2WYMA

Structure of a metallo-b-lactamase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
340
structure length
303
Chain Sequence
b'MSKVKSITRESWILSTFPEWGSWLNEEIEQEQVAPGTFAMWWLGCTGIWLKSEGGTNVCVDFWCGTGKQSHGKLQPNLRTTPFVLDPFAIRQIDAVLATHDHNDHIDVNVAAAVMQNCADDVPFIGPKTCVDLWIGWGVPKERCIVVKPGDVVKVKDIEIHALDAFDMDDRAVNYLFKTPGGSLYHSGDSHYSNYYAKHGNEHQIDVALGSYGENPRGITDKMTSADMLRMGEALNAKVVIPFHHDIWSNFQADPQEIRVLWEMKKDRLKYGFKPFIWQVGGKFTWPLDKDNFEYHYPRGFDD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-ASCORBATE-6-PHOSPHATE LACTONASE ULAG
publication title Molecular Architecture of the Mn(2+)Dependent Lactonase Ulag Reveals an Rnase-Like Metallo-Beta-Lactamase Fold and a Novel Quaternary Structure.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 94
structure length 303
sequence length 340
chains with identical sequence B, D, E
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13483 Lactamase_B_3 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2wymA00
1JJEA 4GYQA 4AD9A 4RL0A 4XUKA 5AYAA 4C1GA 4C1CA 1DXKA 1HLKA 2YNVB 3I0VA 4TYTA 2I7TA 4C1HA 3MD7A 4J5FA 2Y8BA 1X8IA 4NQ4A 5AEBA 3TP9A 2GFJA 2YNVA 3T3OA 4BZ3A 2NXAA 5K4KA 5KILA 2AIOA 1DDKA 4Z5ZA 1E5DA 3IEMA 2WYLA 1X8GA 2I7XA 4NQ5A 4RL2A 5FQAA 4F6HA 5EV6A 3A4YA 2H6AA 5A0VA 2BGAA 5ACVA 4DILA 4DIKA 1VJNA 4HKYA 3IELA 3SPUA 4C09A 2Y8AA 2OHIA 2YCBA 3IE1A 4UBQA 4EY2A 2XF4A 4TZBA 2GKLA 1KR3A 4Z67A 1WUPA 5IQKA 2CBNA 4UA4A 2FU9A 1BVTA 3ZR9A 3BC2A 5HH5A 1YCGA 1BMCA 3QH8A 5ACRA 3DHBA 1KO3A 1WW1A 2Q42A 2XR1A 4NQ2A 4YSLA 5HISA 3BK1A 3WXCA 4FEKA 1KO2A 4Z6XA 1M2XA 2QEDA 3X2XA 1MQOA 5ACUA 4TZEA 3P2UA 4O98A 1X8HA 2OHHA 1SMLA 1WUOA 4WD6A 2NZEA 2ZZIA 3IDZA 2P18A 2WHGA 4AX0B 3X2YA 3IE0A 3IEKA 4PVOA 2WYMC 2BTNA 2BR6A 2GMNA 3RKJA 5EVDA 3ESHA 4B87A 4ZO2A 4C1FA 5LLDA 5EV8A 3T3NA 4Z5YA 3I11A 3X30A 5ACQA 3IOGA 3T9MA 3IOFA 3BV6A 3FCZA 2QINA 1Y44A 3ZQ4A 5K4MA 3DHCA 2P4ZA 2WRSA 5EH9A 4PVTA 2BG8B 2BFLA 4HL1A 4LE6A 1YCHA 4FSBA 4TYFA 4NQ6A 5LE1A 2BIBA 3L6NA 3RPCA 4XWTA 4Z7RA 1XTOA 4TZ9A 5LCFA 3I13A 3F9OA 2E7YA 4F6ZA 2QDSA 4JO0A 2HB9A 2A7MA 3JXPA 4RAMA 1L9YA 3Q6VA 3KL7A 1BC2A 5FQBA 2YNTB 2OHJA 3SFPA 2YZ3A 2FK6A 3H3EA 2BFZB 5HH6A 2YNTA 4RBSA 4KEPA 4Z60A 4GYUA 2BFZA 4D1WA 5B3RA 4ZNBA 2ZWRA 2M5DA 3KNRA 4UWOB 3ZWFA 4YSKA 1P9EA 5ACPA 4EFZA 5AXOA 5LMCA 4UAMA 5K4NA 2NZFA 4EYFA 4UWRB 5LCAA 3VPEA 2Q9UA 3PY5A 2Q0IA 3AJ3A 5LCHA 1ZKPA 3PY6A 4TZFA 2QJSA 4EYBA 5EVBA 4J5HA 2BMIA 3SBLA 1JT1A 4V0HA 5FQCA 1QH5A 3AF5A 2GCUA 1VMEA 5HIOA 5LSCA 5AXRA 2Q0JA 5HIPA 4CHLA 5ACWA 4RAWA 2QDTA 4RM5A 4HL2A 5ACXA 2FHXB 5A5ZA 3SD9A 2YNUA 4BP0A 3LVZA 4AWZA 1K07A 2FHXA 2BG8A 5EVKA 5KIKA 2AZ4A 5DPXA 3X2ZA 2M5CA 1XM8A 5EWAA 3G1PA 4ZEJA 2BG6A 5ACSA 5EW0A 4UWSB 5LM6A 1ZNBA 2DKFA 2I7VA 4EXYA 3R2UA 1A7TA 4XWWA 3DHAA 5A87A 3FAIA 2NYPA 3RKKA 5K0WA 3SW3A 3S0ZA 4C1DA 2ZNBA 2UYXA 3VQZA 4GCWA 2Y87A 4FR7A 5EHTA 2FU7A 3ADRA 2GFKA 2BG2A 3SRXA 2P97A 2R2DA 2BC2A 1DD6A 4UWPB 4P62A 5HH4A 4ZO3A 1ZTCA 4YSBA 2ZO4A 1VGNA 1A8TA 5LS3A 5HIQA 3IE2A 3I14A 4EYLA 4AWYB 3AF6A 3PG4A 3DH8A 1JJTA 4KEQA 3BK2A 2P1EA 2DOOA 3I15A 5A0TA 5B15A 5AHOA 4H0DA 4D02A 5AHRA 5B1UA 3KNSA 4EXSA 1WRAA 4D1VA 3ZNBA 4C1EA 2BG7A 2YNWA 4AX1B 2VW8A 4D1TA 2FU6A 4D1UA 2FM6A 2BFKA 5ACTA 1QH3A 2WYMA 2FU8A 4U4LA 1YCFA
chains in the Genus database with same CATH superfamily
1JJEA 4GYQA 4AD9A 4RL0A 4XUKA 5AYAA 4C1GA 4C1CA 1DXKA 1HLKA 2YNVB 3I0VA 4TYTA 2I7TA 4C1HA 3MD7A 4J5FA 2Y8BA 1X8IA 4NQ4A 5AEBA 3TP9A 2GFJA 2YNVA 3T3OA 4BZ3A 2NXAA 5K4KA 5AJLA 5KILA 2AIOA 1DDKA 4Z5ZA 1E5DA 3IEMA 2WYLA 1X8GA 2I7XA 4NQ5A 4RL2A 5FQAA 4F6HA 5EV6A 3A4YA 2H6AA 5A0VA 2BGAA 5ACVA 4DILA 4AV7A 4DIKA 1VJNA 4HKYA 3IELA 3SPUA 4C09A 2Y8AA 2OHIA 2YCBA 3IE1A 4UBQA 4EY2A 2XF4A 4TZBA 2GKLA 1KR3A 4Z67A 1WUPA 5IQKA 2CBNA 4UA4A 2FU9A 1BVTA 3ZR9A 3BC2A 5HH5A 1YCGA 1BMCA 3QH8A 5ACRA 3DHBA 1KO3A 1WW1A 2Q42A 2XR1A 4NQ2A 4YSLA 5HISA 3BK1A 3WXCA 4FEKA 1KO2A 4Z6XA 1M2XA 2QEDA 3X2XA 1MQOA 5ACUA 5A23A 4TZEA 3P2UA 4O98A 1X8HA 2OHHA 1SMLA 1WUOA 4WD6A 2NZEA 2ZZIA 3IDZA 2P18A 2WHGA 4AX0B 3X2YA 3IE0A 3IEKA 4PVOA 2WYMC 5AIJA 2BTNA 2BR6A 2GMNA 3RKJA 5EVDA 3ESHA 4B87A 4ZO2A 4C1FA 5LLDA 5EV8A 3T3NA 4Z5YA 3I11A 3X30A 5ACQA 3IOGA 3T9MA 3IOFA 3BV6A 3FCZA 2QINA 1Y44A 3ZQ4A 5K4MA 3DHCA 2P4ZA 2WRSA 5EH9A 4PVTA 2BG8B 2BFLA 4HL1A 4LE6A 1YCHA 4FSBA 4TYFA 4NQ6A 5LE1A 2BIBA 3L6NA 3RPCA 4XWTA 4Z7RA 1XTOA 4TZ9A 5LCFA 3I13A 3F9OA 2E7YA 4F6ZA 2QDSA 4JO0A 2HB9A 2A7MA 3JXPA 4RAMA 1L9YA 3Q6VA 3KL7A 1BC2A 5FQBA 2YNTB 2OHJA 3SFPA 2YZ3A 2CG2A 3H3EA 2FK6A 2BFZB 5HH6A 2YNTA 4RBSA 4KEPA 4Z60A 4GYUA 2BFZA 4D1WA 5B3RA 2CFZA 4ZNBA 2ZWRA 2M5DA 3KNRA 4UWOB 3ZWFA 2CG3A 4YSKA 1P9EA 5ACPA 4EFZA 5AXOA 5LMCA 4UAMA 5K4NA 2NZFA 4EYFA 4UWRB 5LCAA 3VPEA 2Q9UA 3PY5A 2Q0IA 3AJ3A 5LCHA 1ZKPA 3PY6A 4TZFA 2QJSA 4EYBA 5EVBA 4J5HA 2BMIA 3SBLA 1JT1A 2YHEA 4V0HA 5FQCA 1QH5A 3AF5A 2GCUA 1VMEA 5HIOA 4PDXA 5LSCA 5AXRA 2Q0JA 5HIPA 4CHLA 5ACWA 4RAWA 2QDTA 4RM5A 4HL2A 5ACXA 2FHXB 5A5ZA 3SD9A 2YNUA 4BP0A 3LVZA 4AWZA 1K07A 2FHXA 2BG8A 5EVKA 5KIKA 2AZ4A 5DPXA 3X2ZA 2M5CA 1XM8A 5EWAA 3G1PA 4ZEJA 2BG6A 5ACSA 5EW0A 4UWSB 5LM6A 1ZNBA 2DKFA 2I7VA 4EXYA 3R2UA 1A7TA 4XWWA 3DHAA 5A87A 3FAIA 2NYPA 3RKKA 5K0WA 3SW3A 3S0ZA 4C1DA 2ZNBA 2UYXA 3VQZA 4GCWA 2Y87A 4FR7A 5EHTA 2FU7A 3ADRA 2GFKA 2BG2A 3SRXA 2P97A 2R2DA 2BC2A 1DD6A 4UWPB 4P62A 5HH4A 4NURA 4ZO3A 1ZTCA 4YSBA 2ZO4A 1VGNA 1A8TA 5LS3A 5HIQA 3IE2A 3I14A 4AXHA 4EYLA 4AWYB 3AF6A 3PG4A 3DH8A 1JJTA 4KEQA 3BK2A 2CFUA 2P1EA 2DOOA 3I15A 5A0TA 5B15A 5AHOA 4H0DA 4D02A 5AHRA 5B1UA 3KNSA 4EXSA 1WRAA 4D1VA 3ZNBA 4C1EA 2BG7A 2YNWA 4AX1B 2VW8A 4D1TA 2FU6A 4D1UA 2FM6A 2BFKA 5ACTA 1QH3A 2WYMA 2FU8A 4U4LA 1YCFA
chains in the Genus database with same CATH topology
1JJEA 4GYQA 4AD9A 4RL0A 4XUKA 5AYAA 4C1GA 4C1CA 1DXKA 1HLKA 2YNVB 3I0VA 4TYTA 2I7TA 4C1HA 3MD7A 4J5FA 2Y8BA 1X8IA 4NQ4A 5AEBA 3TP9A 2GFJA 2YNVA 3T3OA 4BZ3A 2NXAA 5K4KA 5KILA 2AIOA 1DDKA 4Z5ZA 1E5DA 3IEMA 2WYLA 1X8GA 2I7XA 4NQ5A 4RL2A 5FQAA 4F6HA 5EV6A 3A4YA 2H6AA 5A0VA 2BGAA 5ACVA 4DILA 4DIKA 1VJNA 4HKYA 3IELA 3SPUA 4C09A 2Y8AA 2OHIA 2YCBA 3IE1A 4UBQA 4EY2A 2XF4A 4TZBA 2GKLA 1KR3A 4Z67A 1WUPA 5IQKA 2CBNA 4UA4A 2FU9A 1BVTA 3ZR9A 3BC2A 5HH5A 1YCGA 1BMCA 3QH8A 5ACRA 3DHBA 1KO3A 1WW1A 2Q42A 2XR1A 4NQ2A 4YSLA 5HISA 3BK1A 3WXCA 4FEKA 1KO2A 4Z6XA 1M2XA 2QEDA 3X2XA 1MQOA 5ACUA 4TZEA 3P2UA 4O98A 1X8HA 2OHHA 1SMLA 1WUOA 4WD6A 2NZEA 2ZZIA 3IDZA 2P18A 2WHGA 4AX0B 3X2YA 3IE0A 3IEKA 4PVOA 2WYMC 2BTNA 2BR6A 2GMNA 3RKJA 5EVDA 3ESHA 4B87A 4ZO2A 4C1FA 5LLDA 5EV8A 3T3NA 4Z5YA 3I11A 3X30A 5ACQA 3IOGA 3T9MA 3IOFA 3BV6A 3FCZA 2QINA 1Y44A 3ZQ4A 5K4MA 3DHCA 2P4ZA 2WRSA 5EH9A 4PVTA 2BG8B 2BFLA 4HL1A 4LE6A 1YCHA 4FSBA 4TYFA 4NQ6A 5LE1A 2BIBA 3L6NA 3RPCA 4XWTA 4Z7RA 1XTOA 4TZ9A 5LCFA 3I13A 3F9OA 2E7YA 4F6ZA 2QDSA 4JO0A 2HB9A 2A7MA 3JXPA 4RAMA 1L9YA 3Q6VA 3KL7A 1BC2A 5FQBA 2YNTB 2OHJA 3SFPA 2YZ3A 2FK6A 3H3EA 2BFZB 5HH6A 2YNTA 4RBSA 4KEPA 4Z60A 4GYUA 2BFZA 4D1WA 5B3RA 4ZNBA 2ZWRA 2M5DA 3KNRA 4UWOB 3ZWFA 4YSKA 1P9EA 5ACPA 4EFZA 5AXOA 5LMCA 4UAMA 5K4NA 2NZFA 4EYFA 4UWRB 5LCAA 3VPEA 2Q9UA 3PY5A 2Q0IA 3AJ3A 5LCHA 1ZKPA 3PY6A 4TZFA 2QJSA 4EYBA 5EVBA 4J5HA 2BMIA 3SBLA 1JT1A 4V0HA 5FQCA 1QH5A 3AF5A 2GCUA 1VMEA 5HIOA 5LSCA 5AXRA 2Q0JA 5HIPA 4CHLA 5ACWA 4RAWA 2QDTA 4RM5A 4HL2A 5ACXA 2FHXB 5A5ZA 3SD9A 2YNUA 4BP0A 3LVZA 4AWZA 1K07A 2FHXA 2BG8A 5EVKA 5KIKA 2AZ4A 5DPXA 3X2ZA 2M5CA 1XM8A 5EWAA 3G1PA 4ZEJA 2BG6A 5ACSA 5EW0A 4UWSB 5LM6A 1ZNBA 2DKFA 2I7VA 4EXYA 3R2UA 1A7TA 4XWWA 3DHAA 5A87A 3FAIA 2NYPA 3RKKA 5K0WA 3SW3A 3S0ZA 4C1DA 2ZNBA 2UYXA 3VQZA 4GCWA 2Y87A 4FR7A 5EHTA 2FU7A 3ADRA 2GFKA 2BG2A 3SRXA 2P97A 2R2DA 2BC2A 1DD6A 4UWPB 4P62A 5HH4A 4ZO3A 1ZTCA 4YSBA 2ZO4A 1VGNA 1A8TA 5LS3A 5HIQA 3IE2A 3I14A 4EYLA 4AWYB 3AF6A 3PG4A 3DH8A 1JJTA 4KEQA 3BK2A 2P1EA 2DOOA 3I15A 5A0TA 5B15A 5AHOA 4H0DA 4D02A 5AHRA 5B1UA 3KNSA 4EXSA 1WRAA 4D1VA 3ZNBA 4C1EA 2BG7A 2YNWA 4AX1B 2VW8A 4D1TA 2FU6A 4D1UA 2FM6A 2BFKA 5ACTA 1QH3A 2WYMA 2FU8A 4U4LA 1YCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJE A;  4GYQ A;  4AD9 A;  4RL0 A;  4XUK A;  5AYA A;  4C1G A;  4C1C A;  1DXK A;  1HLK A;  2YNV B;  3I0V A;  4TYT A;  2I7T A;  4C1H A;  3MD7 A;  4J5F A;  2Y8B A;  1X8I A;  4NQ4 A;  5AEB A;  3TP9 A;  2GFJ A;  2YNV A;  3T3O A;  4BZ3 A;  2NXA A;  5K4K A;  5KIL A;  2AIO A;  1DDK A;  4Z5Z A;  1E5D A;  3IEM A;  2WYL A;  1X8G A;  2I7X A;  4NQ5 A;  4RL2 A;  5FQA A;  4F6H A;  5EV6 A;  3A4Y A;  2H6A A;  5A0V A;  2BGA A;  5ACV A;  4DIL A;  4DIK A;  1VJN A;  4HKY A;  3IEL A;  3SPU A;  4C09 A;  2Y8A A;  2OHI A;  2YCB A;  3IE1 A;  4UBQ A;  4EY2 A;  2XF4 A;  4TZB A;  2GKL A;  1KR3 A;  4Z67 A;  1WUP A;  5IQK A;  2CBN A;  4UA4 A;  2FU9 A;  1BVT A;  3ZR9 A;  3BC2 A;  5HH5 A;  1YCG A;  1BMC A;  3QH8 A;  5ACR A;  3DHB A;  1KO3 A;  1WW1 A;  2Q42 A;  2XR1 A;  4NQ2 A;  4YSL A;  5HIS A;  3BK1 A;  3WXC A;  4FEK A;  1KO2 A;  4Z6X A;  1M2X A;  2QED A;  3X2X A;  1MQO A;  5ACU A;  4TZE A;  3P2U A;  4O98 A;  1X8H A;  2OHH A;  1SML A;  1WUO A;  4WD6 A;  2NZE A;  2ZZI A;  3IDZ A;  2P18 A;  2WHG A;  4AX0 B;  3X2Y A;  3IE0 A;  3IEK A;  4PVO A;  2WYM C;  2BTN A;  2BR6 A;  2GMN A;  3RKJ A;  5EVD A;  3ESH A;  4B87 A;  4ZO2 A;  4C1F A;  5LLD A;  5EV8 A;  3T3N A;  4Z5Y A;  3I11 A;  3X30 A;  5ACQ A;  3IOG A;  3T9M A;  3IOF A;  3BV6 A;  3FCZ A;  2QIN A;  1Y44 A;  3ZQ4 A;  5K4M A;  3DHC A;  2P4Z A;  2WRS A;  5EH9 A;  4PVT A;  2BG8 B;  2BFL A;  4HL1 A;  4LE6 A;  1YCH A;  4FSB A;  4TYF A;  4NQ6 A;  5LE1 A;  2BIB A;  3L6N A;  3RPC A;  4XWT A;  4Z7R A;  1XTO A;  4TZ9 A;  5LCF A;  3I13 A;  3F9O A;  2E7Y A;  4F6Z A;  2QDS A;  4JO0 A;  2HB9 A;  2A7M A;  3JXP A;  4RAM A;  1L9Y A;  3Q6V A;  3KL7 A;  1BC2 A;  5FQB A;  2YNT B;  2OHJ A;  3SFP A;  2YZ3 A;  2FK6 A;  3H3E A;  2BFZ B;  5HH6 A;  2YNT A;  4RBS A;  4KEP A;  4Z60 A;  4GYU A;  2BFZ A;  4D1W A;  5B3R A;  4ZNB A;  2ZWR A;  2M5D A;  3KNR A;  4UWO B;  3ZWF A;  4YSK A;  1P9E A;  5ACP A;  4EFZ A;  5AXO A;  5LMC A;  4UAM A;  5K4N A;  2NZF A;  4EYF A;  4UWR B;  5LCA A;  3VPE A;  2Q9U A;  3PY5 A;  2Q0I A;  3AJ3 A;  5LCH A;  1ZKP A;  3PY6 A;  4TZF A;  2QJS A;  4EYB A;  5EVB A;  4J5H A;  2BMI A;  3SBL A;  1JT1 A;  4V0H A;  5FQC A;  1QH5 A;  3AF5 A;  2GCU A;  1VME A;  5HIO A;  5LSC A;  5AXR A;  2Q0J A;  5HIP A;  4CHL A;  5ACW A;  4RAW A;  2QDT A;  4RM5 A;  4HL2 A;  5ACX A;  2FHX B;  5A5Z A;  3SD9 A;  2YNU A;  4BP0 A;  3LVZ A;  4AWZ A;  1K07 A;  2FHX A;  2BG8 A;  5EVK A;  5KIK A;  2AZ4 A;  5DPX A;  3X2Z A;  2M5C A;  1XM8 A;  5EWA A;  3G1P A;  4ZEJ A;  2BG6 A;  5ACS A;  5EW0 A;  4UWS B;  5LM6 A;  1ZNB A;  2DKF A;  2I7V A;  4EXY A;  3R2U A;  1A7T A;  4XWW A;  3DHA A;  5A87 A;  3FAI A;  2NYP A;  3RKK A;  5K0W A;  3SW3 A;  3S0Z A;  4C1D A;  2ZNB A;  2UYX A;  3VQZ A;  4GCW A;  2Y87 A;  4FR7 A;  5EHT A;  2FU7 A;  3ADR A;  2GFK A;  2BG2 A;  3SRX A;  2P97 A;  2R2D A;  2BC2 A;  1DD6 A;  4UWP B;  4P62 A;  5HH4 A;  4ZO3 A;  1ZTC A;  4YSB A;  2ZO4 A;  1VGN A;  1A8T A;  5LS3 A;  5HIQ A;  3IE2 A;  3I14 A;  4EYL A;  4AWY B;  3AF6 A;  3PG4 A;  3DH8 A;  1JJT A;  4KEQ A;  3BK2 A;  2P1E A;  2DOO A;  3I15 A;  5A0T A;  5B15 A;  5AHO A;  4H0D A;  4D02 A;  5AHR A;  5B1U A;  3KNS A;  4EXS A;  1WRA A;  4D1V A;  3ZNB A;  4C1E A;  2BG7 A;  2YNW A;  4AX1 B;  2VW8 A;  4D1T A;  2FU6 A;  4D1U A;  2FM6 A;  2BFK A;  5ACT A;  1QH3 A;  2WYM A;  2FU8 A;  4U4L A;  1YCF A; 
#chains in the Genus database with same CATH topology
 1JJE A;  4GYQ A;  4AD9 A;  4RL0 A;  4XUK A;  5AYA A;  4C1G A;  4C1C A;  1DXK A;  1HLK A;  2YNV B;  3I0V A;  4TYT A;  2I7T A;  4C1H A;  3MD7 A;  4J5F A;  2Y8B A;  1X8I A;  4NQ4 A;  5AEB A;  3TP9 A;  2GFJ A;  2YNV A;  3T3O A;  4BZ3 A;  2NXA A;  5K4K A;  5AJL A;  5KIL A;  2AIO A;  1DDK A;  4Z5Z A;  1E5D A;  3IEM A;  2WYL A;  1X8G A;  2I7X A;  4NQ5 A;  4RL2 A;  5FQA A;  4F6H A;  5EV6 A;  3A4Y A;  2H6A A;  5A0V A;  2BGA A;  5ACV A;  4DIL A;  4AV7 A;  4DIK A;  1VJN A;  4HKY A;  3IEL A;  3SPU A;  4C09 A;  2Y8A A;  2OHI A;  2YCB A;  3IE1 A;  4UBQ A;  4EY2 A;  2XF4 A;  4TZB A;  2GKL A;  1KR3 A;  4Z67 A;  1WUP A;  5IQK A;  2CBN A;  4UA4 A;  2FU9 A;  1BVT A;  3ZR9 A;  3BC2 A;  5HH5 A;  1YCG A;  1BMC A;  3QH8 A;  5ACR A;  3DHB A;  1KO3 A;  1WW1 A;  2Q42 A;  2XR1 A;  4NQ2 A;  4YSL A;  5HIS A;  3BK1 A;  3WXC A;  4FEK A;  1KO2 A;  4Z6X A;  1M2X A;  2QED A;  3X2X A;  1MQO A;  5ACU A;  5A23 A;  4TZE A;  3P2U A;  4O98 A;  1X8H A;  2OHH A;  1SML A;  1WUO A;  4WD6 A;  2NZE A;  2ZZI A;  3IDZ A;  2P18 A;  2WHG A;  4AX0 B;  3X2Y A;  3IE0 A;  3IEK A;  4PVO A;  2WYM C;  5AIJ A;  2BTN A;  2BR6 A;  2GMN A;  3RKJ A;  5EVD A;  3ESH A;  4B87 A;  4ZO2 A;  4C1F A;  5LLD A;  5EV8 A;  3T3N A;  4Z5Y A;  3I11 A;  3X30 A;  5ACQ A;  3IOG A;  3T9M A;  3IOF A;  3BV6 A;  3FCZ A;  2QIN A;  1Y44 A;  3ZQ4 A;  5K4M A;  3DHC A;  2P4Z A;  2WRS A;  5EH9 A;  4PVT A;  2BG8 B;  2BFL A;  4HL1 A;  4LE6 A;  1YCH A;  4FSB A;  4TYF A;  4NQ6 A;  5LE1 A;  2BIB A;  3L6N A;  3RPC A;  4XWT A;  4Z7R A;  1XTO A;  4TZ9 A;  5LCF A;  3I13 A;  3F9O A;  2E7Y A;  4F6Z A;  2QDS A;  4JO0 A;  2HB9 A;  2A7M A;  3JXP A;  4RAM A;  1L9Y A;  3Q6V A;  3KL7 A;  1BC2 A;  5FQB A;  2YNT B;  2OHJ A;  3SFP A;  2YZ3 A;  2CG2 A;  3H3E A;  2FK6 A;  2BFZ B;  5HH6 A;  2YNT A;  4RBS A;  4KEP A;  4Z60 A;  4GYU A;  2BFZ A;  4D1W A;  5B3R A;  2CFZ A;  4ZNB A;  2ZWR A;  2M5D A;  3KNR A;  4UWO B;  3ZWF A;  2CG3 A;  4YSK A;  1P9E A;  5ACP A;  4EFZ A;  5AXO A;  5LMC A;  4UAM A;  5K4N A;  2NZF A;  4EYF A;  4UWR B;  5LCA A;  3VPE A;  2Q9U A;  3PY5 A;  2Q0I A;  3AJ3 A;  5LCH A;  1ZKP A;  3PY6 A;  4TZF A;  2QJS A;  4EYB A;  5EVB A;  4J5H A;  2BMI A;  3SBL A;  1JT1 A;  2YHE A;  4V0H A;  5FQC A;  1QH5 A;  3AF5 A;  2GCU A;  1VME A;  5HIO A;  4PDX A;  5LSC A;  5AXR A;  2Q0J A;  5HIP A;  4CHL A;  5ACW A;  4RAW A;  2QDT A;  4RM5 A;  4HL2 A;  5ACX A;  2FHX B;  5A5Z A;  3SD9 A;  2YNU A;  4BP0 A;  3LVZ A;  4AWZ A;  1K07 A;  2FHX A;  2BG8 A;  5EVK A;  5KIK A;  2AZ4 A;  5DPX A;  3X2Z A;  2M5C A;  1XM8 A;  5EWA A;  3G1P A;  4ZEJ A;  2BG6 A;  5ACS A;  5EW0 A;  4UWS B;  5LM6 A;  1ZNB A;  2DKF A;  2I7V A;  4EXY A;  3R2U A;  1A7T A;  4XWW A;  3DHA A;  5A87 A;  3FAI A;  2NYP A;  3RKK A;  5K0W A;  3SW3 A;  3S0Z A;  4C1D A;  2ZNB A;  2UYX A;  3VQZ A;  4GCW A;  2Y87 A;  4FR7 A;  5EHT A;  2FU7 A;  3ADR A;  2GFK A;  2BG2 A;  3SRX A;  2P97 A;  2R2D A;  2BC2 A;  1DD6 A;  4UWP B;  4P62 A;  5HH4 A;  4NUR A;  4ZO3 A;  1ZTC A;  4YSB A;  2ZO4 A;  1VGN A;  1A8T A;  5LS3 A;  5HIQ A;  3IE2 A;  3I14 A;  4AXH A;  4EYL A;  4AWY B;  3AF6 A;  3PG4 A;  3DH8 A;  1JJT A;  4KEQ A;  3BK2 A;  2CFU A;  2P1E A;  2DOO A;  3I15 A;  5A0T A;  5B15 A;  5AHO A;  4H0D A;  4D02 A;  5AHR A;  5B1U A;  3KNS A;  4EXS A;  1WRA A;  4D1V A;  3ZNB A;  4C1E A;  2BG7 A;  2YNW A;  4AX1 B;  2VW8 A;  4D1T A;  2FU6 A;  4D1U A;  2FM6 A;  2BFK A;  5ACT A;  1QH3 A;  2WYM A;  2FU8 A;  4U4L A;  1YCF A; 
#chains in the Genus database with same CATH homology
 1JJE A;  4GYQ A;  4AD9 A;  4RL0 A;  4XUK A;  5AYA A;  4C1G A;  4C1C A;  1DXK A;  1HLK A;  2YNV B;  3I0V A;  4TYT A;  2I7T A;  4C1H A;  3MD7 A;  4J5F A;  2Y8B A;  1X8I A;  4NQ4 A;  5AEB A;  3TP9 A;  2GFJ A;  2YNV A;  3T3O A;  4BZ3 A;  2NXA A;  5K4K A;  5KIL A;  2AIO A;  1DDK A;  4Z5Z A;  1E5D A;  3IEM A;  2WYL A;  1X8G A;  2I7X A;  4NQ5 A;  4RL2 A;  5FQA A;  4F6H A;  5EV6 A;  3A4Y A;  2H6A A;  5A0V A;  2BGA A;  5ACV A;  4DIL A;  4DIK A;  1VJN A;  4HKY A;  3IEL A;  3SPU A;  4C09 A;  2Y8A A;  2OHI A;  2YCB A;  3IE1 A;  4UBQ A;  4EY2 A;  2XF4 A;  4TZB A;  2GKL A;  1KR3 A;  4Z67 A;  1WUP A;  5IQK A;  2CBN A;  4UA4 A;  2FU9 A;  1BVT A;  3ZR9 A;  3BC2 A;  5HH5 A;  1YCG A;  1BMC A;  3QH8 A;  5ACR A;  3DHB A;  1KO3 A;  1WW1 A;  2Q42 A;  2XR1 A;  4NQ2 A;  4YSL A;  5HIS A;  3BK1 A;  3WXC A;  4FEK A;  1KO2 A;  4Z6X A;  1M2X A;  2QED A;  3X2X A;  1MQO A;  5ACU A;  4TZE A;  3P2U A;  4O98 A;  1X8H A;  2OHH A;  1SML A;  1WUO A;  4WD6 A;  2NZE A;  2ZZI A;  3IDZ A;  2P18 A;  2WHG A;  4AX0 B;  3X2Y A;  3IE0 A;  3IEK A;  4PVO A;  2WYM C;  2BTN A;  2BR6 A;  2GMN A;  3RKJ A;  5EVD A;  3ESH A;  4B87 A;  4ZO2 A;  4C1F A;  5LLD A;  5EV8 A;  3T3N A;  4Z5Y A;  3I11 A;  3X30 A;  5ACQ A;  3IOG A;  3T9M A;  3IOF A;  3BV6 A;  3FCZ A;  2QIN A;  1Y44 A;  3ZQ4 A;  5K4M A;  3DHC A;  2P4Z A;  2WRS A;  5EH9 A;  4PVT A;  2BG8 B;  2BFL A;  4HL1 A;  4LE6 A;  1YCH A;  4FSB A;  4TYF A;  4NQ6 A;  5LE1 A;  2BIB A;  3L6N A;  3RPC A;  4XWT A;  4Z7R A;  1XTO A;  4TZ9 A;  5LCF A;  3I13 A;  3F9O A;  2E7Y A;  4F6Z A;  2QDS A;  4JO0 A;  2HB9 A;  2A7M A;  3JXP A;  4RAM A;  1L9Y A;  3Q6V A;  3KL7 A;  1BC2 A;  5FQB A;  2YNT B;  2OHJ A;  3SFP A;  2YZ3 A;  2FK6 A;  3H3E A;  2BFZ B;  5HH6 A;  2YNT A;  4RBS A;  4KEP A;  4Z60 A;  4GYU A;  2BFZ A;  4D1W A;  5B3R A;  4ZNB A;  2ZWR A;  2M5D A;  3KNR A;  4UWO B;  3ZWF A;  4YSK A;  1P9E A;  5ACP A;  4EFZ A;  5AXO A;  5LMC A;  4UAM A;  5K4N A;  2NZF A;  4EYF A;  4UWR B;  5LCA A;  3VPE A;  2Q9U A;  3PY5 A;  2Q0I A;  3AJ3 A;  5LCH A;  1ZKP A;  3PY6 A;  4TZF A;  2QJS A;  4EYB A;  5EVB A;  4J5H A;  2BMI A;  3SBL A;  1JT1 A;  4V0H A;  5FQC A;  1QH5 A;  3AF5 A;  2GCU A;  1VME A;  5HIO A;  5LSC A;  5AXR A;  2Q0J A;  5HIP A;  4CHL A;  5ACW A;  4RAW A;  2QDT A;  4RM5 A;  4HL2 A;  5ACX A;  2FHX B;  5A5Z A;  3SD9 A;  2YNU A;  4BP0 A;  3LVZ A;  4AWZ A;  1K07 A;  2FHX A;  2BG8 A;  5EVK A;  5KIK A;  2AZ4 A;  5DPX A;  3X2Z A;  2M5C A;  1XM8 A;  5EWA A;  3G1P A;  4ZEJ A;  2BG6 A;  5ACS A;  5EW0 A;  4UWS B;  5LM6 A;  1ZNB A;  2DKF A;  2I7V A;  4EXY A;  3R2U A;  1A7T A;  4XWW A;  3DHA A;  5A87 A;  3FAI A;  2NYP A;  3RKK A;  5K0W A;  3SW3 A;  3S0Z A;  4C1D A;  2ZNB A;  2UYX A;  3VQZ A;  4GCW A;  2Y87 A;  4FR7 A;  5EHT A;  2FU7 A;  3ADR A;  2GFK A;  2BG2 A;  3SRX A;  2P97 A;  2R2D A;  2BC2 A;  1DD6 A;  4UWP B;  4P62 A;  5HH4 A;  4ZO3 A;  1ZTC A;  4YSB A;  2ZO4 A;  1VGN A;  1A8T A;  5LS3 A;  5HIQ A;  3IE2 A;  3I14 A;  4EYL A;  4AWY B;  3AF6 A;  3PG4 A;  3DH8 A;  1JJT A;  4KEQ A;  3BK2 A;  2P1E A;  2DOO A;  3I15 A;  5A0T A;  5B15 A;  5AHO A;  4H0D A;  4D02 A;  5AHR A;  5B1U A;  3KNS A;  4EXS A;  1WRA A;  4D1V A;  3ZNB A;  4C1E A;  2BG7 A;  2YNW A;  4AX1 B;  2VW8 A;  4D1T A;  2FU6 A;  4D1U A;  2FM6 A;  2BFK A;  5ACT A;  1QH3 A;  2WYM A;  2FU8 A;  4U4L A;  1YCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...