2WYMA

Structure of a metallo-b-lactamase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
340
structure length
303
Chain Sequence
MSKVKSITRESWILSTFPEWGSWLNEEIEQEQVAPGTFAMWWLGCTGIWLKSEGGTNVCVDFWCGTGKQSHGKLQPNLRTTPFVLDPFAIRQIDAVLATHDHNDHIDVNVAAAVMQNCADDVPFIGPKTCVDLWIGWGVPKERCIVVKPGDVVKVKDIEIHALDAFDMDDRAVNYLFKTPGGSLYHSGDSHYSNYYAKHGNEHQIDVALGSYGENPRGITDKMTSADMLRMGEALNAKVVIPFHHDIWSNFQADPQEIRVLWEMKKDRLKYGFKPFIWQVGGKFTWPLDKDNFEYHYPRGFDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-ASCORBATE-6-PHOSPHATE LACTONASE ULAG
publication title Molecular Architecture of the Mn(2+)Dependent Lactonase Ulag Reveals an Rnase-Like Metallo-Beta-Lactamase Fold and a Novel Quaternary Structure.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 94
structure length 303
sequence length 340
chains with identical sequence B, D, E
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13483 Lactamase_B_3 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2wymA00
5ACWA 4AWZA 5HIQA 3SFPA 2BFKA 1K07A 2Q9UA 3T9MA 4UAMA 3JXPA 4C1EA 1ZKPA 4XWTA 5AXOA 5K4MA 5ACPA 5EHTA 4UA4A 3I0VA 2VW8A 4CHLA 5EW0A 5HH5A 4RL2A 5EVDA 4JO0A 3SD9A 1YCFA 3SRXA 4C1HA 5LCFA 3I11A 3PG4A 1ZTCA 4AWYB 5FQAA 4D02A 4UWPB 2QEDA 2WRSA 5LM6A 3SBLA 5A5ZA 4AX0B 5HIPA 5LE1A 4EYLA 4F6HA 3X30A 2YNTB 5EV6A 3DH8A 4P62A 4J5FA 3IOFA 2NZFA 2UYXA 4RAMA 4WD6A 4Z6XA 5K0WA 4XWWA 1KR3A 3MD7A 1E5DA 5ACTA 2XR1A 2FU6A 5HH4A 3RKKA 5AHRA 2BG2A 2NXAA 4NQ2A 4RBSA 4XUKA 4D1TA 2YNVA 4AX1B 4GYUA 4Z5ZA 2FHXB 5KIKA 2AIOA 3X2ZA 4DILA 2BTNA 3Q6VA 5HH6A 2QDTA 3IE0A 2BFZA 5K4KA 2YCBA 1DD6A 1DDKA 4ZO2A 3BK2A 1YCGA 3BC2A 1X8GA 2WYMA 5LMCA 4TZBA 2M5DA 2OHIA 1QH5A 3H3EA 5ACSA 5A0TA 3L6NA 4FSBA 2GFKA 2FM6A 3I14A 1KO2A 1JJEA 1JT1A 2YZ3A 4F6ZA 2BG8B 3KNSA 4C1GA 4PVOA 4NQ4A 2YNUA 4GYQA 4FR7A 2BC2A 3DHBA 1WUOA 2DOOA 1SMLA 2QJSA 2QDSA 5AYAA 5B1UA 5EVBA 3FCZA 2WYLA 4C1CA 3ADRA 2ZZIA 3ESHA 2FK6A 3IOGA 3LVZA 2FU7A 2Q0JA 1VMEA 4Z5YA 1M2XA 3ZR9A 2I7TA 2ZWRA 2BR6A 3R2UA 4BZ3A 4O98A 1ZNBA 2YNWA 2AZ4A 2ZNBA 2E7YA 4FEKA 3PY6A 2M5CA 4D1UA 2R2DA 4EFZA 5ACRA 2WYMC 5IQKA 3P2UA 4U4LA 3ZWFA 3I15A 4LE6A 2Q0IA 2HB9A 4RM5A 2P1EA 2BFLA 4KEPA 2FU9A 3X2XA 4YSBA 3I13A 4HL2A 3T3NA 2OHHA 1WRAA 1MQOA 2QINA 1BMCA 4RAWA 4EXSA 4YSKA 5B15A 3IEKA 3IE2A 3TP9A 1BVTA 2BIBA 3ZNBA 2ZO4A 1Y44A 2A7MA 3BV6A 4C1FA 4HKYA 3QH8A 5EV8A 5FQBA 2I7XA 2YNTA 4UWRB 1WW1A 2FU8A 5LCAA 5LLDA 3DHAA 2Y8AA 3A4YA 4UBQA 1X8HA 2H6AA 5B3RA 3RKJA 4Z7RA 4EYBA 3IELA 4ZNBA 5ACVA 2GKLA 2Q42A 5EH9A 3VPEA 5LS3A 2P18A 5LCHA 2BGAA 4TZ9A 2NYPA 5ACXA 3SW3A 2DKFA 5AHOA 3SPUA 1QH3A 3AJ3A 2FHXA 2BMIA 4ZEJA 5ACUA 1WUPA 3S0ZA 5LSCA 4KEQA 1DXKA 3AF5A 2GFJA 1P9EA 2YNVB 1VJNA 4H0DA 4NQ6A 1A8TA 4NQ5A 1HLKA 4PVTA 3AF6A 4AD9A 1XTOA 1L9YA 4D1WA 4TYFA 4GCWA 3F9OA 2BFZB 3ZQ4A 4TZEA 3VQZA 2Y8BA 4V0HA 4HL1A 3IDZA 2CBNA 3KL7A 2P4ZA 4EXYA 4BP0A 4DIKA 5A87A 3KNRA 3IEMA 5KILA 4Z67A 2BG7A 2BG8A 1KO3A 3G1PA 4TYTA 4UWOB 5ACQA 1VGNA 4B87A 2WHGA 5DPXA 4YSLA 4EY2A 2I7VA 4C09A 2P97A 3IE1A 5AEBA 4J5HA 5AXRA 4C1DA 1A7TA 1BC2A 3PY5A 5EWAA 1JJTA 5HIOA 4UWSB 3WXCA 5HISA 5A0VA 1YCHA 2BG6A 1X8IA 2OHJA 2NZEA 4RL0A 2XF4A 3BK1A 4TZFA 5EVKA 4ZO3A 4EYFA 2Y87A 1XM8A 2GCUA 5K4NA 2GMNA 4Z60A 3T3OA 3X2YA 3DHCA 3FAIA 4D1VA 3RPCA 5FQCA
chains in the Genus database with same CATH superfamily
5ACWA 4AWZA 5HIQA 3SFPA 2BFKA 1K07A 2Q9UA 3T9MA 4UAMA 3JXPA 4C1EA 1ZKPA 4XWTA 5AXOA 5K4MA 5ACPA 5EHTA 4UA4A 3I0VA 4AV7A 2VW8A 4CHLA 4PDXA 5EW0A 5HH5A 4RL2A 5EVDA 4JO0A 3SD9A 1YCFA 3SRXA 4C1HA 5LCFA 3I11A 3PG4A 1ZTCA 4AWYB 5FQAA 4D02A 4UWPB 2QEDA 2WRSA 5LM6A 3SBLA 5A5ZA 4AX0B 2YHEA 5HIPA 5LE1A 4EYLA 4F6HA 3X30A 2YNTB 5EV6A 3DH8A 4P62A 4J5FA 3IOFA 2NZFA 2UYXA 4RAMA 4WD6A 4Z6XA 5K0WA 4XWWA 1KR3A 3MD7A 1E5DA 5ACTA 2XR1A 2FU6A 5HH4A 3RKKA 5AHRA 2BG2A 2NXAA 4NQ2A 4RBSA 4XUKA 4D1TA 2YNVA 4AX1B 4GYUA 4Z5ZA 2FHXB 5KIKA 2AIOA 3X2ZA 4DILA 2BTNA 3Q6VA 5HH6A 2QDTA 3IE0A 2BFZA 5K4KA 2YCBA 1DD6A 1DDKA 4ZO2A 3BK2A 1YCGA 3BC2A 1X8GA 2WYMA 5LMCA 4TZBA 2M5DA 2OHIA 1QH5A 3H3EA 5ACSA 5A0TA 3L6NA 4FSBA 2GFKA 2FM6A 3I14A 1KO2A 1JJEA 1JT1A 2YZ3A 4F6ZA 2BG8B 3KNSA 4C1GA 4PVOA 4NQ4A 2YNUA 4GYQA 4FR7A 2BC2A 3DHBA 1WUOA 2DOOA 1SMLA 2QJSA 2QDSA 5AYAA 5A23A 5B1UA 5EVBA 3FCZA 2WYLA 4C1CA 3ADRA 2ZZIA 3ESHA 2FK6A 3IOGA 3LVZA 2FU7A 2Q0JA 1VMEA 4Z5YA 1M2XA 3ZR9A 2I7TA 2ZWRA 2BR6A 5AIJA 3R2UA 4BZ3A 4O98A 1ZNBA 2YNWA 2AZ4A 2ZNBA 2E7YA 4FEKA 2CG3A 3PY6A 2M5CA 4D1UA 2R2DA 4EFZA 5ACRA 2WYMC 5IQKA 3P2UA 4U4LA 3ZWFA 3I15A 4LE6A 2Q0IA 2HB9A 4RM5A 2P1EA 2BFLA 4KEPA 2FU9A 3X2XA 4YSBA 3I13A 4HL2A 3T3NA 2OHHA 1WRAA 1MQOA 2QINA 1BMCA 4RAWA 4EXSA 4YSKA 5B15A 3IEKA 3IE2A 3TP9A 1BVTA 2CG2A 2BIBA 3ZNBA 2ZO4A 1Y44A 2A7MA 3BV6A 4C1FA 4HKYA 3QH8A 5EV8A 5FQBA 2I7XA 2YNTA 4UWRB 1WW1A 2FU8A 5LCAA 5LLDA 3DHAA 2Y8AA 3A4YA 4UBQA 1X8HA 2H6AA 5B3RA 3RKJA 4Z7RA 4EYBA 3IELA 4ZNBA 5ACVA 2GKLA 2Q42A 5EH9A 3VPEA 5LS3A 2P18A 5LCHA 2BGAA 4TZ9A 2NYPA 5ACXA 3SW3A 2DKFA 5AHOA 3SPUA 1QH3A 3AJ3A 2FHXA 2BMIA 4ZEJA 5ACUA 1WUPA 3S0ZA 5LSCA 4KEQA 1DXKA 3AF5A 2GFJA 1P9EA 2YNVB 1VJNA 4H0DA 4AXHA 4NQ6A 1A8TA 4NQ5A 1HLKA 4PVTA 3AF6A 4AD9A 1XTOA 1L9YA 4D1WA 4TYFA 4GCWA 3F9OA 2BFZB 3ZQ4A 4TZEA 3VQZA 2Y8BA 4V0HA 4HL1A 3IDZA 2CBNA 3KL7A 2P4ZA 4EXYA 4BP0A 4DIKA 5A87A 3KNRA 3IEMA 2CFUA 5KILA 4Z67A 2BG7A 4NURA 2BG8A 1KO3A 3G1PA 4TYTA 4UWOB 5ACQA 1VGNA 4B87A 2WHGA 5DPXA 4YSLA 4EY2A 2I7VA 4C09A 2P97A 3IE1A 5AEBA 4J5HA 5AXRA 4C1DA 1A7TA 1BC2A 3PY5A 5EWAA 1JJTA 5HIOA 2CFZA 4UWSB 3WXCA 5HISA 5A0VA 1YCHA 2BG6A 1X8IA 5AJLA 2OHJA 2NZEA 4RL0A 2XF4A 3BK1A 4TZFA 5EVKA 4ZO3A 4EYFA 2Y87A 1XM8A 2GCUA 5K4NA 2GMNA 4Z60A 3T3OA 3X2YA 3DHCA 3FAIA 4D1VA 3RPCA 5FQCA
chains in the Genus database with same CATH topology
5ACWA 4AWZA 5HIQA 3SFPA 2BFKA 1K07A 2Q9UA 3T9MA 4UAMA 3JXPA 4C1EA 1ZKPA 4XWTA 5AXOA 5K4MA 5ACPA 5EHTA 4UA4A 3I0VA 2VW8A 4CHLA 5EW0A 5HH5A 4RL2A 5EVDA 4JO0A 3SD9A 1YCFA 3SRXA 4C1HA 5LCFA 3I11A 3PG4A 1ZTCA 4AWYB 5FQAA 4D02A 4UWPB 2QEDA 2WRSA 5LM6A 3SBLA 5A5ZA 4AX0B 5HIPA 5LE1A 4EYLA 4F6HA 3X30A 2YNTB 5EV6A 3DH8A 4P62A 4J5FA 3IOFA 2NZFA 2UYXA 4RAMA 4WD6A 4Z6XA 5K0WA 4XWWA 1KR3A 3MD7A 1E5DA 5ACTA 2XR1A 2FU6A 5HH4A 3RKKA 5AHRA 2BG2A 2NXAA 4NQ2A 4RBSA 4XUKA 4D1TA 2YNVA 4AX1B 4GYUA 4Z5ZA 2FHXB 5KIKA 2AIOA 3X2ZA 4DILA 2BTNA 3Q6VA 5HH6A 2QDTA 3IE0A 2BFZA 5K4KA 2YCBA 1DD6A 1DDKA 4ZO2A 3BK2A 1YCGA 3BC2A 1X8GA 2WYMA 5LMCA 4TZBA 2M5DA 2OHIA 1QH5A 3H3EA 5ACSA 5A0TA 3L6NA 4FSBA 2GFKA 2FM6A 3I14A 1KO2A 1JJEA 1JT1A 2YZ3A 4F6ZA 2BG8B 3KNSA 4C1GA 4PVOA 4NQ4A 2YNUA 4GYQA 4FR7A 2BC2A 3DHBA 1WUOA 2DOOA 1SMLA 2QJSA 2QDSA 5AYAA 5B1UA 5EVBA 3FCZA 2WYLA 4C1CA 3ADRA 2ZZIA 3ESHA 2FK6A 3IOGA 3LVZA 2FU7A 2Q0JA 1VMEA 4Z5YA 1M2XA 3ZR9A 2I7TA 2ZWRA 2BR6A 3R2UA 4BZ3A 4O98A 1ZNBA 2YNWA 2AZ4A 2ZNBA 2E7YA 4FEKA 3PY6A 2M5CA 4D1UA 2R2DA 4EFZA 5ACRA 2WYMC 5IQKA 3P2UA 4U4LA 3ZWFA 3I15A 4LE6A 2Q0IA 2HB9A 4RM5A 2P1EA 2BFLA 4KEPA 2FU9A 3X2XA 4YSBA 3I13A 4HL2A 3T3NA 2OHHA 1WRAA 1MQOA 2QINA 1BMCA 4RAWA 4EXSA 4YSKA 5B15A 3IEKA 3IE2A 3TP9A 1BVTA 2BIBA 3ZNBA 2ZO4A 1Y44A 2A7MA 3BV6A 4C1FA 4HKYA 3QH8A 5EV8A 5FQBA 2I7XA 2YNTA 4UWRB 1WW1A 2FU8A 5LCAA 5LLDA 3DHAA 2Y8AA 3A4YA 4UBQA 1X8HA 2H6AA 5B3RA 3RKJA 4Z7RA 4EYBA 3IELA 4ZNBA 5ACVA 2GKLA 2Q42A 5EH9A 3VPEA 5LS3A 2P18A 5LCHA 2BGAA 4TZ9A 2NYPA 5ACXA 3SW3A 2DKFA 5AHOA 3SPUA 1QH3A 3AJ3A 2FHXA 2BMIA 4ZEJA 5ACUA 1WUPA 3S0ZA 5LSCA 4KEQA 1DXKA 3AF5A 2GFJA 1P9EA 2YNVB 1VJNA 4H0DA 4NQ6A 1A8TA 4NQ5A 1HLKA 4PVTA 3AF6A 4AD9A 1XTOA 1L9YA 4D1WA 4TYFA 4GCWA 3F9OA 2BFZB 3ZQ4A 4TZEA 3VQZA 2Y8BA 4V0HA 4HL1A 3IDZA 2CBNA 3KL7A 2P4ZA 4EXYA 4BP0A 4DIKA 5A87A 3KNRA 3IEMA 5KILA 4Z67A 2BG7A 2BG8A 1KO3A 3G1PA 4TYTA 4UWOB 5ACQA 1VGNA 4B87A 2WHGA 5DPXA 4YSLA 4EY2A 2I7VA 4C09A 2P97A 3IE1A 5AEBA 4J5HA 5AXRA 4C1DA 1A7TA 1BC2A 3PY5A 5EWAA 1JJTA 5HIOA 4UWSB 3WXCA 5HISA 5A0VA 1YCHA 2BG6A 1X8IA 2OHJA 2NZEA 4RL0A 2XF4A 3BK1A 4TZFA 5EVKA 4ZO3A 4EYFA 2Y87A 1XM8A 2GCUA 5K4NA 2GMNA 4Z60A 3T3OA 3X2YA 3DHCA 3FAIA 4D1VA 3RPCA 5FQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ACW A;  4AWZ A;  5HIQ A;  3SFP A;  2BFK A;  1K07 A;  2Q9U A;  3T9M A;  4UAM A;  3JXP A;  4C1E A;  1ZKP A;  4XWT A;  5AXO A;  5K4M A;  5ACP A;  5EHT A;  4UA4 A;  3I0V A;  2VW8 A;  4CHL A;  5EW0 A;  5HH5 A;  4RL2 A;  5EVD A;  4JO0 A;  3SD9 A;  1YCF A;  3SRX A;  4C1H A;  5LCF A;  3I11 A;  3PG4 A;  1ZTC A;  4AWY B;  5FQA A;  4D02 A;  4UWP B;  2QED A;  2WRS A;  5LM6 A;  3SBL A;  5A5Z A;  4AX0 B;  5HIP A;  5LE1 A;  4EYL A;  4F6H A;  3X30 A;  2YNT B;  5EV6 A;  3DH8 A;  4P62 A;  4J5F A;  3IOF A;  2NZF A;  2UYX A;  4RAM A;  4WD6 A;  4Z6X A;  5K0W A;  4XWW A;  1KR3 A;  3MD7 A;  1E5D A;  5ACT A;  2XR1 A;  2FU6 A;  5HH4 A;  3RKK A;  5AHR A;  2BG2 A;  2NXA A;  4NQ2 A;  4RBS A;  4XUK A;  4D1T A;  2YNV A;  4AX1 B;  4GYU A;  4Z5Z A;  2FHX B;  5KIK A;  2AIO A;  3X2Z A;  4DIL A;  2BTN A;  3Q6V A;  5HH6 A;  2QDT A;  3IE0 A;  2BFZ A;  5K4K A;  2YCB A;  1DD6 A;  1DDK A;  4ZO2 A;  3BK2 A;  1YCG A;  3BC2 A;  1X8G A;  2WYM A;  5LMC A;  4TZB A;  2M5D A;  2OHI A;  1QH5 A;  3H3E A;  5ACS A;  5A0T A;  3L6N A;  4FSB A;  2GFK A;  2FM6 A;  3I14 A;  1KO2 A;  1JJE A;  1JT1 A;  2YZ3 A;  4F6Z A;  2BG8 B;  3KNS A;  4C1G A;  4PVO A;  4NQ4 A;  2YNU A;  4GYQ A;  4FR7 A;  2BC2 A;  3DHB A;  1WUO A;  2DOO A;  1SML A;  2QJS A;  2QDS A;  5AYA A;  5B1U A;  5EVB A;  3FCZ A;  2WYL A;  4C1C A;  3ADR A;  2ZZI A;  3ESH A;  2FK6 A;  3IOG A;  3LVZ A;  2FU7 A;  2Q0J A;  1VME A;  4Z5Y A;  1M2X A;  3ZR9 A;  2I7T A;  2ZWR A;  2BR6 A;  3R2U A;  4BZ3 A;  4O98 A;  1ZNB A;  2YNW A;  2AZ4 A;  2ZNB A;  2E7Y A;  4FEK A;  3PY6 A;  2M5C A;  4D1U A;  2R2D A;  4EFZ A;  5ACR A;  2WYM C;  5IQK A;  3P2U A;  4U4L A;  3ZWF A;  3I15 A;  4LE6 A;  2Q0I A;  2HB9 A;  4RM5 A;  2P1E A;  2BFL A;  4KEP A;  2FU9 A;  3X2X A;  4YSB A;  3I13 A;  4HL2 A;  3T3N A;  2OHH A;  1WRA A;  1MQO A;  2QIN A;  1BMC A;  4RAW A;  4EXS A;  4YSK A;  5B15 A;  3IEK A;  3IE2 A;  3TP9 A;  1BVT A;  2BIB A;  3ZNB A;  2ZO4 A;  1Y44 A;  2A7M A;  3BV6 A;  4C1F A;  4HKY A;  3QH8 A;  5EV8 A;  5FQB A;  2I7X A;  2YNT A;  4UWR B;  1WW1 A;  2FU8 A;  5LCA A;  5LLD A;  3DHA A;  2Y8A A;  3A4Y A;  4UBQ A;  1X8H A;  2H6A A;  5B3R A;  3RKJ A;  4Z7R A;  4EYB A;  3IEL A;  4ZNB A;  5ACV A;  2GKL A;  2Q42 A;  5EH9 A;  3VPE A;  5LS3 A;  2P18 A;  5LCH A;  2BGA A;  4TZ9 A;  2NYP A;  5ACX A;  3SW3 A;  2DKF A;  5AHO A;  3SPU A;  1QH3 A;  3AJ3 A;  2FHX A;  2BMI A;  4ZEJ A;  5ACU A;  1WUP A;  3S0Z A;  5LSC A;  4KEQ A;  1DXK A;  3AF5 A;  2GFJ A;  1P9E A;  2YNV B;  1VJN A;  4H0D A;  4NQ6 A;  1A8T A;  4NQ5 A;  1HLK A;  4PVT A;  3AF6 A;  4AD9 A;  1XTO A;  1L9Y A;  4D1W A;  4TYF A;  4GCW A;  3F9O A;  2BFZ B;  3ZQ4 A;  4TZE A;  3VQZ A;  2Y8B A;  4V0H A;  4HL1 A;  3IDZ A;  2CBN A;  3KL7 A;  2P4Z A;  4EXY A;  4BP0 A;  4DIK A;  5A87 A;  3KNR A;  3IEM A;  5KIL A;  4Z67 A;  2BG7 A;  2BG8 A;  1KO3 A;  3G1P A;  4TYT A;  4UWO B;  5ACQ A;  1VGN A;  4B87 A;  2WHG A;  5DPX A;  4YSL A;  4EY2 A;  2I7V A;  4C09 A;  2P97 A;  3IE1 A;  5AEB A;  4J5H A;  5AXR A;  4C1D A;  1A7T A;  1BC2 A;  3PY5 A;  5EWA A;  1JJT A;  5HIO A;  4UWS B;  3WXC A;  5HIS A;  5A0V A;  1YCH A;  2BG6 A;  1X8I A;  2OHJ A;  2NZE A;  4RL0 A;  2XF4 A;  3BK1 A;  4TZF A;  5EVK A;  4ZO3 A;  4EYF A;  2Y87 A;  1XM8 A;  2GCU A;  5K4N A;  2GMN A;  4Z60 A;  3T3O A;  3X2Y A;  3DHC A;  3FAI A;  4D1V A;  3RPC A;  5FQC A; 
#chains in the Genus database with same CATH topology
 5ACW A;  4AWZ A;  5HIQ A;  3SFP A;  2BFK A;  1K07 A;  2Q9U A;  3T9M A;  4UAM A;  3JXP A;  4C1E A;  1ZKP A;  4XWT A;  5AXO A;  5K4M A;  5ACP A;  5EHT A;  4UA4 A;  3I0V A;  4AV7 A;  2VW8 A;  4CHL A;  4PDX A;  5EW0 A;  5HH5 A;  4RL2 A;  5EVD A;  4JO0 A;  3SD9 A;  1YCF A;  3SRX A;  4C1H A;  5LCF A;  3I11 A;  3PG4 A;  1ZTC A;  4AWY B;  5FQA A;  4D02 A;  4UWP B;  2QED A;  2WRS A;  5LM6 A;  3SBL A;  5A5Z A;  4AX0 B;  2YHE A;  5HIP A;  5LE1 A;  4EYL A;  4F6H A;  3X30 A;  2YNT B;  5EV6 A;  3DH8 A;  4P62 A;  4J5F A;  3IOF A;  2NZF A;  2UYX A;  4RAM A;  4WD6 A;  4Z6X A;  5K0W A;  4XWW A;  1KR3 A;  3MD7 A;  1E5D A;  5ACT A;  2XR1 A;  2FU6 A;  5HH4 A;  3RKK A;  5AHR A;  2BG2 A;  2NXA A;  4NQ2 A;  4RBS A;  4XUK A;  4D1T A;  2YNV A;  4AX1 B;  4GYU A;  4Z5Z A;  2FHX B;  5KIK A;  2AIO A;  3X2Z A;  4DIL A;  2BTN A;  3Q6V A;  5HH6 A;  2QDT A;  3IE0 A;  2BFZ A;  5K4K A;  2YCB A;  1DD6 A;  1DDK A;  4ZO2 A;  3BK2 A;  1YCG A;  3BC2 A;  1X8G A;  2WYM A;  5LMC A;  4TZB A;  2M5D A;  2OHI A;  1QH5 A;  3H3E A;  5ACS A;  5A0T A;  3L6N A;  4FSB A;  2GFK A;  2FM6 A;  3I14 A;  1KO2 A;  1JJE A;  1JT1 A;  2YZ3 A;  4F6Z A;  2BG8 B;  3KNS A;  4C1G A;  4PVO A;  4NQ4 A;  2YNU A;  4GYQ A;  4FR7 A;  2BC2 A;  3DHB A;  1WUO A;  2DOO A;  1SML A;  2QJS A;  2QDS A;  5AYA A;  5A23 A;  5B1U A;  5EVB A;  3FCZ A;  2WYL A;  4C1C A;  3ADR A;  2ZZI A;  3ESH A;  2FK6 A;  3IOG A;  3LVZ A;  2FU7 A;  2Q0J A;  1VME A;  4Z5Y A;  1M2X A;  3ZR9 A;  2I7T A;  2ZWR A;  2BR6 A;  5AIJ A;  3R2U A;  4BZ3 A;  4O98 A;  1ZNB A;  2YNW A;  2AZ4 A;  2ZNB A;  2E7Y A;  4FEK A;  2CG3 A;  3PY6 A;  2M5C A;  4D1U A;  2R2D A;  4EFZ A;  5ACR A;  2WYM C;  5IQK A;  3P2U A;  4U4L A;  3ZWF A;  3I15 A;  4LE6 A;  2Q0I A;  2HB9 A;  4RM5 A;  2P1E A;  2BFL A;  4KEP A;  2FU9 A;  3X2X A;  4YSB A;  3I13 A;  4HL2 A;  3T3N A;  2OHH A;  1WRA A;  1MQO A;  2QIN A;  1BMC A;  4RAW A;  4EXS A;  4YSK A;  5B15 A;  3IEK A;  3IE2 A;  3TP9 A;  1BVT A;  2CG2 A;  2BIB A;  3ZNB A;  2ZO4 A;  1Y44 A;  2A7M A;  3BV6 A;  4C1F A;  4HKY A;  3QH8 A;  5EV8 A;  5FQB A;  2I7X A;  2YNT A;  4UWR B;  1WW1 A;  2FU8 A;  5LCA A;  5LLD A;  3DHA A;  2Y8A A;  3A4Y A;  4UBQ A;  1X8H A;  2H6A A;  5B3R A;  3RKJ A;  4Z7R A;  4EYB A;  3IEL A;  4ZNB A;  5ACV A;  2GKL A;  2Q42 A;  5EH9 A;  3VPE A;  5LS3 A;  2P18 A;  5LCH A;  2BGA A;  4TZ9 A;  2NYP A;  5ACX A;  3SW3 A;  2DKF A;  5AHO A;  3SPU A;  1QH3 A;  3AJ3 A;  2FHX A;  2BMI A;  4ZEJ A;  5ACU A;  1WUP A;  3S0Z A;  5LSC A;  4KEQ A;  1DXK A;  3AF5 A;  2GFJ A;  1P9E A;  2YNV B;  1VJN A;  4H0D A;  4AXH A;  4NQ6 A;  1A8T A;  4NQ5 A;  1HLK A;  4PVT A;  3AF6 A;  4AD9 A;  1XTO A;  1L9Y A;  4D1W A;  4TYF A;  4GCW A;  3F9O A;  2BFZ B;  3ZQ4 A;  4TZE A;  3VQZ A;  2Y8B A;  4V0H A;  4HL1 A;  3IDZ A;  2CBN A;  3KL7 A;  2P4Z A;  4EXY A;  4BP0 A;  4DIK A;  5A87 A;  3KNR A;  3IEM A;  2CFU A;  5KIL A;  4Z67 A;  2BG7 A;  4NUR A;  2BG8 A;  1KO3 A;  3G1P A;  4TYT A;  4UWO B;  5ACQ A;  1VGN A;  4B87 A;  2WHG A;  5DPX A;  4YSL A;  4EY2 A;  2I7V A;  4C09 A;  2P97 A;  3IE1 A;  5AEB A;  4J5H A;  5AXR A;  4C1D A;  1A7T A;  1BC2 A;  3PY5 A;  5EWA A;  1JJT A;  5HIO A;  2CFZ A;  4UWS B;  3WXC A;  5HIS A;  5A0V A;  1YCH A;  2BG6 A;  1X8I A;  5AJL A;  2OHJ A;  2NZE A;  4RL0 A;  2XF4 A;  3BK1 A;  4TZF A;  5EVK A;  4ZO3 A;  4EYF A;  2Y87 A;  1XM8 A;  2GCU A;  5K4N A;  2GMN A;  4Z60 A;  3T3O A;  3X2Y A;  3DHC A;  3FAI A;  4D1V A;  3RPC A;  5FQC A; 
#chains in the Genus database with same CATH homology
 5ACW A;  4AWZ A;  5HIQ A;  3SFP A;  2BFK A;  1K07 A;  2Q9U A;  3T9M A;  4UAM A;  3JXP A;  4C1E A;  1ZKP A;  4XWT A;  5AXO A;  5K4M A;  5ACP A;  5EHT A;  4UA4 A;  3I0V A;  2VW8 A;  4CHL A;  5EW0 A;  5HH5 A;  4RL2 A;  5EVD A;  4JO0 A;  3SD9 A;  1YCF A;  3SRX A;  4C1H A;  5LCF A;  3I11 A;  3PG4 A;  1ZTC A;  4AWY B;  5FQA A;  4D02 A;  4UWP B;  2QED A;  2WRS A;  5LM6 A;  3SBL A;  5A5Z A;  4AX0 B;  5HIP A;  5LE1 A;  4EYL A;  4F6H A;  3X30 A;  2YNT B;  5EV6 A;  3DH8 A;  4P62 A;  4J5F A;  3IOF A;  2NZF A;  2UYX A;  4RAM A;  4WD6 A;  4Z6X A;  5K0W A;  4XWW A;  1KR3 A;  3MD7 A;  1E5D A;  5ACT A;  2XR1 A;  2FU6 A;  5HH4 A;  3RKK A;  5AHR A;  2BG2 A;  2NXA A;  4NQ2 A;  4RBS A;  4XUK A;  4D1T A;  2YNV A;  4AX1 B;  4GYU A;  4Z5Z A;  2FHX B;  5KIK A;  2AIO A;  3X2Z A;  4DIL A;  2BTN A;  3Q6V A;  5HH6 A;  2QDT A;  3IE0 A;  2BFZ A;  5K4K A;  2YCB A;  1DD6 A;  1DDK A;  4ZO2 A;  3BK2 A;  1YCG A;  3BC2 A;  1X8G A;  2WYM A;  5LMC A;  4TZB A;  2M5D A;  2OHI A;  1QH5 A;  3H3E A;  5ACS A;  5A0T A;  3L6N A;  4FSB A;  2GFK A;  2FM6 A;  3I14 A;  1KO2 A;  1JJE A;  1JT1 A;  2YZ3 A;  4F6Z A;  2BG8 B;  3KNS A;  4C1G A;  4PVO A;  4NQ4 A;  2YNU A;  4GYQ A;  4FR7 A;  2BC2 A;  3DHB A;  1WUO A;  2DOO A;  1SML A;  2QJS A;  2QDS A;  5AYA A;  5B1U A;  5EVB A;  3FCZ A;  2WYL A;  4C1C A;  3ADR A;  2ZZI A;  3ESH A;  2FK6 A;  3IOG A;  3LVZ A;  2FU7 A;  2Q0J A;  1VME A;  4Z5Y A;  1M2X A;  3ZR9 A;  2I7T A;  2ZWR A;  2BR6 A;  3R2U A;  4BZ3 A;  4O98 A;  1ZNB A;  2YNW A;  2AZ4 A;  2ZNB A;  2E7Y A;  4FEK A;  3PY6 A;  2M5C A;  4D1U A;  2R2D A;  4EFZ A;  5ACR A;  2WYM C;  5IQK A;  3P2U A;  4U4L A;  3ZWF A;  3I15 A;  4LE6 A;  2Q0I A;  2HB9 A;  4RM5 A;  2P1E A;  2BFL A;  4KEP A;  2FU9 A;  3X2X A;  4YSB A;  3I13 A;  4HL2 A;  3T3N A;  2OHH A;  1WRA A;  1MQO A;  2QIN A;  1BMC A;  4RAW A;  4EXS A;  4YSK A;  5B15 A;  3IEK A;  3IE2 A;  3TP9 A;  1BVT A;  2BIB A;  3ZNB A;  2ZO4 A;  1Y44 A;  2A7M A;  3BV6 A;  4C1F A;  4HKY A;  3QH8 A;  5EV8 A;  5FQB A;  2I7X A;  2YNT A;  4UWR B;  1WW1 A;  2FU8 A;  5LCA A;  5LLD A;  3DHA A;  2Y8A A;  3A4Y A;  4UBQ A;  1X8H A;  2H6A A;  5B3R A;  3RKJ A;  4Z7R A;  4EYB A;  3IEL A;  4ZNB A;  5ACV A;  2GKL A;  2Q42 A;  5EH9 A;  3VPE A;  5LS3 A;  2P18 A;  5LCH A;  2BGA A;  4TZ9 A;  2NYP A;  5ACX A;  3SW3 A;  2DKF A;  5AHO A;  3SPU A;  1QH3 A;  3AJ3 A;  2FHX A;  2BMI A;  4ZEJ A;  5ACU A;  1WUP A;  3S0Z A;  5LSC A;  4KEQ A;  1DXK A;  3AF5 A;  2GFJ A;  1P9E A;  2YNV B;  1VJN A;  4H0D A;  4NQ6 A;  1A8T A;  4NQ5 A;  1HLK A;  4PVT A;  3AF6 A;  4AD9 A;  1XTO A;  1L9Y A;  4D1W A;  4TYF A;  4GCW A;  3F9O A;  2BFZ B;  3ZQ4 A;  4TZE A;  3VQZ A;  2Y8B A;  4V0H A;  4HL1 A;  3IDZ A;  2CBN A;  3KL7 A;  2P4Z A;  4EXY A;  4BP0 A;  4DIK A;  5A87 A;  3KNR A;  3IEM A;  5KIL A;  4Z67 A;  2BG7 A;  2BG8 A;  1KO3 A;  3G1P A;  4TYT A;  4UWO B;  5ACQ A;  1VGN A;  4B87 A;  2WHG A;  5DPX A;  4YSL A;  4EY2 A;  2I7V A;  4C09 A;  2P97 A;  3IE1 A;  5AEB A;  4J5H A;  5AXR A;  4C1D A;  1A7T A;  1BC2 A;  3PY5 A;  5EWA A;  1JJT A;  5HIO A;  4UWS B;  3WXC A;  5HIS A;  5A0V A;  1YCH A;  2BG6 A;  1X8I A;  2OHJ A;  2NZE A;  4RL0 A;  2XF4 A;  3BK1 A;  4TZF A;  5EVK A;  4ZO3 A;  4EYF A;  2Y87 A;  1XM8 A;  2GCU A;  5K4N A;  2GMN A;  4Z60 A;  3T3O A;  3X2Y A;  3DHC A;  3FAI A;  4D1V A;  3RPC A;  5FQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...