;  4KEP A;  5EVD A;  3SD9 A;  3X2X A;  2GCU A;  3L6N A;  3IEL A;  4FR7 A;  3SRX A;  2E7Y A;  1K07 A;  5K4K A;  2BG8 A;  2QJS A;  2BG8 B;  3IDZ A;  3VPE A;  4UAM A;  3QH8 A;  1X8H A;  2YNT B;  4GYU A;  2QIN A;  1ZTC A;  1E5D A;  4PVO A;  4EXS A;  5LCF A;  2YNV B;  4Z60 A;  4GYQ A;  3KL7 A;  2QED A;  1KO2 A;  2QDS A;  5DPX A;  3BC2 A;  1L9Y A;  4UWS B;  1YCG A;  4YSK A;  4NQ4 A;  5LM6 A;  1VGN A;  5FQA A;  4Z6X A;  5KIK A;  4Z5Y A;  3I15 A;  4Z5Z A;  5A0T A;  4TZE A;  2FHX B;  5B3R A;  4EXY A;  4RBS A;  4JO0 A;  4CHL A;  2P4Z A;  3LVZ A;  5ACP A;  1XM8 A;  1X8G A;  4EYL A;  2FU9 A;  3A4Y A;  2XF4 A;  5AXR A;  1VME A;  4V0H A;  2Q42 A;  4XWW A;  2GFJ A;  3T9M A;  4B87 A;  3I14 A;  5EVB A;  3X2Y A;  4ZNB A;  3SW3 A;  4KEQ A;  4NQ6 A;  2BC2 A;  2Y8A A;  5KIL A;  2NZE A;  2BG6 A;  1YCH A;  3SPU A;  4TZF A;  3I13 A;  4TYT A;  3I0V A;  4C1H A;  2AIO A;  2P1E A;  3IE0 A;  4RM5 A;  3PY6 A;  4ZEJ A;  1KR3 A;  1DD6 A;  5AHO A;  5HH6 A;  2R2D A;  5LSC A;  2FM6 A;  3T3N A;  2P18 A;  5K0W A;  2BTN A;  1JJT A;  1HLK A;  3VQZ A;  1WUP A;  2OHJ A;  1WUO A;  4WD6 A;  1WW1 A;  1YCF A;  1KO3 A;  2NXA A;  5EHT A;  4EY2 A;  4HL2 A;  2WYL A;  4RL2 A;  2FU7 A;  4YSL A;  3DH8 A;  5HIP A;  3H3E A;  3RKJ A;  2GMN A;  5EV8 A;  3IEM A;  3I11 A;  4C1D A;  4FSB A;  5LCA A;  4XUK A;  4GCW A;  1DXK A;  2FK6 A;  4UA4 A;  2P97 A;  4UBQ A;  4TYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...