4AWZA

Crystal structure of the mobile metallo-beta-lactamase aim-1 from pseudomonas aeruginosa: insights into antibiotic binding and the role of gln157
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
269
structure length
269
Chain Sequence
ASRGCADDAGWNDPAMPLKVYGNTWYVGTCGISALLVTSDAGHILVDAATPQAGPQILANIRALGFRPEDVRAIVFSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLPDRTDPQFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRSCEGDDCRQMVYADSLTAISDDVFRYSDDAAHPGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRIGPRAAAPLMDTTACRRYAQGARQRLEKRLAEEAAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METALLO-BETA-LACTAMASE AIM-1
publication title Crystal Structure of the Mobile Metallo-Beta-Lactamase Aim-1 from Pseudomonas Aeruginosa: Insights Into Antibiotic Binding and the Role of Gln157.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 90
structure length 269
sequence length 269
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4awzA00
4D1WA 2DOOA 2YNTB 4Z7RA 4NQ2A 5HIQA 4C1CA 3ZNBA 4C09A 2ZWRA 3IELA 4J5FA 4UWSB 3SFPA 5IQKA 2BFKA 2I7TA 1A7TA 4HL2A 2YNTA 2YNUA 4ZNBA 3KL7A 5EV8A 1WRAA 2GMNA 4DILA 1X8IA 2HB9A 4FSBA 2GFJA 2NZFA 5HIOA 1MQOA 2BTNA 4HKYA 5AXOA 1VJNA 5HH5A 5ACPA 5LCAA 2NZEA 2YNWA 3T9MA 4KEPA 3I13A 4AWYB 5AXRA 3RKJA 5K0WA 3SRXA 2DKFA 5LM6A 4FR7A 4B87A 1JT1A 4UA4A 1A8TA 4TYFA 2BG6A 3PG4A 2FU7A 3X2ZA 5HH6A 5LS3A 5HH4A 4LE6A 3ZQ4A 1L9YA 3IOGA 3IEKA 2BC2A 2QEDA 2XF4A 3ZWFA 2OHHA 2QINA 4EYLA 3IE2A 4RL2A 4EXSA 4TZEA 2FHXA 1P9EA 5EVKA 5K4NA 4XWTA 2I7VA 5LCHA 2Q42A 3DH8A 1ZKPA 5KIKA 5ACVA 2WYLA 1HLKA 3AF6A 5ACWA 5ACTA 4EYBA 5HIPA 2OHIA 3I0VA 2Q0JA 2ZO4A 4D02A 3L6NA 4XWWA 1E5DA 4O98A 4Z5YA 4C1FA 2Q9UA 1WUOA 3VQZA 4RM5A 4BP0A 5AEBA 2UYXA 5EHTA 3AF5A 2I7XA 2YNVA 2BFZB 2P18A 1K07A 4V0HA 4RAWA 3WXCA 4YSBA 4F6ZA 3DHCA 3TP9A 1WUPA 1DD6A 4ZO2A 2BFLA 4YSLA 2YCBA 2ZNBA 4AD9A 4WD6A 4C1EA 4EFZA 4P62A 4TYTA 4PVTA 3SW3A 2Y8AA 3KNRA 3VPEA 2M5DA 4HL1A 4BZ3A 5LSCA 5DPXA 2AZ4A 2FU6A 3G1PA 3R2UA 4D1TA 3PY6A 1BC2A 5B3RA 1QH3A 5B15A 3KNSA 5ACSA 4D1VA 3IE1A 3X2YA 1YCGA 4AWZA 5EVDA 2Y8BA 5K4MA 1ZNBA 3IEMA 2FK6A 3BK2A 3BC2A 3ZR9A 2XR1A 4NQ6A 1VMEA 5ACUA 3T3OA 5FQCA 4EY2A 2R2DA 3I14A 2P4ZA 1X8GA 2BGAA 4EXYA 4NQ4A 5ACRA 4Z60A 3LVZA 2CBNA 3QH8A 4UAMA 5LCFA 3F9OA 4UWOB 3SPUA 5LLDA 2Y87A 5A0VA 4C1GA 4Z5ZA 2FM6A 4UWPB 4JO0A 5K4KA 4GCWA 2P97A 2GKLA 1XM8A 2BG8B 1WW1A 4FEKA 3X2XA 2BG7A 1M2XA 2VW8A 2BIBA 1YCFA 4PVOA 1XTOA 3JXPA 2WYMA 4UBQA 4Z6XA 3I15A 5A87A 5LMCA 2GFKA 1X8HA 5FQAA 4GYUA 2BG8A 2Q0IA 1DDKA 3Q6VA 2BFZA 3IE0A 1KO3A 1QH5A 2BMIA 3PY5A 2OHJA 2NXAA 2BR6A 2YZ3A 1DXKA 3SD9A 1ZTCA 5EW0A 4Z67A 3RKKA 2ZZIA 3X30A 2E7YA 2H6AA 3T3NA 3IOFA 3SBLA 3BK1A 2QDSA 4GYQA 4AX0B 3FCZA 4U4LA 4D1UA 4XUKA 1BVTA 3P2UA 5EWAA 4KEQA 2AIOA 1BMCA 3DHBA 3AJ3A 1JJTA 4DIKA 5EV6A 2QJSA 5HISA 4RBSA 2FHXB 5A5ZA 4ZO3A 3ADRA 3I11A 3H3EA 5KILA 5ACQA 5AYAA 5ACXA 4F6HA 1VGNA 4YSKA 3ESHA 2FU9A 3BV6A 2FU8A 5A0TA 2BG2A 5EVBA 4EYFA 2QDTA 4RAMA 4NQ5A 4J5HA 3RPCA 2WRSA 4CHLA 1YCHA 3DHAA 1Y44A 2WYMC 2M5CA 4C1HA 5B1UA 5AHOA 5LE1A 2GCUA 3FAIA 4TZFA 5FQBA 5AHRA 4C1DA 4H0DA 2P1EA 2YNVB 1SMLA 3IDZA 4UWRB 1JJEA 3MD7A 1KR3A 2A7MA 1KO2A 3S0ZA 2NYPA 4TZBA 5EH9A 2WHGA 4TZ9A 4AX1B 4RL0A 4ZEJA 3A4YA
chains in the Genus database with same CATH superfamily
4D1WA 2DOOA 2YNTB 4Z7RA 4NQ2A 4PDXA 5HIQA 4C1CA 3ZNBA 4C09A 2ZWRA 2CG2A 3IELA 4J5FA 4UWSB 3SFPA 5IQKA 2BFKA 2I7TA 1A7TA 4HL2A 2YNTA 2YNUA 4ZNBA 3KL7A 5EV8A 1WRAA 2GMNA 4DILA 1X8IA 2HB9A 4FSBA 2GFJA 2NZFA 5HIOA 1MQOA 2BTNA 4HKYA 5AXOA 1VJNA 5HH5A 5ACPA 5LCAA 2NZEA 2YNWA 3T9MA 4KEPA 3I13A 4AWYB 5AXRA 3RKJA 5K0WA 3SRXA 2DKFA 5LM6A 4FR7A 4B87A 1JT1A 4UA4A 1A8TA 2CFZA 4TYFA 4AV7A 2BG6A 3PG4A 2FU7A 3X2ZA 5HH6A 5LS3A 5HH4A 4LE6A 3ZQ4A 1L9YA 3IOGA 3IEKA 2BC2A 2QEDA 2XF4A 3ZWFA 2OHHA 2QINA 4EYLA 3IE2A 4RL2A 4EXSA 4TZEA 2FHXA 1P9EA 5EVKA 5K4NA 4XWTA 2I7VA 5LCHA 2Q42A 3DH8A 1ZKPA 5KIKA 5ACVA 2WYLA 1HLKA 3AF6A 5ACWA 5ACTA 4EYBA 5HIPA 2OHIA 3I0VA 2Q0JA 2ZO4A 4D02A 3L6NA 4XWWA 1E5DA 4O98A 4AXHA 4Z5YA 4C1FA 2Q9UA 1WUOA 3VQZA 4RM5A 4BP0A 5AEBA 2UYXA 5EHTA 3AF5A 2I7XA 2YNVA 2BFZB 2P18A 1K07A 4V0HA 4RAWA 3WXCA 4YSBA 4F6ZA 3DHCA 3TP9A 1WUPA 1DD6A 4ZO2A 2BFLA 4YSLA 2YCBA 2ZNBA 4AD9A 4WD6A 4C1EA 4EFZA 4P62A 4TYTA 4PVTA 3SW3A 2Y8AA 3KNRA 3VPEA 2M5DA 4HL1A 4BZ3A 5LSCA 5DPXA 2CG3A 2AZ4A 2FU6A 3G1PA 3R2UA 4D1TA 3PY6A 1BC2A 5B3RA 1QH3A 5B15A 4NURA 3KNSA 5ACSA 4D1VA 3IE1A 3X2YA 1YCGA 5AIJA 4AWZA 5EVDA 2Y8BA 5K4MA 1ZNBA 3IEMA 2FK6A 3BK2A 3BC2A 3ZR9A 2XR1A 4NQ6A 1VMEA 5ACUA 3T3OA 5FQCA 4EY2A 2R2DA 3I14A 2P4ZA 1X8GA 2BGAA 4EXYA 4NQ4A 5ACRA 4Z60A 3LVZA 2CBNA 3QH8A 4UAMA 5LCFA 3F9OA 4UWOB 3SPUA 5LLDA 2Y87A 5A0VA 4C1GA 4Z5ZA 2FM6A 4UWPB 4JO0A 5K4KA 4GCWA 2P97A 2GKLA 1XM8A 2BG8B 1WW1A 4FEKA 3X2XA 2BG7A 1M2XA 2VW8A 2BIBA 1YCFA 4PVOA 1XTOA 3JXPA 2WYMA 4UBQA 4Z6XA 3I15A 5A87A 5A23A 5LMCA 2GFKA 1X8HA 5FQAA 4GYUA 2BG8A 2Q0IA 1DDKA 3Q6VA 2BFZA 3IE0A 2YHEA 1KO3A 1QH5A 2BMIA 3PY5A 2OHJA 2CFUA 2NXAA 2BR6A 2YZ3A 1DXKA 3SD9A 1ZTCA 5EW0A 4Z67A 3RKKA 2ZZIA 3X30A 2E7YA 2H6AA 3T3NA 3IOFA 3SBLA 3BK1A 2QDSA 4GYQA 4AX0B 3FCZA 4U4LA 4D1UA 4XUKA 1BVTA 3P2UA 5EWAA 4KEQA 2AIOA 1BMCA 3DHBA 3AJ3A 1JJTA 4DIKA 5EV6A 2QJSA 5HISA 4RBSA 2FHXB 5A5ZA 4ZO3A 3ADRA 3I11A 3H3EA 5KILA 5ACQA 5AYAA 5ACXA 4F6HA 1VGNA 4YSKA 3ESHA 2FU9A 3BV6A 2FU8A 5A0TA 2BG2A 5EVBA 4EYFA 2QDTA 4RAMA 4NQ5A 4J5HA 3RPCA 2WRSA 4CHLA 1YCHA 3DHAA 1Y44A 2WYMC 2M5CA 4C1HA 5B1UA 5AHOA 5LE1A 2GCUA 3FAIA 4TZFA 5FQBA 5AHRA 4C1DA 4H0DA 2P1EA 2YNVB 1SMLA 5AJLA 3IDZA 4UWRB 1JJEA 3MD7A 1KR3A 2A7MA 1KO2A 3S0ZA 2NYPA 4TZBA 5EH9A 2WHGA 4TZ9A 4AX1B 4RL0A 4ZEJA 3A4YA
chains in the Genus database with same CATH topology
4D1WA 2DOOA 2YNTB 4Z7RA 4NQ2A 5HIQA 4C1CA 3ZNBA 4C09A 2ZWRA 3IELA 4J5FA 4UWSB 3SFPA 5IQKA 2BFKA 2I7TA 1A7TA 4HL2A 2YNTA 2YNUA 4ZNBA 3KL7A 5EV8A 1WRAA 2GMNA 4DILA 1X8IA 2HB9A 4FSBA 2GFJA 2NZFA 5HIOA 1MQOA 2BTNA 4HKYA 5AXOA 1VJNA 5HH5A 5ACPA 5LCAA 2NZEA 2YNWA 3T9MA 4KEPA 3I13A 4AWYB 5AXRA 3RKJA 5K0WA 3SRXA 2DKFA 5LM6A 4FR7A 4B87A 1JT1A 4UA4A 1A8TA 4TYFA 2BG6A 3PG4A 2FU7A 3X2ZA 5HH6A 5LS3A 5HH4A 4LE6A 3ZQ4A 1L9YA 3IOGA 3IEKA 2BC2A 2QEDA 2XF4A 3ZWFA 2OHHA 2QINA 4EYLA 3IE2A 4RL2A 4EXSA 4TZEA 2FHXA 1P9EA 5EVKA 5K4NA 4XWTA 2I7VA 5LCHA 2Q42A 3DH8A 1ZKPA 5KIKA 5ACVA 2WYLA 1HLKA 3AF6A 5ACWA 5ACTA 4EYBA 5HIPA 2OHIA 3I0VA 2Q0JA 2ZO4A 4D02A 3L6NA 4XWWA 1E5DA 4O98A 4Z5YA 4C1FA 2Q9UA 1WUOA 3VQZA 4RM5A 4BP0A 5AEBA 2UYXA 5EHTA 3AF5A 2I7XA 2YNVA 2BFZB 2P18A 1K07A 4V0HA 4RAWA 3WXCA 4YSBA 4F6ZA 3DHCA 3TP9A 1WUPA 1DD6A 4ZO2A 2BFLA 4YSLA 2YCBA 2ZNBA 4AD9A 4WD6A 4C1EA 4EFZA 4P62A 4TYTA 4PVTA 3SW3A 2Y8AA 3KNRA 3VPEA 2M5DA 4HL1A 4BZ3A 5LSCA 5DPXA 2AZ4A 2FU6A 3G1PA 3R2UA 4D1TA 3PY6A 1BC2A 5B3RA 1QH3A 5B15A 3KNSA 5ACSA 4D1VA 3IE1A 3X2YA 1YCGA 4AWZA 5EVDA 2Y8BA 5K4MA 1ZNBA 3IEMA 2FK6A 3BK2A 3BC2A 3ZR9A 2XR1A 4NQ6A 1VMEA 5ACUA 3T3OA 5FQCA 4EY2A 2R2DA 3I14A 2P4ZA 1X8GA 2BGAA 4EXYA 4NQ4A 5ACRA 4Z60A 3LVZA 2CBNA 3QH8A 4UAMA 5LCFA 3F9OA 4UWOB 3SPUA 5LLDA 2Y87A 5A0VA 4C1GA 4Z5ZA 2FM6A 4UWPB 4JO0A 5K4KA 4GCWA 2P97A 2GKLA 1XM8A 2BG8B 1WW1A 4FEKA 3X2XA 2BG7A 1M2XA 2VW8A 2BIBA 1YCFA 4PVOA 1XTOA 3JXPA 2WYMA 4UBQA 4Z6XA 3I15A 5A87A 5LMCA 2GFKA 1X8HA 5FQAA 4GYUA 2BG8A 2Q0IA 1DDKA 3Q6VA 2BFZA 3IE0A 1KO3A 1QH5A 2BMIA 3PY5A 2OHJA 2NXAA 2BR6A 2YZ3A 1DXKA 3SD9A 1ZTCA 5EW0A 4Z67A 3RKKA 2ZZIA 3X30A 2E7YA 2H6AA 3T3NA 3IOFA 3SBLA 3BK1A 2QDSA 4GYQA 4AX0B 3FCZA 4U4LA 4D1UA 4XUKA 1BVTA 3P2UA 5EWAA 4KEQA 2AIOA 1BMCA 3DHBA 3AJ3A 1JJTA 4DIKA 5EV6A 2QJSA 5HISA 4RBSA 2FHXB 5A5ZA 4ZO3A 3ADRA 3I11A 3H3EA 5KILA 5ACQA 5AYAA 5ACXA 4F6HA 1VGNA 4YSKA 3ESHA 2FU9A 3BV6A 2FU8A 5A0TA 2BG2A 5EVBA 4EYFA 2QDTA 4RAMA 4NQ5A 4J5HA 3RPCA 2WRSA 4CHLA 1YCHA 3DHAA 1Y44A 2WYMC 2M5CA 4C1HA 5B1UA 5AHOA 5LE1A 2GCUA 3FAIA 4TZFA 5FQBA 5AHRA 4C1DA 4H0DA 2P1EA 2YNVB 1SMLA 3IDZA 4UWRB 1JJEA 3MD7A 1KR3A 2A7MA 1KO2A 3S0ZA 2NYPA 4TZBA 5EH9A 2WHGA 4TZ9A 4AX1B 4RL0A 4ZEJA 3A4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D1W A;  2DOO A;  2YNT B;  4Z7R A;  4NQ2 A;  5HIQ A;  4C1C A;  3ZNB A;  4C09 A;  2ZWR A;  3IEL A;  4J5F A;  4UWS B;  3SFP A;  5IQK A;  2BFK A;  2I7T A;  1A7T A;  4HL2 A;  2YNT A;  2YNU A;  4ZNB A;  3KL7 A;  5EV8 A;  1WRA A;  2GMN A;  4DIL A;  1X8I A;  2HB9 A;  4FSB A;  2GFJ A;  2NZF A;  5HIO A;  1MQO A;  2BTN A;  4HKY A;  5AXO A;  1VJN A;  5HH5 A;  5ACP A;  5LCA A;  2NZE A;  2YNW A;  3T9M A;  4KEP A;  3I13 A;  4AWY B;  5AXR A;  3RKJ A;  5K0W A;  3SRX A;  2DKF A;  5LM6 A;  4FR7 A;  4B87 A;  1JT1 A;  4UA4 A;  1A8T A;  4TYF A;  2BG6 A;  3PG4 A;  2FU7 A;  3X2Z A;  5HH6 A;  5LS3 A;  5HH4 A;  4LE6 A;  3ZQ4 A;  1L9Y A;  3IOG A;  3IEK A;  2BC2 A;  2QED A;  2XF4 A;  3ZWF A;  2OHH A;  2QIN A;  4EYL A;  3IE2 A;  4RL2 A;  4EXS A;  4TZE A;  2FHX A;  1P9E A;  5EVK A;  5K4N A;  4XWT A;  2I7V A;  5LCH A;  2Q42 A;  3DH8 A;  1ZKP A;  5KIK A;  5ACV A;  2WYL A;  1HLK A;  3AF6 A;  5ACW A;  5ACT A;  4EYB A;  5HIP A;  2OHI A;  3I0V A;  2Q0J A;  2ZO4 A;  4D02 A;  3L6N A;  4XWW A;  1E5D A;  4O98 A;  4Z5Y A;  4C1F A;  2Q9U A;  1WUO A;  3VQZ A;  4RM5 A;  4BP0 A;  5AEB A;  2UYX A;  5EHT A;  3AF5 A;  2I7X A;  2YNV A;  2BFZ B;  2P18 A;  1K07 A;  4V0H A;  4RAW A;  3WXC A;  4YSB A;  4F6Z A;  3DHC A;  3TP9 A;  1WUP A;  1DD6 A;  4ZO2 A;  2BFL A;  4YSL A;  2YCB A;  2ZNB A;  4AD9 A;  4WD6 A;  4C1E A;  4EFZ A;  4P62 A;  4TYT A;  4PVT A;  3SW3 A;  2Y8A A;  3KNR A;  3VPE A;  2M5D A;  4HL1 A;  4BZ3 A;  5LSC A;  5DPX A;  2AZ4 A;  2FU6 A;  3G1P A;  3R2U A;  4D1T A;  3PY6 A;  1BC2 A;  5B3R A;  1QH3 A;  5B15 A;  3KNS A;  5ACS A;  4D1V A;  3IE1 A;  3X2Y A;  1YCG A;  4AWZ A;  5EVD A;  2Y8B A;  5K4M A;  1ZNB A;  3IEM A;  2FK6 A;  3BK2 A;  3BC2 A;  3ZR9 A;  2XR1 A;  4NQ6 A;  1VME A;  5ACU A;  3T3O A;  5FQC A;  4EY2 A;  2R2D A;  3I14 A;  2P4Z A;  1X8G A;  2BGA A;  4EXY A;  4NQ4 A;  5ACR A;  4Z60 A;  3LVZ A;  2CBN A;  3QH8 A;  4UAM A;  5LCF A;  3F9O A;  4UWO B;  3SPU A;  5LLD A;  2Y87 A;  5A0V A;  4C1G A;  4Z5Z A;  2FM6 A;  4UWP B;  4JO0 A;  5K4K A;  4GCW A;  2P97 A;  2GKL A;  1XM8 A;  2BG8 B;  1WW1 A;  4FEK A;  3X2X A;  2BG7 A;  1M2X A;  2VW8 A;  2BIB A;  1YCF A;  4PVO A;  1XTO A;  3JXP A;  2WYM A;  4UBQ A;  4Z6X A;  3I15 A;  5A87 A;  5LMC A;  2GFK A;  1X8H A;  5FQA A;  4GYU A;  2BG8 A;  2Q0I A;  1DDK A;  3Q6V A;  2BFZ A;  3IE0 A;  1KO3 A;  1QH5 A;  2BMI A;  3PY5 A;  2OHJ A;  2NXA A;  2BR6 A;  2YZ3 A;  1DXK A;  3SD9 A;  1ZTC A;  5EW0 A;  4Z67 A;  3RKK A;  2ZZI A;  3X30 A;  2E7Y A;  2H6A A;  3T3N A;  3IOF A;  3SBL A;  3BK1 A;  2QDS A;  4GYQ A;  4AX0 B;  3FCZ A;  4U4L A;  4D1U A;  4XUK A;  1BVT A;  3P2U A;  5EWA A;  4KEQ A;  2AIO A;  1BMC A;  3DHB A;  3AJ3 A;  1JJT A;  4DIK A;  5EV6 A;  2QJS A;  5HIS A;  4RBS A;  2FHX B;  5A5Z A;  4ZO3 A;  3ADR A;  3I11 A;  3H3E A;  5KIL A;  5ACQ A;  5AYA A;  5ACX A;  4F6H A;  1VGN A;  4YSK A;  3ESH A;  2FU9 A;  3BV6 A;  2FU8 A;  5A0T A;  2BG2 A;  5EVB A;  4EYF A;  2QDT A;  4RAM A;  4NQ5 A;  4J5H A;  3RPC A;  2WRS A;  4CHL A;  1YCH A;  3DHA A;  1Y44 A;  2WYM C;  2M5C A;  4C1H A;  5B1U A;  5AHO A;  5LE1 A;  2GCU A;  3FAI A;  4TZF A;  5FQB A;  5AHR A;  4C1D A;  4H0D A;  2P1E A;  2YNV B;  1SML A;  3IDZ A;  4UWR B;  1JJE A;  3MD7 A;  1KR3 A;  2A7M A;  1KO2 A;  3S0Z A;  2NYP A;  4TZB A;  5EH9 A;  2WHG A;  4TZ9 A;  4AX1 B;  4RL0 A;  4ZEJ A;  3A4Y A; 
#chains in the Genus database with same CATH topology
 4D1W A;  2DOO A;  2YNT B;  4Z7R A;  4NQ2 A;  4PDX A;  5HIQ A;  4C1C A;  3ZNB A;  4C09 A;  2ZWR A;  2CG2 A;  3IEL A;  4J5F A;  4UWS B;  3SFP A;  5IQK A;  2BFK A;  2I7T A;  1A7T A;  4HL2 A;  2YNT A;  2YNU A;  4ZNB A;  3KL7 A;  5EV8 A;  1WRA A;  2GMN A;  4DIL A;  1X8I A;  2HB9 A;  4FSB A;  2GFJ A;  2NZF A;  5HIO A;  1MQO A;  2BTN A;  4HKY A;  5AXO A;  1VJN A;  5HH5 A;  5ACP A;  5LCA A;  2NZE A;  2YNW A;  3T9M A;  4KEP A;  3I13 A;  4AWY B;  5AXR A;  3RKJ A;  5K0W A;  3SRX A;  2DKF A;  5LM6 A;  4FR7 A;  4B87 A;  1JT1 A;  4UA4 A;  1A8T A;  2CFZ A;  4TYF A;  4AV7 A;  2BG6 A;  3PG4 A;  2FU7 A;  3X2Z A;  5HH6 A;  5LS3 A;  5HH4 A;  4LE6 A;  3ZQ4 A;  1L9Y A;  3IOG A;  3IEK A;  2BC2 A;  2QED A;  2XF4 A;  3ZWF A;  2OHH A;  2QIN A;  4EYL A;  3IE2 A;  4RL2 A;  4EXS A;  4TZE A;  2FHX A;  1P9E A;  5EVK A;  5K4N A;  4XWT A;  2I7V A;  5LCH A;  2Q42 A;  3DH8 A;  1ZKP A;  5KIK A;  5ACV A;  2WYL A;  1HLK A;  3AF6 A;  5ACW A;  5ACT A;  4EYB A;  5HIP A;  2OHI A;  3I0V A;  2Q0J A;  2ZO4 A;  4D02 A;  3L6N A;  4XWW A;  1E5D A;  4O98 A;  4AXH A;  4Z5Y A;  4C1F A;  2Q9U A;  1WUO A;  3VQZ A;  4RM5 A;  4BP0 A;  5AEB A;  2UYX A;  5EHT A;  3AF5 A;  2I7X A;  2YNV A;  2BFZ B;  2P18 A;  1K07 A;  4V0H A;  4RAW A;  3WXC A;  4YSB A;  4F6Z A;  3DHC A;  3TP9 A;  1WUP A;  1DD6 A;  4ZO2 A;  2BFL A;  4YSL A;  2YCB A;  2ZNB A;  4AD9 A;  4WD6 A;  4C1E A;  4EFZ A;  4P62 A;  4TYT A;  4PVT A;  3SW3 A;  2Y8A A;  3KNR A;  3VPE A;  2M5D A;  4HL1 A;  4BZ3 A;  5LSC A;  5DPX A;  2CG3 A;  2AZ4 A;  2FU6 A;  3G1P A;  3R2U A;  4D1T A;  3PY6 A;  1BC2 A;  5B3R A;  1QH3 A;  5B15 A;  4NUR A;  3KNS A;  5ACS A;  4D1V A;  3IE1 A;  3X2Y A;  1YCG A;  5AIJ A;  4AWZ A;  5EVD A;  2Y8B A;  5K4M A;  1ZNB A;  3IEM A;  2FK6 A;  3BK2 A;  3BC2 A;  3ZR9 A;  2XR1 A;  4NQ6 A;  1VME A;  5ACU A;  3T3O A;  5FQC A;  4EY2 A;  2R2D A;  3I14 A;  2P4Z A;  1X8G A;  2BGA A;  4EXY A;  4NQ4 A;  5ACR A;  4Z60 A;  3LVZ A;  2CBN A;  3QH8 A;  4UAM A;  5LCF A;  3F9O A;  4UWO B;  3SPU A;  5LLD A;  2Y87 A;  5A0V A;  4C1G A;  4Z5Z A;  2FM6 A;  4UWP B;  4JO0 A;  5K4K A;  4GCW A;  2P97 A;  2GKL A;  1XM8 A;  2BG8 B;  1WW1 A;  4FEK A;  3X2X A;  2BG7 A;  1M2X A;  2VW8 A;  2BIB A;  1YCF A;  4PVO A;  1XTO A;  3JXP A;  2WYM A;  4UBQ A;  4Z6X A;  3I15 A;  5A87 A;  5A23 A;  5LMC A;  2GFK A;  1X8H A;  5FQA A;  4GYU A;  2BG8 A;  2Q0I A;  1DDK A;  3Q6V A;  2BFZ A;  3IE0 A;  2YHE A;  1KO3 A;  1QH5 A;  2BMI A;  3PY5 A;  2OHJ A;  2CFU A;  2NXA A;  2BR6 A;  2YZ3 A;  1DXK A;  3SD9 A;  1ZTC A;  5EW0 A;  4Z67 A;  3RKK A;  2ZZI A;  3X30 A;  2E7Y A;  2H6A A;  3T3N A;  3IOF A;  3SBL A;  3BK1 A;  2QDS A;  4GYQ A;  4AX0 B;  3FCZ A;  4U4L A;  4D1U A;  4XUK A;  1BVT A;  3P2U A;  5EWA A;  4KEQ A;  2AIO A;  1BMC A;  3DHB A;  3AJ3 A;  1JJT A;  4DIK A;  5EV6 A;  2QJS A;  5HIS A;  4RBS A;  2FHX B;  5A5Z A;  4ZO3 A;  3ADR A;  3I11 A;  3H3E A;  5KIL A;  5ACQ A;  5AYA A;  5ACX A;  4F6H A;  1VGN A;  4YSK A;  3ESH A;  2FU9 A;  3BV6 A;  2FU8 A;  5A0T A;  2BG2 A;  5EVB A;  4EYF A;  2QDT A;  4RAM A;  4NQ5 A;  4J5H A;  3RPC A;  2WRS A;  4CHL A;  1YCH A;  3DHA A;  1Y44 A;  2WYM C;  2M5C A;  4C1H A;  5B1U A;  5AHO A;  5LE1 A;  2GCU A;  3FAI A;  4TZF A;  5FQB A;  5AHR A;  4C1D A;  4H0D A;  2P1E A;  2YNV B;  1SML A;  5AJL A;  3IDZ A;  4UWR B;  1JJE A;  3MD7 A;  1KR3 A;  2A7M A;  1KO2 A;  3S0Z A;  2NYP A;  4TZB A;  5EH9 A;  2WHG A;  4TZ9 A;  4AX1 B;  4RL0 A;  4ZEJ A;  3A4Y A; 
#chains in the Genus database with same CATH homology
 4D1W A;  2DOO A;  2YNT B;  4Z7R A;  4NQ2 A;  5HIQ A;  4C1C A;  3ZNB A;  4C09 A;  2ZWR A;  3IEL A;  4J5F A;  4UWS B;  3SFP A;  5IQK A;  2BFK A;  2I7T A;  1A7T A;  4HL2 A;  2YNT A;  2YNU A;  4ZNB A;  3KL7 A;  5EV8 A;  1WRA A;  2GMN A;  4DIL A;  1X8I A;  2HB9 A;  4FSB A;  2GFJ A;  2NZF A;  5HIO A;  1MQO A;  2BTN A;  4HKY A;  5AXO A;  1VJN A;  5HH5 A;  5ACP A;  5LCA A;  2NZE A;  2YNW A;  3T9M A;  4KEP A;  3I13 A;  4AWY B;  5AXR A;  3RKJ A;  5K0W A;  3SRX A;  2DKF A;  5LM6 A;  4FR7 A;  4B87 A;  1JT1 A;  4UA4 A;  1A8T A;  4TYF A;  2BG6 A;  3PG4 A;  2FU7 A;  3X2Z A;  5HH6 A;  5LS3 A;  5HH4 A;  4LE6 A;  3ZQ4 A;  1L9Y A;  3IOG A;  3IEK A;  2BC2 A;  2QED A;  2XF4 A;  3ZWF A;  2OHH A;  2QIN A;  4EYL A;  3IE2 A;  4RL2 A;  4EXS A;  4TZE A;  2FHX A;  1P9E A;  5EVK A;  5K4N A;  4XWT A;  2I7V A;  5LCH A;  2Q42 A;  3DH8 A;  1ZKP A;  5KIK A;  5ACV A;  2WYL A;  1HLK A;  3AF6 A;  5ACW A;  5ACT A;  4EYB A;  5HIP A;  2OHI A;  3I0V A;  2Q0J A;  2ZO4 A;  4D02 A;  3L6N A;  4XWW A;  1E5D A;  4O98 A;  4Z5Y A;  4C1F A;  2Q9U A;  1WUO A;  3VQZ A;  4RM5 A;  4BP0 A;  5AEB A;  2UYX A;  5EHT A;  3AF5 A;  2I7X A;  2YNV A;  2BFZ B;  2P18 A;  1K07 A;  4V0H A;  4RAW A;  3WXC A;  4YSB A;  4F6Z A;  3DHC A;  3TP9 A;  1WUP A;  1DD6 A;  4ZO2 A;  2BFL A;  4YSL A;  2YCB A;  2ZNB A;  4AD9 A;  4WD6 A;  4C1E A;  4EFZ A;  4P62 A;  4TYT A;  4PVT A;  3SW3 A;  2Y8A A;  3KNR A;  3VPE A;  2M5D A;  4HL1 A;  4BZ3 A;  5LSC A;  5DPX A;  2AZ4 A;  2FU6 A;  3G1P A;  3R2U A;  4D1T A;  3PY6 A;  1BC2 A;  5B3R A;  1QH3 A;  5B15 A;  3KNS A;  5ACS A;  4D1V A;  3IE1 A;  3X2Y A;  1YCG A;  4AWZ A;  5EVD A;  2Y8B A;  5K4M A;  1ZNB A;  3IEM A;  2FK6 A;  3BK2 A;  3BC2 A;  3ZR9 A;  2XR1 A;  4NQ6 A;  1VME A;  5ACU A;  3T3O A;  5FQC A;  4EY2 A;  2R2D A;  3I14 A;  2P4Z A;  1X8G A;  2BGA A;  4EXY A;  4NQ4 A;  5ACR A;  4Z60 A;  3LVZ A;  2CBN A;  3QH8 A;  4UAM A;  5LCF A;  3F9O A;  4UWO B;  3SPU A;  5LLD A;  2Y87 A;  5A0V A;  4C1G A;  4Z5Z A;  2FM6 A;  4UWP B;  4JO0 A;  5K4K A;  4GCW A;  2P97 A;  2GKL A;  1XM8 A;  2BG8 B;  1WW1 A;  4FEK A;  3X2X A;  2BG7 A;  1M2X A;  2VW8 A;  2BIB A;  1YCF A;  4PVO A;  1XTO A;  3JXP A;  2WYM A;  4UBQ A;  4Z6X A;  3I15 A;  5A87 A;  5LMC A;  2GFK A;  1X8H A;  5FQA A;  4GYU A;  2BG8 A;  2Q0I A;  1DDK A;  3Q6V A;  2BFZ A;  3IE0 A;  1KO3 A;  1QH5 A;  2BMI A;  3PY5 A;  2OHJ A;  2NXA A;  2BR6 A;  2YZ3 A;  1DXK A;  3SD9 A;  1ZTC A;  5EW0 A;  4Z67 A;  3RKK A;  2ZZI A;  3X30 A;  2E7Y A;  2H6A A;  3T3N A;  3IOF A;  3SBL A;  3BK1 A;  2QDS A;  4GYQ A;  4AX0 B;  3FCZ A;  4U4L A;  4D1U A;  4XUK A;  1BVT A;  3P2U A;  5EWA A;  4KEQ A;  2AIO A;  1BMC A;  3DHB A;  3AJ3 A;  1JJT A;  4DIK A;  5EV6 A;  2QJS A;  5HIS A;  4RBS A;  2FHX B;  5A5Z A;  4ZO3 A;  3ADR A;  3I11 A;  3H3E A;  5KIL A;  5ACQ A;  5AYA A;  5ACX A;  4F6H A;  1VGN A;  4YSK A;  3ESH A;  2FU9 A;  3BV6 A;  2FU8 A;  5A0T A;  2BG2 A;  5EVB A;  4EYF A;  2QDT A;  4RAM A;  4NQ5 A;  4J5H A;  3RPC A;  2WRS A;  4CHL A;  1YCH A;  3DHA A;  1Y44 A;  2WYM C;  2M5C A;  4C1H A;  5B1U A;  5AHO A;  5LE1 A;  2GCU A;  3FAI A;  4TZF A;  5FQB A;  5AHR A;  4C1D A;  4H0D A;  2P1E A;  2YNV B;  1SML A;  3IDZ A;  4UWR B;  1JJE A;  3MD7 A;  1KR3 A;  2A7M A;  1KO2 A;  3S0Z A;  2NYP A;  4TZB A;  5EH9 A;  2WHG A;  4TZ9 A;  4AX1 B;  4RL0 A;  4ZEJ A;  3A4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...