4AWZA

Crystal structure of the mobile metallo-beta-lactamase aim-1 from pseudomonas aeruginosa: insights into antibiotic binding and the role of gln157
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
269
structure length
269
Chain Sequence
ASRGCADDAGWNDPAMPLKVYGNTWYVGTCGISALLVTSDAGHILVDAATPQAGPQILANIRALGFRPEDVRAIVFSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLPDRTDPQFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRSCEGDDCRQMVYADSLTAISDDVFRYSDDAAHPGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRIGPRAAAPLMDTTACRRYAQGARQRLEKRLAEEAAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords METALLO-BETA-LACTAMASE AIM-1
publication title Crystal Structure of the Mobile Metallo-Beta-Lactamase Aim-1 from Pseudomonas Aeruginosa: Insights Into Antibiotic Binding and the Role of Gln157.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 90
structure length 269
sequence length 269
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4awzA00
3BV6A 5LM6A 4EXSA 5K4KA 3WXCA 5ACSA 4GYQA 2YNUA 4EYFA 3IE1A 4AWZA 5LLDA 4XWWA 3I11A 2ZO4A 4Z6XA 3L6NA 2OHIA 5FQAA 4UBQA 2BTNA 3A4YA 4TYTA 3AF5A 2WRSA 5HH6A 4F6ZA 2BG7A 3DHAA 4TYFA 2NZFA 1KR3A 2OHHA 1WRAA 2HB9A 2FU8A 1JJTA 2YNWA 4RAWA 3SD9A 4HL2A 4H0DA 2WYMA 2P1EA 3MD7A 4YSLA 2P97A 5EHTA 3KNSA 4YSBA 3DH8A 4RBSA 5HH5A 4C1EA 2UYXA 5ACXA 4UWSB 3SBLA 1X8IA 2BR6A 4J5FA 4AX1B 4J5HA 2YNTB 4D1VA 3IE0A 3RPCA 3H3EA 5LCFA 3IELA 3ESHA 4RL0A 2QJSA 3ZR9A 5K4MA 3I13A 4D1WA 5K4NA 1VJNA 2FM6A 4Z67A 1XM8A 4TZBA 4O98A 4YSKA 1WUPA 4UA4A 2FHXB 3FAIA 3LVZA 2YCBA 2YNVB 1VMEA 5KILA 4XUKA 1JT1A 3FCZA 3ADRA 2H6AA 2NZEA 5LE1A 4GYUA 2BG2A 1HLKA 2ZNBA 2BC2A 4XWTA 2M5CA 2BG6A 2NXAA 2BFLA 2GKLA 2I7TA 5HH4A 5HISA 2VW8A 2R2DA 5LCAA 2Q42A 2ZZIA 1VGNA 2ZWRA 1X8GA 1DXKA 2P4ZA 4C09A 3KNRA 4BZ3A 5AYAA 3PY6A 2GCUA 1YCGA 4AWYB 3I14A 3X2XA 2FU6A 2QEDA 3KL7A 1ZKPA 5ACQA 3IEMA 2WYLA 4KEPA 2Q0JA 4GCWA 4KEQA 1P9EA 4UWRB 3VQZA 2QDSA 3F9OA 5A87A 3IDZA 5LMCA 2OHJA 5EVBA 3PG4A 5AHRA 1MQOA 2AIOA 2Y87A 3Q6VA 4B87A 1BMCA 5EV8A 1ZTCA 5KIKA 4DIKA 2GMNA 3SW3A 4Z7RA 2DOOA 1KO2A 3IEKA 5AXOA 3SRXA 3I15A 4PVTA 2XR1A 4WD6A 4FSBA 4ZNBA 3T9MA 5HIOA 2BG8A 5FQBA 1E5DA 3BC2A 5ACWA 4C1FA 5A0VA 5K0WA 4D1TA 3SFPA 4UWPB 4BP0A 2YNTA 3ZWFA 3TP9A 1BC2A 3IE2A 4NQ4A 4NQ6A 2AZ4A 5ACTA 1ZNBA 5B15A 4LE6A 2FU9A 5HIQA 4FR7A 4C1CA 2Q9UA 3JXPA 2NYPA 3T3OA 4NQ5A 2GFKA 2Y8BA 1DD6A 5B3RA 2FHXA 3X2ZA 3DHBA 4ZEJA 5EVDA 4HKYA 2BFKA 2YZ3A 4UAMA 5HIPA 3P2UA 4ZO3A 2BFZA 1WUOA 4U4LA 4HL1A 3AJ3A 1Y44A 4EYLA 4C1DA 4JO0A 4DILA 4D02A 3X30A 2QDTA 4AX0B 5EW0A 4V0HA 5ACVA 4Z5ZA 5AEBA 4EFZA 4Z60A 5DPXA 1BVTA 2P18A 3RKKA 3PY5A 2E7YA 1DDKA 3AF6A 2A7MA 3R2UA 3I0VA 4TZFA 5LS3A 1QH5A 4C1GA 4AD9A 5ACPA 1K07A 2XF4A 4UWOB 4RAMA 5AXRA 5EH9A 4RL2A 5A0TA 1KO3A 4Z5YA 3VPEA 3BK1A 3G1PA 4ZO2A 3SPUA 1XTOA 5IQKA 5EWAA 3DHCA 2M5DA 2BG8B 3ZQ4A 3ZNBA 4D1UA 3QH8A 3IOGA 2WYMC 4P62A 2DKFA 2I7VA 5ACUA 1L9YA 5EV6A 2I7XA 2FU7A 3S0ZA 4NQ2A 1A8TA 3IOFA 1A7TA 1WW1A 4CHLA 5LCHA 2BMIA 5FQCA 2BGAA 2GFJA 4EXYA 4RM5A 5B1UA 4C1HA 2WHGA 4PVOA 2CBNA 3RKJA 3BK2A 1JJEA 5EVKA 2Y8AA 3T3NA 4F6HA 5A5ZA 1YCHA 1M2XA 1SMLA 1X8HA 5AHOA 2FK6A 4EYBA 2YNVA 4EY2A 2BFZB 2BIBA 3X2YA 2Q0IA 1YCFA 5ACRA 4FEKA 5LSCA 4TZEA 2QINA 4TZ9A 1QH3A
chains in the Genus database with same CATH superfamily
3BV6A 5LM6A 4EXSA 5K4KA 3WXCA 5ACSA 4GYQA 2YNUA 4EYFA 3IE1A 4AWZA 5LLDA 4XWWA 3I11A 2ZO4A 4Z6XA 3L6NA 2OHIA 5FQAA 4UBQA 2BTNA 3A4YA 4TYTA 3AF5A 2WRSA 5HH6A 4F6ZA 2BG7A 3DHAA 4TYFA 2NZFA 1KR3A 2OHHA 1WRAA 2HB9A 2FU8A 1JJTA 2YNWA 4RAWA 3SD9A 4HL2A 4H0DA 2WYMA 2P1EA 3MD7A 4YSLA 2P97A 5EHTA 3KNSA 4YSBA 3DH8A 4RBSA 5HH5A 4C1EA 2UYXA 5ACXA 4UWSB 3SBLA 1X8IA 2BR6A 4J5FA 4AX1B 4J5HA 2YNTB 4D1VA 3IE0A 3RPCA 3H3EA 5LCFA 3IELA 3ESHA 4RL0A 2QJSA 3ZR9A 5K4MA 3I13A 4D1WA 5K4NA 1VJNA 2FM6A 4Z67A 1XM8A 5AJLA 2CG3A 4TZBA 4O98A 4YSKA 1WUPA 4UA4A 2FHXB 3FAIA 3LVZA 2YCBA 2YNVB 1VMEA 5KILA 4XUKA 1JT1A 3FCZA 3ADRA 2H6AA 2NZEA 5LE1A 4GYUA 2BG2A 1HLKA 2ZNBA 2BC2A 4XWTA 2M5CA 2BG6A 2NXAA 2BFLA 2GKLA 2I7TA 4AV7A 5HH4A 5HISA 2VW8A 2R2DA 5LCAA 2Q42A 2ZZIA 1VGNA 2ZWRA 1X8GA 1DXKA 2P4ZA 4C09A 3KNRA 4BZ3A 5AYAA 3PY6A 2GCUA 1YCGA 4AWYB 3I14A 3X2XA 2FU6A 2QEDA 3KL7A 1ZKPA 5ACQA 3IEMA 2WYLA 4KEPA 2Q0JA 4GCWA 4KEQA 1P9EA 4UWRB 3VQZA 2QDSA 3F9OA 5A87A 3IDZA 5LMCA 2OHJA 5EVBA 3PG4A 5AHRA 1MQOA 2CFZA 2AIOA 2Y87A 3Q6VA 4B87A 1BMCA 5EV8A 1ZTCA 5KIKA 4DIKA 2GMNA 3SW3A 4Z7RA 2DOOA 1KO2A 3IEKA 5AXOA 3SRXA 3I15A 4PVTA 2XR1A 4WD6A 4FSBA 4ZNBA 4NURA 3T9MA 5HIOA 2BG8A 5FQBA 1E5DA 3BC2A 5ACWA 4C1FA 5A0VA 5K0WA 4D1TA 4AXHA 3SFPA 4UWPB 4BP0A 2YNTA 3ZWFA 3TP9A 1BC2A 2YHEA 3IE2A 4NQ4A 4NQ6A 2AZ4A 5ACTA 1ZNBA 5B15A 4LE6A 2FU9A 5HIQA 4FR7A 4C1CA 2Q9UA 3JXPA 2NYPA 3T3OA 4NQ5A 2GFKA 2Y8BA 1DD6A 5B3RA 2FHXA 3X2ZA 3DHBA 4ZEJA 5EVDA 4HKYA 2BFKA 2YZ3A 4UAMA 5HIPA 3P2UA 4ZO3A 2BFZA 1WUOA 4U4LA 4HL1A 3AJ3A 1Y44A 4EYLA 4C1DA 4JO0A 4DILA 4D02A 3X30A 2QDTA 4AX0B 5EW0A 4V0HA 5ACVA 4Z5ZA 5AEBA 4EFZA 4Z60A 5DPXA 1BVTA 2P18A 3RKKA 3PY5A 2E7YA 1DDKA 3AF6A 2A7MA 3R2UA 4PDXA 3I0VA 4TZFA 5LS3A 1QH5A 4C1GA 4AD9A 5ACPA 1K07A 2XF4A 4UWOB 4RAMA 5AXRA 2CG2A 5EH9A 4RL2A 5A0TA 5AIJA 1KO3A 4Z5YA 3VPEA 3BK1A 3G1PA 4ZO2A 3SPUA 1XTOA 5IQKA 5EWAA 3DHCA 2M5DA 2BG8B 3ZQ4A 3ZNBA 4D1UA 3QH8A 3IOGA 2WYMC 4P62A 2DKFA 2I7VA 5ACUA 1L9YA 5EV6A 2I7XA 2FU7A 3S0ZA 4NQ2A 1A8TA 3IOFA 1A7TA 1WW1A 4CHLA 5LCHA 2BMIA 5FQCA 2BGAA 2GFJA 4EXYA 4RM5A 5B1UA 4C1HA 2WHGA 4PVOA 2CBNA 3RKJA 3BK2A 1JJEA 5EVKA 2CFUA 5A23A 2Y8AA 3T3NA 4F6HA 5A5ZA 1YCHA 1M2XA 1SMLA 1X8HA 5AHOA 2FK6A 4EYBA 2YNVA 2BFZB 2BIBA 4EY2A 3X2YA 2Q0IA 1YCFA 5ACRA 4FEKA 5LSCA 4TZEA 2QINA 4TZ9A 1QH3A
chains in the Genus database with same CATH topology
3BV6A 5LM6A 4EXSA 5K4KA 3WXCA 5ACSA 4GYQA 2YNUA 4EYFA 3IE1A 4AWZA 5LLDA 4XWWA 3I11A 2ZO4A 4Z6XA 3L6NA 2OHIA 5FQAA 4UBQA 2BTNA 3A4YA 4TYTA 3AF5A 2WRSA 5HH6A 4F6ZA 2BG7A 3DHAA 4TYFA 2NZFA 1KR3A 2OHHA 1WRAA 2HB9A 2FU8A 1JJTA 2YNWA 4RAWA 3SD9A 4HL2A 4H0DA 2WYMA 2P1EA 3MD7A 4YSLA 2P97A 5EHTA 3KNSA 4YSBA 3DH8A 4RBSA 5HH5A 4C1EA 2UYXA 5ACXA 4UWSB 3SBLA 1X8IA 2BR6A 4J5FA 4AX1B 4J5HA 2YNTB 4D1VA 3IE0A 3RPCA 3H3EA 5LCFA 3IELA 3ESHA 4RL0A 2QJSA 3ZR9A 5K4MA 3I13A 4D1WA 5K4NA 1VJNA 2FM6A 4Z67A 1XM8A 4TZBA 4O98A 4YSKA 1WUPA 4UA4A 2FHXB 3FAIA 3LVZA 2YCBA 2YNVB 1VMEA 5KILA 4XUKA 1JT1A 3FCZA 3ADRA 2H6AA 2NZEA 5LE1A 4GYUA 2BG2A 1HLKA 2ZNBA 2BC2A 4XWTA 2M5CA 2BG6A 2NXAA 2BFLA 2GKLA 2I7TA 5HH4A 5HISA 2VW8A 2R2DA 5LCAA 2Q42A 2ZZIA 1VGNA 2ZWRA 1X8GA 1DXKA 2P4ZA 4C09A 3KNRA 4BZ3A 5AYAA 3PY6A 2GCUA 1YCGA 4AWYB 3I14A 3X2XA 2FU6A 2QEDA 3KL7A 1ZKPA 5ACQA 3IEMA 2WYLA 4KEPA 2Q0JA 4GCWA 4KEQA 1P9EA 4UWRB 3VQZA 2QDSA 3F9OA 5A87A 3IDZA 5LMCA 2OHJA 5EVBA 3PG4A 5AHRA 1MQOA 2AIOA 2Y87A 3Q6VA 4B87A 1BMCA 5EV8A 1ZTCA 5KIKA 4DIKA 2GMNA 3SW3A 4Z7RA 2DOOA 1KO2A 3IEKA 5AXOA 3SRXA 3I15A 4PVTA 2XR1A 4WD6A 4FSBA 4ZNBA 3T9MA 5HIOA 2BG8A 5FQBA 1E5DA 3BC2A 5ACWA 4C1FA 5A0VA 5K0WA 4D1TA 3SFPA 4UWPB 4BP0A 2YNTA 3ZWFA 3TP9A 1BC2A 3IE2A 4NQ4A 4NQ6A 2AZ4A 5ACTA 1ZNBA 5B15A 4LE6A 2FU9A 5HIQA 4FR7A 4C1CA 2Q9UA 3JXPA 2NYPA 3T3OA 4NQ5A 2GFKA 2Y8BA 1DD6A 5B3RA 2FHXA 3X2ZA 3DHBA 4ZEJA 5EVDA 4HKYA 2BFKA 2YZ3A 4UAMA 5HIPA 3P2UA 4ZO3A 2BFZA 1WUOA 4U4LA 4HL1A 3AJ3A 1Y44A 4EYLA 4C1DA 4JO0A 4DILA 4D02A 3X30A 2QDTA 4AX0B 5EW0A 4V0HA 5ACVA 4Z5ZA 5AEBA 4EFZA 4Z60A 5DPXA 1BVTA 2P18A 3RKKA 3PY5A 2E7YA 1DDKA 3AF6A 2A7MA 3R2UA 3I0VA 4TZFA 5LS3A 1QH5A 4C1GA 4AD9A 5ACPA 1K07A 2XF4A 4UWOB 4RAMA 5AXRA 5EH9A 4RL2A 5A0TA 1KO3A 4Z5YA 3VPEA 3BK1A 3G1PA 4ZO2A 3SPUA 1XTOA 5IQKA 5EWAA 3DHCA 2M5DA 2BG8B 3ZQ4A 3ZNBA 4D1UA 3QH8A 3IOGA 2WYMC 4P62A 2DKFA 2I7VA 5ACUA 1L9YA 5EV6A 2I7XA 2FU7A 3S0ZA 4NQ2A 1A8TA 3IOFA 1A7TA 1WW1A 4CHLA 5LCHA 2BMIA 5FQCA 2BGAA 2GFJA 4EXYA 4RM5A 5B1UA 4C1HA 2WHGA 4PVOA 2CBNA 3RKJA 3BK2A 1JJEA 5EVKA 2Y8AA 3T3NA 4F6HA 5A5ZA 1YCHA 1M2XA 1SMLA 1X8HA 5AHOA 2FK6A 4EYBA 2YNVA 4EY2A 2BFZB 2BIBA 3X2YA 2Q0IA 1YCFA 5ACRA 4FEKA 5LSCA 4TZEA 2QINA 4TZ9A 1QH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BV6 A;  5LM6 A;  4EXS A;  5K4K A;  3WXC A;  5ACS A;  4GYQ A;  2YNU A;  4EYF A;  3IE1 A;  4AWZ A;  5LLD A;  4XWW A;  3I11 A;  2ZO4 A;  4Z6X A;  3L6N A;  2OHI A;  5FQA A;  4UBQ A;  2BTN A;  3A4Y A;  4TYT A;  3AF5 A;  2WRS A;  5HH6 A;  4F6Z A;  2BG7 A;  3DHA A;  4TYF A;  2NZF A;  1KR3 A;  2OHH A;  1WRA A;  2HB9 A;  2FU8 A;  1JJT A;  2YNW A;  4RAW A;  3SD9 A;  4HL2 A;  4H0D A;  2WYM A;  2P1E A;  3MD7 A;  4YSL A;  2P97 A;  5EHT A;  3KNS A;  4YSB A;  3DH8 A;  4RBS A;  5HH5 A;  4C1E A;  2UYX A;  5ACX A;  4UWS B;  3SBL A;  1X8I A;  2BR6 A;  4J5F A;  4AX1 B;  4J5H A;  2YNT B;  4D1V A;  3IE0 A;  3RPC A;  3H3E A;  5LCF A;  3IEL A;  3ESH A;  4RL0 A;  2QJS A;  3ZR9 A;  5K4M A;  3I13 A;  4D1W A;  5K4N A;  1VJN A;  2FM6 A;  4Z67 A;  1XM8 A;  4TZB A;  4O98 A;  4YSK A;  1WUP A;  4UA4 A;  2FHX B;  3FAI A;  3LVZ A;  2YCB A;  2YNV B;  1VME A;  5KIL A;  4XUK A;  1JT1 A;  3FCZ A;  3ADR A;  2H6A A;  2NZE A;  5LE1 A;  4GYU A;  2BG2 A;  1HLK A;  2ZNB A;  2BC2 A;  4XWT A;  2M5C A;  2BG6 A;  2NXA A;  2BFL A;  2GKL A;  2I7T A;  5HH4 A;  5HIS A;  2VW8 A;  2R2D A;  5LCA A;  2Q42 A;  2ZZI A;  1VGN A;  2ZWR A;  1X8G A;  1DXK A;  2P4Z A;  4C09 A;  3KNR A;  4BZ3 A;  5AYA A;  3PY6 A;  2GCU A;  1YCG A;  4AWY B;  3I14 A;  3X2X A;  2FU6 A;  2QED A;  3KL7 A;  1ZKP A;  5ACQ A;  3IEM A;  2WYL A;  4KEP A;  2Q0J A;  4GCW A;  4KEQ A;  1P9E A;  4UWR B;  3VQZ A;  2QDS A;  3F9O A;  5A87 A;  3IDZ A;  5LMC A;  2OHJ A;  5EVB A;  3PG4 A;  5AHR A;  1MQO A;  2AIO A;  2Y87 A;  3Q6V A;  4B87 A;  1BMC A;  5EV8 A;  1ZTC A;  5KIK A;  4DIK A;  2GMN A;  3SW3 A;  4Z7R A;  2DOO A;  1KO2 A;  3IEK A;  5AXO A;  3SRX A;  3I15 A;  4PVT A;  2XR1 A;  4WD6 A;  4FSB A;  4ZNB A;  3T9M A;  5HIO A;  2BG8 A;  5FQB A;  1E5D A;  3BC2 A;  5ACW A;  4C1F A;  5A0V A;  5K0W A;  4D1T A;  3SFP A;  4UWP B;  4BP0 A;  2YNT A;  3ZWF A;  3TP9 A;  1BC2 A;  3IE2 A;  4NQ4 A;  4NQ6 A;  2AZ4 A;  5ACT A;  1ZNB A;  5B15 A;  4LE6 A;  2FU9 A;  5HIQ A;  4FR7 A;  4C1C A;  2Q9U A;  3JXP A;  2NYP A;  3T3O A;  4NQ5 A;  2GFK A;  2Y8B A;  1DD6 A;  5B3R A;  2FHX A;  3X2Z A;  3DHB A;  4ZEJ A;  5EVD A;  4HKY A;  2BFK A;  2YZ3 A;  4UAM A;  5HIP A;  3P2U A;  4ZO3 A;  2BFZ A;  1WUO A;  4U4L A;  4HL1 A;  3AJ3 A;  1Y44 A;  4EYL A;  4C1D A;  4JO0 A;  4DIL A;  4D02 A;  3X30 A;  2QDT A;  4AX0 B;  5EW0 A;  4V0H A;  5ACV A;  4Z5Z A;  5AEB A;  4EFZ A;  4Z60 A;  5DPX A;  1BVT A;  2P18 A;  3RKK A;  3PY5 A;  2E7Y A;  1DDK A;  3AF6 A;  2A7M A;  3R2U A;  3I0V A;  4TZF A;  5LS3 A;  1QH5 A;  4C1G A;  4AD9 A;  5ACP A;  1K07 A;  2XF4 A;  4UWO B;  4RAM A;  5AXR A;  5EH9 A;  4RL2 A;  5A0T A;  1KO3 A;  4Z5Y A;  3VPE A;  3BK1 A;  3G1P A;  4ZO2 A;  3SPU A;  1XTO A;  5IQK A;  5EWA A;  3DHC A;  2M5D A;  2BG8 B;  3ZQ4 A;  3ZNB A;  4D1U A;  3QH8 A;  3IOG A;  2WYM C;  4P62 A;  2DKF A;  2I7V A;  5ACU A;  1L9Y A;  5EV6 A;  2I7X A;  2FU7 A;  3S0Z A;  4NQ2 A;  1A8T A;  3IOF A;  1A7T A;  1WW1 A;  4CHL A;  5LCH A;  2BMI A;  5FQC A;  2BGA A;  2GFJ A;  4EXY A;  4RM5 A;  5B1U A;  4C1H A;  2WHG A;  4PVO A;  2CBN A;  3RKJ A;  3BK2 A;  1JJE A;  5EVK A;  2Y8A A;  3T3N A;  4F6H A;  5A5Z A;  1YCH A;  1M2X A;  1SML A;  1X8H A;  5AHO A;  2FK6 A;  4EYB A;  2YNV A;  4EY2 A;  2BFZ B;  2BIB A;  3X2Y A;  2Q0I A;  1YCF A;  5ACR A;  4FEK A;  5LSC A;  4TZE A;  2QIN A;  4TZ9 A;  1QH3 A; 
#chains in the Genus database with same CATH topology
 3BV6 A;  5LM6 A;  4EXS A;  5K4K A;  3WXC A;  5ACS A;  4GYQ A;  2YNU A;  4EYF A;  3IE1 A;  4AWZ A;  5LLD A;  4XWW A;  3I11 A;  2ZO4 A;  4Z6X A;  3L6N A;  2OHI A;  5FQA A;  4UBQ A;  2BTN A;  3A4Y A;  4TYT A;  3AF5 A;  2WRS A;  5HH6 A;  4F6Z A;  2BG7 A;  3DHA A;  4TYF A;  2NZF A;  1KR3 A;  2OHH A;  1WRA A;  2HB9 A;  2FU8 A;  1JJT A;  2YNW A;  4RAW A;  3SD9 A;  4HL2 A;  4H0D A;  2WYM A;  2P1E A;  3MD7 A;  4YSL A;  2P97 A;  5EHT A;  3KNS A;  4YSB A;  3DH8 A;  4RBS A;  5HH5 A;  4C1E A;  2UYX A;  5ACX A;  4UWS B;  3SBL A;  1X8I A;  2BR6 A;  4J5F A;  4AX1 B;  4J5H A;  2YNT B;  4D1V A;  3IE0 A;  3RPC A;  3H3E A;  5LCF A;  3IEL A;  3ESH A;  4RL0 A;  2QJS A;  3ZR9 A;  5K4M A;  3I13 A;  4D1W A;  5K4N A;  1VJN A;  2FM6 A;  4Z67 A;  1XM8 A;  5AJL A;  2CG3 A;  4TZB A;  4O98 A;  4YSK A;  1WUP A;  4UA4 A;  2FHX B;  3FAI A;  3LVZ A;  2YCB A;  2YNV B;  1VME A;  5KIL A;  4XUK A;  1JT1 A;  3FCZ A;  3ADR A;  2H6A A;  2NZE A;  5LE1 A;  4GYU A;  2BG2 A;  1HLK A;  2ZNB A;  2BC2 A;  4XWT A;  2M5C A;  2BG6 A;  2NXA A;  2BFL A;  2GKL A;  2I7T A;  4AV7 A;  5HH4 A;  5HIS A;  2VW8 A;  2R2D A;  5LCA A;  2Q42 A;  2ZZI A;  1VGN A;  2ZWR A;  1X8G A;  1DXK A;  2P4Z A;  4C09 A;  3KNR A;  4BZ3 A;  5AYA A;  3PY6 A;  2GCU A;  1YCG A;  4AWY B;  3I14 A;  3X2X A;  2FU6 A;  2QED A;  3KL7 A;  1ZKP A;  5ACQ A;  3IEM A;  2WYL A;  4KEP A;  2Q0J A;  4GCW A;  4KEQ A;  1P9E A;  4UWR B;  3VQZ A;  2QDS A;  3F9O A;  5A87 A;  3IDZ A;  5LMC A;  2OHJ A;  5EVB A;  3PG4 A;  5AHR A;  1MQO A;  2CFZ A;  2AIO A;  2Y87 A;  3Q6V A;  4B87 A;  1BMC A;  5EV8 A;  1ZTC A;  5KIK A;  4DIK A;  2GMN A;  3SW3 A;  4Z7R A;  2DOO A;  1KO2 A;  3IEK A;  5AXO A;  3SRX A;  3I15 A;  4PVT A;  2XR1 A;  4WD6 A;  4FSB A;  4ZNB A;  4NUR A;  3T9M A;  5HIO A;  2BG8 A;  5FQB A;  1E5D A;  3BC2 A;  5ACW A;  4C1F A;  5A0V A;  5K0W A;  4D1T A;  4AXH A;  3SFP A;  4UWP B;  4BP0 A;  2YNT A;  3ZWF A;  3TP9 A;  1BC2 A;  2YHE A;  3IE2 A;  4NQ4 A;  4NQ6 A;  2AZ4 A;  5ACT A;  1ZNB A;  5B15 A;  4LE6 A;  2FU9 A;  5HIQ A;  4FR7 A;  4C1C A;  2Q9U A;  3JXP A;  2NYP A;  3T3O A;  4NQ5 A;  2GFK A;  2Y8B A;  1DD6 A;  5B3R A;  2FHX A;  3X2Z A;  3DHB A;  4ZEJ A;  5EVD A;  4HKY A;  2BFK A;  2YZ3 A;  4UAM A;  5HIP A;  3P2U A;  4ZO3 A;  2BFZ A;  1WUO A;  4U4L A;  4HL1 A;  3AJ3 A;  1Y44 A;  4EYL A;  4C1D A;  4JO0 A;  4DIL A;  4D02 A;  3X30 A;  2QDT A;  4AX0 B;  5EW0 A;  4V0H A;  5ACV A;  4Z5Z A;  5AEB A;  4EFZ A;  4Z60 A;  5DPX A;  1BVT A;  2P18 A;  3RKK A;  3PY5 A;  2E7Y A;  1DDK A;  3AF6 A;  2A7M A;  3R2U A;  4PDX A;  3I0V A;  4TZF A;  5LS3 A;  1QH5 A;  4C1G A;  4AD9 A;  5ACP A;  1K07 A;  2XF4 A;  4UWO B;  4RAM A;  5AXR A;  2CG2 A;  5EH9 A;  4RL2 A;  5A0T A;  5AIJ A;  1KO3 A;  4Z5Y A;  3VPE A;  3BK1 A;  3G1P A;  4ZO2 A;  3SPU A;  1XTO A;  5IQK A;  5EWA A;  3DHC A;  2M5D A;  2BG8 B;  3ZQ4 A;  3ZNB A;  4D1U A;  3QH8 A;  3IOG A;  2WYM C;  4P62 A;  2DKF A;  2I7V A;  5ACU A;  1L9Y A;  5EV6 A;  2I7X A;  2FU7 A;  3S0Z A;  4NQ2 A;  1A8T A;  3IOF A;  1A7T A;  1WW1 A;  4CHL A;  5LCH A;  2BMI A;  5FQC A;  2BGA A;  2GFJ A;  4EXY A;  4RM5 A;  5B1U A;  4C1H A;  2WHG A;  4PVO A;  2CBN A;  3RKJ A;  3BK2 A;  1JJE A;  5EVK A;  2CFU A;  5A23 A;  2Y8A A;  3T3N A;  4F6H A;  5A5Z A;  1YCH A;  1M2X A;  1SML A;  1X8H A;  5AHO A;  2FK6 A;  4EYB A;  2YNV A;  2BFZ B;  2BIB A;  4EY2 A;  3X2Y A;  2Q0I A;  1YCF A;  5ACR A;  4FEK A;  5LSC A;  4TZE A;  2QIN A;  4TZ9 A;  1QH3 A; 
#chains in the Genus database with same CATH homology
 3BV6 A;  5LM6 A;  4EXS A;  5K4K A;  3WXC A;  5ACS A;  4GYQ A;  2YNU A;  4EYF A;  3IE1 A;  4AWZ A;  5LLD A;  4XWW A;  3I11 A;  2ZO4 A;  4Z6X A;  3L6N A;  2OHI A;  5FQA A;  4UBQ A;  2BTN A;  3A4Y A;  4TYT A;  3AF5 A;  2WRS A;  5HH6 A;  4F6Z A;  2BG7 A;  3DHA A;  4TYF A;  2NZF A;  1KR3 A;  2OHH A;  1WRA A;  2HB9 A;  2FU8 A;  1JJT A;  2YNW A;  4RAW A;  3SD9 A;  4HL2 A;  4H0D A;  2WYM A;  2P1E A;  3MD7 A;  4YSL A;  2P97 A;  5EHT A;  3KNS A;  4YSB A;  3DH8 A;  4RBS A;  5HH5 A;  4C1E A;  2UYX A;  5ACX A;  4UWS B;  3SBL A;  1X8I A;  2BR6 A;  4J5F A;  4AX1 B;  4J5H A;  2YNT B;  4D1V A;  3IE0 A;  3RPC A;  3H3E A;  5LCF A;  3IEL A;  3ESH A;  4RL0 A;  2QJS A;  3ZR9 A;  5K4M A;  3I13 A;  4D1W A;  5K4N A;  1VJN A;  2FM6 A;  4Z67 A;  1XM8 A;  4TZB A;  4O98 A;  4YSK A;  1WUP A;  4UA4 A;  2FHX B;  3FAI A;  3LVZ A;  2YCB A;  2YNV B;  1VME A;  5KIL A;  4XUK A;  1JT1 A;  3FCZ A;  3ADR A;  2H6A A;  2NZE A;  5LE1 A;  4GYU A;  2BG2 A;  1HLK A;  2ZNB A;  2BC2 A;  4XWT A;  2M5C A;  2BG6 A;  2NXA A;  2BFL A;  2GKL A;  2I7T A;  5HH4 A;  5HIS A;  2VW8 A;  2R2D A;  5LCA A;  2Q42 A;  2ZZI A;  1VGN A;  2ZWR A;  1X8G A;  1DXK A;  2P4Z A;  4C09 A;  3KNR A;  4BZ3 A;  5AYA A;  3PY6 A;  2GCU A;  1YCG A;  4AWY B;  3I14 A;  3X2X A;  2FU6 A;  2QED A;  3KL7 A;  1ZKP A;  5ACQ A;  3IEM A;  2WYL A;  4KEP A;  2Q0J A;  4GCW A;  4KEQ A;  1P9E A;  4UWR B;  3VQZ A;  2QDS A;  3F9O A;  5A87 A;  3IDZ A;  5LMC A;  2OHJ A;  5EVB A;  3PG4 A;  5AHR A;  1MQO A;  2AIO A;  2Y87 A;  3Q6V A;  4B87 A;  1BMC A;  5EV8 A;  1ZTC A;  5KIK A;  4DIK A;  2GMN A;  3SW3 A;  4Z7R A;  2DOO A;  1KO2 A;  3IEK A;  5AXO A;  3SRX A;  3I15 A;  4PVT A;  2XR1 A;  4WD6 A;  4FSB A;  4ZNB A;  3T9M A;  5HIO A;  2BG8 A;  5FQB A;  1E5D A;  3BC2 A;  5ACW A;  4C1F A;  5A0V A;  5K0W A;  4D1T A;  3SFP A;  4UWP B;  4BP0 A;  2YNT A;  3ZWF A;  3TP9 A;  1BC2 A;  3IE2 A;  4NQ4 A;  4NQ6 A;  2AZ4 A;  5ACT A;  1ZNB A;  5B15 A;  4LE6 A;  2FU9 A;  5HIQ A;  4FR7 A;  4C1C A;  2Q9U A;  3JXP A;  2NYP A;  3T3O A;  4NQ5 A;  2GFK A;  2Y8B A;  1DD6 A;  5B3R A;  2FHX A;  3X2Z A;  3DHB A;  4ZEJ A;  5EVD A;  4HKY A;  2BFK A;  2YZ3 A;  4UAM A;  5HIP A;  3P2U A;  4ZO3 A;  2BFZ A;  1WUO A;  4U4L A;  4HL1 A;  3AJ3 A;  1Y44 A;  4EYL A;  4C1D A;  4JO0 A;  4DIL A;  4D02 A;  3X30 A;  2QDT A;  4AX0 B;  5EW0 A;  4V0H A;  5ACV A;  4Z5Z A;  5AEB A;  4EFZ A;  4Z60 A;  5DPX A;  1BVT A;  2P18 A;  3RKK A;  3PY5 A;  2E7Y A;  1DDK A;  3AF6 A;  2A7M A;  3R2U A;  3I0V A;  4TZF A;  5LS3 A;  1QH5 A;  4C1G A;  4AD9 A;  5ACP A;  1K07 A;  2XF4 A;  4UWO B;  4RAM A;  5AXR A;  5EH9 A;  4RL2 A;  5A0T A;  1KO3 A;  4Z5Y A;  3VPE A;  3BK1 A;  3G1P A;  4ZO2 A;  3SPU A;  1XTO A;  5IQK A;  5EWA A;  3DHC A;  2M5D A;  2BG8 B;  3ZQ4 A;  3ZNB A;  4D1U A;  3QH8 A;  3IOG A;  2WYM C;  4P62 A;  2DKF A;  2I7V A;  5ACU A;  1L9Y A;  5EV6 A;  2I7X A;  2FU7 A;  3S0Z A;  4NQ2 A;  1A8T A;  3IOF A;  1A7T A;  1WW1 A;  4CHL A;  5LCH A;  2BMI A;  5FQC A;  2BGA A;  2GFJ A;  4EXY A;  4RM5 A;  5B1U A;  4C1H A;  2WHG A;  4PVO A;  2CBN A;  3RKJ A;  3BK2 A;  1JJE A;  5EVK A;  2Y8A A;  3T3N A;  4F6H A;  5A5Z A;  1YCH A;  1M2X A;  1SML A;  1X8H A;  5AHO A;  2FK6 A;  4EYB A;  2YNV A;  4EY2 A;  2BFZ B;  2BIB A;  3X2Y A;  2Q0I A;  1YCF A;  5ACR A;  4FEK A;  5LSC A;  4TZE A;  2QIN A;  4TZ9 A;  1QH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...