4AWZA

Crystal structure of the mobile metallo-beta-lactamase aim-1 from pseudomonas aeruginosa: insights into antibiotic binding and the role of gln157
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
269
structure length
269
Chain Sequence
ASRGCADDAGWNDPAMPLKVYGNTWYVGTCGISALLVTSDAGHILVDAATPQAGPQILANIRALGFRPEDVRAIVFSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLPDRTDPQFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRSCEGDDCRQMVYADSLTAISDDVFRYSDDAAHPGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRIGPRAAAPLMDTTACRRYAQGARQRLEKRLAEEAAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Mobile Metallo-Beta-Lactamase Aim-1 from Pseudomonas Aeruginosa: Insights Into Antibiotic Binding and the Role of Gln157.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords METALLO-BETA-LACTAMASE AIM-1
total genus 90
structure length 269
sequence length 269
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4awzA00
2WHGA 4GYQA 4V0HA 1BMCA 3QH8A 4RM5A 3A4YA 1X8HA 3KNRA 1M2XA 1YCFA 3BK2A 5ACSA 5HIQA 3IDZA 2YNTA 4YSLA 4C09A 4ZO2A 1XTOA 2NYPA 3IE2A 5ACTA 2BC2A 3T3NA 4EFZA 5LCFA 4F6ZA 5EV6A 1KO2A 3PY6A 2E7YA 2AZ4A 2QJSA 5HH6A 2BMIA 3X2YA 2VW8A 2BFLA 4C1GA 2Y8BA 4UWOB 3JXPA 2QDSA 3PG4A 1A8TA 3SPUA 4TYFA 4YSBA 3S0ZA 1Y44A 2FU8A 3X2ZA 4UWRB 2YNUA 3WXCA 2XF4A 4C1DA 1X8IA 3FAIA 3X30A 3PY5A 2GFKA 5EVBA 1SMLA 4H0DA 2M5CA 5LM6A 3IOGA 2YCBA 3L6NA 4EYBA 2R2DA 2Y87A 2QINA 2FU7A 3ZNBA 1YCHA 4Z7RA 5ACXA 3G1PA 5FQAA 4D02A 5A0TA 5KIKA 2P4ZA 5ACUA 1QH5A 3IE0A 4O98A 3DHAA 5A5ZA 2FM6A 4D1VA 4EYLA 4RL2A 4TZBA 4D1UA 1BVTA 1BC2A 2H6AA 5AXRA 1K07A 4Z5ZA 1VGNA 2FU6A 4AX0B 4KEQA 1WUOA 5EVKA 1A7TA 4RL0A 3T3OA 2BG7A 4F6HA 2OHIA 1VMEA 5AEBA 3AJ3A 2Q0JA 3MD7A 4ZNBA 4U4LA 3ZR9A 4YSKA 5K4NA 5FQBA 5B15A 4UA4A 4FR7A 4WD6A 1YCGA 2GFJA 5EV8A 4Z60A 5EHTA 2Q9UA 3P2UA 5EWAA 1XM8A 4J5HA 3DH8A 1E5DA 5LSCA 2BGAA 2P1EA 5HIPA 5AHRA 4NQ4A 3BK1A 4PVOA 5AYAA 3IOFA 1QH3A 2OHJA 2BFZB 4AWZA 2BG2A 4Z5YA 4C1EA 5ACRA 5ACVA 3AF6A 3KL7A 2YNWA 4D1WA 4DIKA 4D1TA 5B1UA 2BG6A 2YNVA 2YNTB 5EVDA 2ZNBA 3Q6VA 5DPXA 3IE1A 4EXSA 2FHXA 1JT1A 2Q42A 4UWPB 4NQ5A 3ZQ4A 3SRXA 5HH5A 5IQKA 2CBNA 2WYMA 4C1CA 4NQ2A 4P62A 5ACQA 4JO0A 5K0WA 2P97A 3VQZA 4AX1B 4RAWA 2A7MA 4EYFA 2BFZA 2FHXB 4TYTA 5ACPA 1ZTCA 2XR1A 3RPCA 4XUKA 4C1FA 4GYUA 4DILA 5AHOA 2P18A 4TZ9A 5K4MA 4TZFA 3IEMA 1DXKA 1P9EA 2BTNA 2DKFA 2AIOA 4HL1A 3SW3A 2BFKA 1X8GA 4C1HA 2Y8AA 3X2XA 5FQCA 4UAMA 2NZFA 4FSBA 2HB9A 4PVTA 2YZ3A 4B87A 2QEDA 4HKYA 4LE6A 1DD6A 5ACWA 2WYLA 2GCUA 4ZEJA 3H3EA 3DHCA 4TZEA 3BC2A 5AXOA 3VPEA 3IELA 1KO3A 3AF5A 1ZKPA 3ESHA 3RKJA 5HH4A 3SFPA 5K4KA 3DHBA 4UWSB 5LMCA 2BG8A 3I14A 2ZO4A 3SD9A 2WRSA 3KNSA 2UYXA 1VJNA 4Z6XA 4AWYB 2GMNA 2ZZIA 2I7VA 3I0VA 5EH9A 4BP0A 1JJTA 4J5FA 4ZO3A 4RAMA 4XWTA 4EY2A 1KR3A 3SBLA 1ZNBA 4NQ6A 3IEKA 2I7XA 5LCHA 2YNVB 4FEKA 2FK6A 4BZ3A 1WW1A 3LVZA 2Q0IA 2WYMC 5A87A 4Z67A 2FU9A 2DOOA 2M5DA 3FCZA 5A0VA 5EW0A 5B3RA 4EXYA 5LE1A 4AD9A 4CHLA 1DDKA 5LLDA 1L9YA 4GCWA 1WUPA 2I7TA 5LCAA 1WRAA 4KEPA 1MQOA 4XWWA 2NZEA 3RKKA 3ADRA 5HIOA 3BV6A 2NXAA 2QDTA 5HISA 3F9OA 3I13A 4RBSA 4UBQA 2BR6A 2BG8B 2GKLA 5KILA 3TP9A 1JJEA 3I11A 2OHHA 3T9MA 2ZWRA 2BIBA 4HL2A 3ZWFA 5LS3A 3I15A 3R2UA 1HLKA
chains in the Genus database with same CATH superfamily
2WHGA 4GYQA 4V0HA 1BMCA 3QH8A 4RM5A 4NURA 3A4YA 1X8HA 3KNRA 1M2XA 1YCFA 3BK2A 5ACSA 5HIQA 3IDZA 2YNTA 4YSLA 4C09A 4ZO2A 1XTOA 2NYPA 3IE2A 5ACTA 2BC2A 2CG2A 3T3NA 4EFZA 5LCFA 5A23A 4F6ZA 5AJLA 5EV6A 1KO2A 3PY6A 2E7YA 2AZ4A 2QJSA 5HH6A 2BMIA 3X2YA 2VW8A 2BFLA 4C1GA 2Y8BA 4UWOB 3JXPA 2QDSA 3PG4A 1A8TA 3SPUA 4TYFA 4YSBA 3S0ZA 1Y44A 2FU8A 3X2ZA 4UWRB 2YNUA 3WXCA 2XF4A 4C1DA 1X8IA 3FAIA 3X30A 3PY5A 2GFKA 5EVBA 1SMLA 4H0DA 2M5CA 5LM6A 3IOGA 2YCBA 3L6NA 4EYBA 2R2DA 2Y87A 2QINA 2FU7A 3ZNBA 1YCHA 4Z7RA 5ACXA 3G1PA 5FQAA 4D02A 5A0TA 5KIKA 2P4ZA 5ACUA 1QH5A 3IE0A 4O98A 2CFZA 3DHAA 5A5ZA 2FM6A 4D1VA 4EYLA 4RL2A 4TZBA 4D1UA 1BVTA 1BC2A 2H6AA 5AXRA 1K07A 4Z5ZA 1VGNA 2FU6A 4AX0B 4KEQA 1WUOA 5EVKA 1A7TA 4RL0A 3T3OA 2BG7A 4F6HA 2OHIA 1VMEA 5AEBA 3AJ3A 2Q0JA 3MD7A 4ZNBA 4U4LA 3ZR9A 4YSKA 5K4NA 5FQBA 2CG3A 5B15A 4UA4A 4FR7A 4WD6A 1YCGA 2GFJA 5EV8A 4Z60A 5EHTA 2Q9UA 3P2UA 5EWAA 1XM8A 4J5HA 3DH8A 1E5DA 5LSCA 2BGAA 2P1EA 5HIPA 5AHRA 4NQ4A 3BK1A 4PVOA 5AYAA 3IOFA 1QH3A 2OHJA 2BFZB 4AWZA 2BG2A 4Z5YA 4C1EA 5ACRA 5ACVA 3AF6A 3KL7A 2YNWA 4D1WA 4DIKA 4D1TA 5B1UA 2BG6A 2YNVA 2YNTB 5EVDA 2ZNBA 3Q6VA 5DPXA 3IE1A 4EXSA 2FHXA 1JT1A 2Q42A 4UWPB 4NQ5A 3ZQ4A 3SRXA 5HH5A 5IQKA 2CBNA 2WYMA 4C1CA 4NQ2A 4P62A 5ACQA 4JO0A 5K0WA 2P97A 3VQZA 4AX1B 4RAWA 2A7MA 4EYFA 2BFZA 2FHXB 4TYTA 4AXHA 5ACPA 1ZTCA 2XR1A 3RPCA 4XUKA 4C1FA 4GYUA 4DILA 5AHOA 2P18A 5AIJA 4TZ9A 5K4MA 4TZFA 3IEMA 1DXKA 1P9EA 2BTNA 2DKFA 2AIOA 4HL1A 3SW3A 2BFKA 1X8GA 2YHEA 4C1HA 2Y8AA 3X2XA 5FQCA 4UAMA 2NZFA 4FSBA 2HB9A 4PVTA 2YZ3A 4B87A 2QEDA 4HKYA 4LE6A 1DD6A 5ACWA 2WYLA 2GCUA 4ZEJA 3H3EA 3DHCA 4TZEA 3BC2A 5AXOA 3VPEA 3IELA 1KO3A 3AF5A 1ZKPA 3ESHA 3RKJA 5HH4A 3SFPA 4AV7A 5K4KA 3DHBA 4UWSB 5LMCA 2BG8A 3I14A 2ZO4A 3SD9A 2WRSA 3KNSA 2UYXA 1VJNA 4Z6XA 4AWYB 2GMNA 2ZZIA 2I7VA 3I0VA 5EH9A 4BP0A 1JJTA 4J5FA 4ZO3A 4RAMA 4XWTA 4EY2A 1KR3A 3SBLA 1ZNBA 4NQ6A 4PDXA 3IEKA 2I7XA 5LCHA 2YNVB 4FEKA 2FK6A 4BZ3A 1WW1A 2CFUA 3LVZA 2Q0IA 2WYMC 5A87A 4Z67A 2FU9A 2DOOA 2M5DA 3FCZA 5A0VA 5EW0A 5B3RA 4EXYA 5LE1A 4AD9A 4CHLA 1DDKA 5LLDA 1L9YA 4GCWA 1WUPA 2I7TA 5LCAA 1WRAA 4KEPA 1MQOA 4XWWA 2NZEA 3RKKA 3ADRA 5HIOA 3BV6A 2NXAA 2QDTA 5HISA 3F9OA 3I13A 4RBSA 4UBQA 2BR6A 2BG8B 2GKLA 5KILA 3TP9A 1JJEA 3I11A 2OHHA 3T9MA 2ZWRA 2BIBA 4HL2A 3ZWFA 5LS3A 3I15A 3R2UA 1HLKA
chains in the Genus database with same CATH topology
2WHGA 4GYQA 4V0HA 1BMCA 3QH8A 4RM5A 3A4YA 1X8HA 3KNRA 1M2XA 1YCFA 3BK2A 5ACSA 5HIQA 3IDZA 2YNTA 4YSLA 4C09A 4ZO2A 1XTOA 2NYPA 3IE2A 5ACTA 2BC2A 3T3NA 4EFZA 5LCFA 4F6ZA 5EV6A 1KO2A 3PY6A 2E7YA 2AZ4A 2QJSA 5HH6A 2BMIA 3X2YA 2VW8A 2BFLA 4C1GA 2Y8BA 4UWOB 3JXPA 2QDSA 3PG4A 1A8TA 3SPUA 4TYFA 4YSBA 3S0ZA 1Y44A 2FU8A 3X2ZA 4UWRB 2YNUA 3WXCA 2XF4A 4C1DA 1X8IA 3FAIA 3X30A 3PY5A 2GFKA 5EVBA 1SMLA 4H0DA 2M5CA 5LM6A 3IOGA 2YCBA 3L6NA 4EYBA 2R2DA 2Y87A 2QINA 2FU7A 3ZNBA 1YCHA 4Z7RA 5ACXA 3G1PA 5FQAA 4D02A 5A0TA 5KIKA 2P4ZA 5ACUA 1QH5A 3IE0A 4O98A 3DHAA 5A5ZA 2FM6A 4D1VA 4EYLA 4RL2A 4TZBA 4D1UA 1BVTA 1BC2A 2H6AA 5AXRA 1K07A 4Z5ZA 1VGNA 2FU6A 4AX0B 4KEQA 1WUOA 5EVKA 1A7TA 4RL0A 3T3OA 2BG7A 4F6HA 2OHIA 1VMEA 5AEBA 3AJ3A 2Q0JA 3MD7A 4ZNBA 4U4LA 3ZR9A 4YSKA 5K4NA 5FQBA 5B15A 4UA4A 4FR7A 4WD6A 1YCGA 2GFJA 5EV8A 4Z60A 5EHTA 2Q9UA 3P2UA 5EWAA 1XM8A 4J5HA 3DH8A 1E5DA 5LSCA 2BGAA 2P1EA 5HIPA 5AHRA 4NQ4A 3BK1A 4PVOA 5AYAA 3IOFA 1QH3A 2OHJA 2BFZB 4AWZA 2BG2A 4Z5YA 4C1EA 5ACRA 5ACVA 3AF6A 3KL7A 2YNWA 4D1WA 4DIKA 4D1TA 5B1UA 2BG6A 2YNVA 2YNTB 5EVDA 2ZNBA 3Q6VA 5DPXA 3IE1A 4EXSA 2FHXA 1JT1A 2Q42A 4UWPB 4NQ5A 3ZQ4A 3SRXA 5HH5A 5IQKA 2CBNA 2WYMA 4C1CA 4NQ2A 4P62A 5ACQA 4JO0A 5K0WA 2P97A 3VQZA 4AX1B 4RAWA 2A7MA 4EYFA 2BFZA 2FHXB 4TYTA 5ACPA 1ZTCA 2XR1A 3RPCA 4XUKA 4C1FA 4GYUA 4DILA 5AHOA 2P18A 4TZ9A 5K4MA 4TZFA 3IEMA 1DXKA 1P9EA 2BTNA 2DKFA 2AIOA 4HL1A 3SW3A 2BFKA 1X8GA 4C1HA 2Y8AA 3X2XA 5FQCA 4UAMA 2NZFA 4FSBA 2HB9A 4PVTA 2YZ3A 4B87A 2QEDA 4HKYA 4LE6A 1DD6A 5ACWA 2WYLA 2GCUA 4ZEJA 3H3EA 3DHCA 4TZEA 3BC2A 5AXOA 3VPEA 3IELA 1KO3A 3AF5A 1ZKPA 3ESHA 3RKJA 5HH4A 3SFPA 5K4KA 3DHBA 4UWSB 5LMCA 2BG8A 3I14A 2ZO4A 3SD9A 2WRSA 3KNSA 2UYXA 1VJNA 4Z6XA 4AWYB 2GMNA 2ZZIA 2I7VA 3I0VA 5EH9A 4BP0A 1JJTA 4J5FA 4ZO3A 4RAMA 4XWTA 4EY2A 1KR3A 3SBLA 1ZNBA 4NQ6A 3IEKA 2I7XA 5LCHA 2YNVB 4FEKA 2FK6A 4BZ3A 1WW1A 3LVZA 2Q0IA 2WYMC 5A87A 4Z67A 2FU9A 2DOOA 2M5DA 3FCZA 5A0VA 5EW0A 5B3RA 4EXYA 5LE1A 4AD9A 4CHLA 1DDKA 5LLDA 1L9YA 4GCWA 1WUPA 2I7TA 5LCAA 1WRAA 4KEPA 1MQOA 4XWWA 2NZEA 3RKKA 3ADRA 5HIOA 3BV6A 2NXAA 2QDTA 5HISA 3F9OA 3I13A 4RBSA 4UBQA 2BR6A 2BG8B 2GKLA 5KILA 3TP9A 1JJEA 3I11A 2OHHA 3T9MA 2ZWRA 2BIBA 4HL2A 3ZWFA 5LS3A 3I15A 3R2UA 1HLKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WHG A;  4GYQ A;  4V0H A;  1BMC A;  3QH8 A;  4RM5 A;  3A4Y A;  1X8H A;  3KNR A;  1M2X A;  1YCF A;  3BK2 A;  5ACS A;  5HIQ A;  3IDZ A;  2YNT A;  4YSL A;  4C09 A;  4ZO2 A;  1XTO A;  2NYP A;  3IE2 A;  5ACT A;  2BC2 A;  3T3N A;  4EFZ A;  5LCF A;  4F6Z A;  5EV6 A;  1KO2 A;  3PY6 A;  2E7Y A;  2AZ4 A;  2QJS A;  5HH6 A;  2BMI A;  3X2Y A;  2VW8 A;  2BFL A;  4C1G A;  2Y8B A;  4UWO B;  3JXP A;  2QDS A;  3PG4 A;  1A8T A;  3SPU A;  4TYF A;  4YSB A;  3S0Z A;  1Y44 A;  2FU8 A;  3X2Z A;  4UWR B;  2YNU A;  3WXC A;  2XF4 A;  4C1D A;  1X8I A;  3FAI A;  3X30 A;  3PY5 A;  2GFK A;  5EVB A;  1SML A;  4H0D A;  2M5C A;  5LM6 A;  3IOG A;  2YCB A;  3L6N A;  4EYB A;  2R2D A;  2Y87 A;  2QIN A;  2FU7 A;  3ZNB A;  1YCH A;  4Z7R A;  5ACX A;  3G1P A;  5FQA A;  4D02 A;  5A0T A;  5KIK A;  2P4Z A;  5ACU A;  1QH5 A;  3IE0 A;  4O98 A;  3DHA A;  5A5Z A;  2FM6 A;  4D1V A;  4EYL A;  4RL2 A;  4TZB A;  4D1U A;  1BVT A;  1BC2 A;  2H6A A;  5AXR A;  1K07 A;  4Z5Z A;  1VGN A;  2FU6 A;  4AX0 B;  4KEQ A;  1WUO A;  5EVK A;  1A7T A;  4RL0 A;  3T3O A;  2BG7 A;  4F6H A;  2OHI A;  1VME A;  5AEB A;  3AJ3 A;  2Q0J A;  3MD7 A;  4ZNB A;  4U4L A;  3ZR9 A;  4YSK A;  5K4N A;  5FQB A;  5B15 A;  4UA4 A;  4FR7 A;  4WD6 A;  1YCG A;  2GFJ A;  5EV8 A;  4Z60 A;  5EHT A;  2Q9U A;  3P2U A;  5EWA A;  1XM8 A;  4J5H A;  3DH8 A;  1E5D A;  5LSC A;  2BGA A;  2P1E A;  5HIP A;  5AHR A;  4NQ4 A;  3BK1 A;  4PVO A;  5AYA A;  3IOF A;  1QH3 A;  2OHJ A;  2BFZ B;  4AWZ A;  2BG2 A;  4Z5Y A;  4C1E A;  5ACR A;  5ACV A;  3AF6 A;  3KL7 A;  2YNW A;  4D1W A;  4DIK A;  4D1T A;  5B1U A;  2BG6 A;  2YNV A;  2YNT B;  5EVD A;  2ZNB A;  3Q6V A;  5DPX A;  3IE1 A;  4EXS A;  2FHX A;  1JT1 A;  2Q42 A;  4UWP B;  4NQ5 A;  3ZQ4 A;  3SRX A;  5HH5 A;  5IQK A;  2CBN A;  2WYM A;  4C1C A;  4NQ2 A;  4P62 A;  5ACQ A;  4JO0 A;  5K0W A;  2P97 A;  3VQZ A;  4AX1 B;  4RAW A;  2A7M A;  4EYF A;  2BFZ A;  2FHX B;  4TYT A;  5ACP A;  1ZTC A;  2XR1 A;  3RPC A;  4XUK A;  4C1F A;  4GYU A;  4DIL A;  5AHO A;  2P18 A;  4TZ9 A;  5K4M A;  4TZF A;  3IEM A;  1DXK A;  1P9E A;  2BTN A;  2DKF A;  2AIO A;  4HL1 A;  3SW3 A;  2BFK A;  1X8G A;  4C1H A;  2Y8A A;  3X2X A;  5FQC A;  4UAM A;  2NZF A;  4FSB A;  2HB9 A;  4PVT A;  2YZ3 A;  4B87 A;  2QED A;  4HKY A;  4LE6 A;  1DD6 A;  5ACW A;  2WYL A;  2GCU A;  4ZEJ A;  3H3E A;  3DHC A;  4TZE A;  3BC2 A;  5AXO A;  3VPE A;  3IEL A;  1KO3 A;  3AF5 A;  1ZKP A;  3ESH A;  3RKJ A;  5HH4 A;  3SFP A;  5K4K A;  3DHB A;  4UWS B;  5LMC A;  2BG8 A;  3I14 A;  2ZO4 A;  3SD9 A;  2WRS A;  3KNS A;  2UYX A;  1VJN A;  4Z6X A;  4AWY B;  2GMN A;  2ZZI A;  2I7V A;  3I0V A;  5EH9 A;  4BP0 A;  1JJT A;  4J5F A;  4ZO3 A;  4RAM A;  4XWT A;  4EY2 A;  1KR3 A;  3SBL A;  1ZNB A;  4NQ6 A;  3IEK A;  2I7X A;  5LCH A;  2YNV B;  4FEK A;  2FK6 A;  4BZ3 A;  1WW1 A;  3LVZ A;  2Q0I A;  2WYM C;  5A87 A;  4Z67 A;  2FU9 A;  2DOO A;  2M5D A;  3FCZ A;  5A0V A;  5EW0 A;  5B3R A;  4EXY A;  5LE1 A;  4AD9 A;  4CHL A;  1DDK A;  5LLD A;  1L9Y A;  4GCW A;  1WUP A;  2I7T A;  5LCA A;  1WRA A;  4KEP A;  1MQO A;  4XWW A;  2NZE A;  3RKK A;  3ADR A;  5HIO A;  3BV6 A;  2NXA A;  2QDT A;  5HIS A;  3F9O A;  3I13 A;  4RBS A;  4UBQ A;  2BR6 A;  2BG8 B;  2GKL A;  5KIL A;  3TP9 A;  1JJE A;  3I11 A;  2OHH A;  3T9M A;  2ZWR A;  2BIB A;  4HL2 A;  3ZWF A;  5LS3 A;  3I15 A;  3R2U A;  1HLK A; 
#chains in the Genus database with same CATH topology
 2WHG A;  4GYQ A;  4V0H A;  1BMC A;  3QH8 A;  4RM5 A;  4NUR A;  3A4Y A;  1X8H A;  3KNR A;  1M2X A;  1YCF A;  3BK2 A;  5ACS A;  5HIQ A;  3IDZ A;  2YNT A;  4YSL A;  4C09 A;  4ZO2 A;  1XTO A;  2NYP A;  3IE2 A;  5ACT A;  2BC2 A;  2CG2 A;  3T3N A;  4EFZ A;  5LCF A;  5A23 A;  4F6Z A;  5AJL A;  5EV6 A;  1KO2 A;  3PY6 A;  2E7Y A;  2AZ4 A;  2QJS A;  5HH6 A;  2BMI A;  3X2Y A;  2VW8 A;  2BFL A;  4C1G A;  2Y8B A;  4UWO B;  3JXP A;  2QDS A;  3PG4 A;  1A8T A;  3SPU A;  4TYF A;  4YSB A;  3S0Z A;  1Y44 A;  2FU8 A;  3X2Z A;  4UWR B;  2YNU A;  3WXC A;  2XF4 A;  4C1D A;  1X8I A;  3FAI A;  3X30 A;  3PY5 A;  2GFK A;  5EVB A;  1SML A;  4H0D A;  2M5C A;  5LM6 A;  3IOG A;  2YCB A;  3L6N A;  4EYB A;  2R2D A;  2Y87 A;  2QIN A;  2FU7 A;  3ZNB A;  1YCH A;  4Z7R A;  5ACX A;  3G1P A;  5FQA A;  4D02 A;  5A0T A;  5KIK A;  2P4Z A;  5ACU A;  1QH5 A;  3IE0 A;  4O98 A;  2CFZ A;  3DHA A;  5A5Z A;  2FM6 A;  4D1V A;  4EYL A;  4RL2 A;  4TZB A;  4D1U A;  1BVT A;  1BC2 A;  2H6A A;  5AXR A;  1K07 A;  4Z5Z A;  1VGN A;  2FU6 A;  4AX0 B;  4KEQ A;  1WUO A;  5EVK A;  1A7T A;  4RL0 A;  3T3O A;  2BG7 A;  4F6H A;  2OHI A;  1VME A;  5AEB A;  3AJ3 A;  2Q0J A;  3MD7 A;  4ZNB A;  4U4L A;  3ZR9 A;  4YSK A;  5K4N A;  5FQB A;  2CG3 A;  5B15 A;  4UA4 A;  4FR7 A;  4WD6 A;  1YCG A;  2GFJ A;  5EV8 A;  4Z60 A;  5EHT A;  2Q9U A;  3P2U A;  5EWA A;  1XM8 A;  4J5H A;  3DH8 A;  1E5D A;  5LSC A;  2BGA A;  2P1E A;  5HIP A;  5AHR A;  4NQ4 A;  3BK1 A;  4PVO A;  5AYA A;  3IOF A;  1QH3 A;  2OHJ A;  2BFZ B;  4AWZ A;  2BG2 A;  4Z5Y A;  4C1E A;  5ACR A;  5ACV A;  3AF6 A;  3KL7 A;  2YNW A;  4D1W A;  4DIK A;  4D1T A;  5B1U A;  2BG6 A;  2YNV A;  2YNT B;  5EVD A;  2ZNB A;  3Q6V A;  5DPX A;  3IE1 A;  4EXS A;  2FHX A;  1JT1 A;  2Q42 A;  4UWP B;  4NQ5 A;  3ZQ4 A;  3SRX A;  5HH5 A;  5IQK A;  2CBN A;  2WYM A;  4C1C A;  4NQ2 A;  4P62 A;  5ACQ A;  4JO0 A;  5K0W A;  2P97 A;  3VQZ A;  4AX1 B;  4RAW A;  2A7M A;  4EYF A;  2BFZ A;  2FHX B;  4TYT A;  4AXH A;  5ACP A;  1ZTC A;  2XR1 A;  3RPC A;  4XUK A;  4C1F A;  4GYU A;  4DIL A;  5AHO A;  2P18 A;  5AIJ A;  4TZ9 A;  5K4M A;  4TZF A;  3IEM A;  1DXK A;  1P9E A;  2BTN A;  2DKF A;  2AIO A;  4HL1 A;  3SW3 A;  2BFK A;  1X8G A;  2YHE A;  4C1H A;  2Y8A A;  3X2X A;  5FQC A;  4UAM A;  2NZF A;  4FSB A;  2HB9 A;  4PVT A;  2YZ3 A;  4B87 A;  2QED A;  4HKY A;  4LE6 A;  1DD6 A;  5ACW A;  2WYL A;  2GCU A;  4ZEJ A;  3H3E A;  3DHC A;  4TZE A;  3BC2 A;  5AXO A;  3VPE A;  3IEL A;  1KO3 A;  3AF5 A;  1ZKP A;  3ESH A;  3RKJ A;  5HH4 A;  3SFP A;  4AV7 A;  5K4K A;  3DHB A;  4UWS B;  5LMC A;  2BG8 A;  3I14 A;  2ZO4 A;  3SD9 A;  2WRS A;  3KNS A;  2UYX A;  1VJN A;  4Z6X A;  4AWY B;  2GMN A;  2ZZI A;  2I7V A;  3I0V A;  5EH9 A;  4BP0 A;  1JJT A;  4J5F A;  4ZO3 A;  4RAM A;  4XWT A;  4EY2 A;  1KR3 A;  3SBL A;  1ZNB A;  4NQ6 A;  4PDX A;  3IEK A;  2I7X A;  5LCH A;  2YNV B;  4FEK A;  2FK6 A;  4BZ3 A;  1WW1 A;  2CFU A;  3LVZ A;  2Q0I A;  2WYM C;  5A87 A;  4Z67 A;  2FU9 A;  2DOO A;  2M5D A;  3FCZ A;  5A0V A;  5EW0 A;  5B3R A;  4EXY A;  5LE1 A;  4AD9 A;  4CHL A;  1DDK A;  5LLD A;  1L9Y A;  4GCW A;  1WUP A;  2I7T A;  5LCA A;  1WRA A;  4KEP A;  1MQO A;  4XWW A;  2NZE A;  3RKK A;  3ADR A;  5HIO A;  3BV6 A;  2NXA A;  2QDT A;  5HIS A;  3F9O A;  3I13 A;  4RBS A;  4UBQ A;  2BR6 A;  2BG8 B;  2GKL A;  5KIL A;  3TP9 A;  1JJE A;  3I11 A;  2OHH A;  3T9M A;  2ZWR A;  2BIB A;  4HL2 A;  3ZWF A;  5LS3 A;  3I15 A;  3R2U A;  1HLK A; 
#chains in the Genus database with same CATH homology
 2WHG A;  4GYQ A;  4V0H A;  1BMC A;  3QH8 A;  4RM5 A;  3A4Y A;  1X8H A;  3KNR A;  1M2X A;  1YCF A;  3BK2 A;  5ACS A;  5HIQ A;  3IDZ A;  2YNT A;  4YSL A;  4C09 A;  4ZO2 A;  1XTO A;  2NYP A;  3IE2 A;  5ACT A;  2BC2 A;  3T3N A;  4EFZ A;  5LCF A;  4F6Z A;  5EV6 A;  1KO2 A;  3PY6 A;  2E7Y A;  2AZ4 A;  2QJS A;  5HH6 A;  2BMI A;  3X2Y A;  2VW8 A;  2BFL A;  4C1G A;  2Y8B A;  4UWO B;  3JXP A;  2QDS A;  3PG4 A;  1A8T A;  3SPU A;  4TYF A;  4YSB A;  3S0Z A;  1Y44 A;  2FU8 A;  3X2Z A;  4UWR B;  2YNU A;  3WXC A;  2XF4 A;  4C1D A;  1X8I A;  3FAI A;  3X30 A;  3PY5 A;  2GFK A;  5EVB A;  1SML A;  4H0D A;  2M5C A;  5LM6 A;  3IOG A;  2YCB A;  3L6N A;  4EYB A;  2R2D A;  2Y87 A;  2QIN A;  2FU7 A;  3ZNB A;  1YCH A;  4Z7R A;  5ACX A;  3G1P A;  5FQA A;  4D02 A;  5A0T A;  5KIK A;  2P4Z A;  5ACU A;  1QH5 A;  3IE0 A;  4O98 A;  3DHA A;  5A5Z A;  2FM6 A;  4D1V A;  4EYL A;  4RL2 A;  4TZB A;  4D1U A;  1BVT A;  1BC2 A;  2H6A A;  5AXR A;  1K07 A;  4Z5Z A;  1VGN A;  2FU6 A;  4AX0 B;  4KEQ A;  1WUO A;  5EVK A;  1A7T A;  4RL0 A;  3T3O A;  2BG7 A;  4F6H A;  2OHI A;  1VME A;  5AEB A;  3AJ3 A;  2Q0J A;  3MD7 A;  4ZNB A;  4U4L A;  3ZR9 A;  4YSK A;  5K4N A;  5FQB A;  5B15 A;  4UA4 A;  4FR7 A;  4WD6 A;  1YCG A;  2GFJ A;  5EV8 A;  4Z60 A;  5EHT A;  2Q9U A;  3P2U A;  5EWA A;  1XM8 A;  4J5H A;  3DH8 A;  1E5D A;  5LSC A;  2BGA A;  2P1E A;  5HIP A;  5AHR A;  4NQ4 A;  3BK1 A;  4PVO A;  5AYA A;  3IOF A;  1QH3 A;  2OHJ A;  2BFZ B;  4AWZ A;  2BG2 A;  4Z5Y A;  4C1E A;  5ACR A;  5ACV A;  3AF6 A;  3KL7 A;  2YNW A;  4D1W A;  4DIK A;  4D1T A;  5B1U A;  2BG6 A;  2YNV A;  2YNT B;  5EVD A;  2ZNB A;  3Q6V A;  5DPX A;  3IE1 A;  4EXS A;  2FHX A;  1JT1 A;  2Q42 A;  4UWP B;  4NQ5 A;  3ZQ4 A;  3SRX A;  5HH5 A;  5IQK A;  2CBN A;  2WYM A;  4C1C A;  4NQ2 A;  4P62 A;  5ACQ A;  4JO0 A;  5K0W A;  2P97 A;  3VQZ A;  4AX1 B;  4RAW A;  2A7M A;  4EYF A;  2BFZ A;  2FHX B;  4TYT A;  5ACP A;  1ZTC A;  2XR1 A;  3RPC A;  4XUK A;  4C1F A;  4GYU A;  4DIL A;  5AHO A;  2P18 A;  4TZ9 A;  5K4M A;  4TZF A;  3IEM A;  1DXK A;  1P9E A;  2BTN A;  2DKF A;  2AIO A;  4HL1 A;  3SW3 A;  2BFK A;  1X8G A;  4C1H A;  2Y8A A;  3X2X A;  5FQC A;  4UAM A;  2NZF A;  4FSB A;  2HB9 A;  4PVT A;  2YZ3 A;  4B87 A;  2QED A;  4HKY A;  4LE6 A;  1DD6 A;  5ACW A;  2WYL A;  2GCU A;  4ZEJ A;  3H3E A;  3DHC A;  4TZE A;  3BC2 A;  5AXO A;  3VPE A;  3IEL A;  1KO3 A;  3AF5 A;  1ZKP A;  3ESH A;  3RKJ A;  5HH4 A;  3SFP A;  5K4K A;  3DHB A;  4UWS B;  5LMC A;  2BG8 A;  3I14 A;  2ZO4 A;  3SD9 A;  2WRS A;  3KNS A;  2UYX A;  1VJN A;  4Z6X A;  4AWY B;  2GMN A;  2ZZI A;  2I7V A;  3I0V A;  5EH9 A;  4BP0 A;  1JJT A;  4J5F A;  4ZO3 A;  4RAM A;  4XWT A;  4EY2 A;  1KR3 A;  3SBL A;  1ZNB A;  4NQ6 A;  3IEK A;  2I7X A;  5LCH A;  2YNV B;  4FEK A;  2FK6 A;  4BZ3 A;  1WW1 A;  3LVZ A;  2Q0I A;  2WYM C;  5A87 A;  4Z67 A;  2FU9 A;  2DOO A;  2M5D A;  3FCZ A;  5A0V A;  5EW0 A;  5B3R A;  4EXY A;  5LE1 A;  4AD9 A;  4CHL A;  1DDK A;  5LLD A;  1L9Y A;  4GCW A;  1WUP A;  2I7T A;  5LCA A;  1WRA A;  4KEP A;  1MQO A;  4XWW A;  2NZE A;  3RKK A;  3ADR A;  5HIO A;  3BV6 A;  2NXA A;  2QDT A;  5HIS A;  3F9O A;  3I13 A;  4RBS A;  4UBQ A;  2BR6 A;  2BG8 B;  2GKL A;  5KIL A;  3TP9 A;  1JJE A;  3I11 A;  2OHH A;  3T9M A;  2ZWR A;  2BIB A;  4HL2 A;  3ZWF A;  5LS3 A;  3I15 A;  3R2U A;  1HLK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...