4AWZA

Crystal structure of the mobile metallo-beta-lactamase aim-1 from pseudomonas aeruginosa: insights into antibiotic binding and the role of gln157
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
269
structure length
269
Chain Sequence
ASRGCADDAGWNDPAMPLKVYGNTWYVGTCGISALLVTSDAGHILVDAATPQAGPQILANIRALGFRPEDVRAIVFSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLPDRTDPQFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRSCEGDDCRQMVYADSLTAISDDVFRYSDDAAHPGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRIGPRAAAPLMDTTACRRYAQGARQRLEKRLAEEAAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Mobile Metallo-Beta-Lactamase Aim-1 from Pseudomonas Aeruginosa: Insights Into Antibiotic Binding and the Role of Gln157.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords METALLO-BETA-LACTAMASE AIM-1
total genus 90
structure length 269
sequence length 269
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4awzA00
5A0TA 3SFPA 1DXKA 5K4NA 4F6ZA 3T9MA 1YCGA 4Z5YA 1JT1A 1MQOA 3ZQ4A 2Q42A 1VJNA 4XUKA 4GCWA 5ACQA 3KNSA 4FR7A 3VQZA 2GFJA 3ZWFA 5LCAA 4D1VA 1XM8A 4LE6A 3BK2A 1VMEA 3P2UA 5EH9A 4TYFA 1WW1A 2BC2A 2Y8AA 3IE1A 4V0HA 3VPEA 5HIQA 5FQAA 2GKLA 3RPCA 4C1HA 5AXOA 2GFKA 2UYXA 2NYPA 5ACXA 4YSBA 4AWYB 3LVZA 2YZ3A 4UAMA 4ZEJA 5EW0A 3JXPA 5EVBA 5HIOA 4RBSA 5HH6A 4ZO2A 3I15A 1X8GA 4FSBA 5KIKA 3G1PA 4AD9A 5LCHA 2VW8A 4YSLA 2BG8B 1KR3A 4FEKA 4RL2A 2YNVB 2QJSA 2WRSA 2FK6A 2YNUA 3AF5A 2WHGA 4PVTA 5HH4A 4C1GA 3TP9A 3IE2A 2ZWRA 5AXRA 2ZNBA 3I13A 2DKFA 1BVTA 3IE0A 3SPUA 2YNVA 4H0DA 2I7VA 2BFLA 2Q0JA 4DIKA 2FHXB 3FAIA 3I0VA 5A87A 3IEMA 3KL7A 5B1UA 5FQBA 4GYUA 3SD9A 3IEKA 4CHLA 5EVDA 4RAMA 1BC2A 4NQ2A 1DDKA 2AIOA 4C09A 1KO2A 1Y44A 5AYAA 4B87A 5AHOA 3BC2A 2QDTA 5A5ZA 2WYMA 1X8HA 2WYLA 5LM6A 4TYTA 2BG7A 4PVOA 3RKKA 1YCFA 3DHAA 2YNTA 3MD7A 4F6HA 5FQCA 1XTOA 4Z60A 1L9YA 4JO0A 2BG6A 2R2DA 4AWZA 2M5CA 4TZBA 4ZNBA 4HKYA 1K07A 5K4KA 4O98A 1DD6A 3SBLA 2BG8A 3DH8A 5AHRA 2BFZB 4UWRB 5LS3A 4GYQA 4DILA 5A0VA 4HL1A 1HLKA 5K4MA 2XR1A 5LE1A 2ZO4A 5B3RA 4UWOB 5LSCA 3F9OA 1WUOA 2Y87A 2H6AA 5K0WA 3AF6A 5DPXA 4D02A 5ACVA 2P4ZA 4BZ3A 3L6NA 1JJEA 1QH5A 3AJ3A 3DHCA 5LCFA 3X2XA 4D1TA 5IQKA 1YCHA 4XWTA 5ACUA 4Z67A 2GCUA 3PY6A 3KNRA 3X2ZA 4KEQA 4EXYA 4C1EA 2XF4A 3WXCA 3SRXA 1JJTA 2I7TA 4TZEA 2BG2A 2P97A 1P9EA 5HH5A 5LMCA 2I7XA 4WD6A 2FU9A 4UWSB 3X30A 2BFZA 4NQ6A 4P62A 4TZ9A 4D1WA 2P18A 5ACSA 2M5DA 3ADRA 4Z5ZA 4Z6XA 2HB9A 4BP0A 2A7MA 2Y8BA 4UWPB 3IDZA 2QINA 1ZNBA 5ACTA 4J5FA 1ZKPA 2YNTB 1KO3A 5B15A 4C1FA 4TZFA 4D1UA 2GMNA 5LLDA 4UA4A 3H3EA 4HL2A 4RL0A 3BV6A 2FU8A 3BK1A 1A7TA 1VGNA 2QDSA 4KEPA 3A4YA 3IOFA 4EFZA 2NZFA 3I14A 2FU6A 3PY5A 5AEBA 1A8TA 1E5DA 5HIPA 2BTNA 5ACWA 5HISA 3Q6VA 4AX1B 3QH8A 2OHIA 3I11A 4RM5A 3PG4A 2QEDA 5KILA 4NQ5A 4C1CA 4EXSA 4J5HA 4U4LA 1BMCA 4YSKA 5EV6A 2OHJA 2YCBA 2Q0IA 5EWAA 1M2XA 3ZR9A 2P1EA 4EY2A 4AX0B 5EV8A 1QH3A 2AZ4A 2E7YA 1SMLA 2BGAA 3ZNBA 3RKJA 2BIBA 2FHXA 3SW3A 2FU7A 5EVKA 4EYFA 3R2UA 3ESHA 2Q9UA 1WRAA 2OHHA 2YNWA 2ZZIA 3T3OA 5EHTA 4RAWA 2BFKA 2CBNA 2FM6A 3FCZA 5ACPA 2BMIA 4EYBA 2DOOA 1WUPA 2NXAA 5ACRA 4NQ4A 2BR6A 2NZEA 1X8IA 3IOGA 3DHBA 4XWWA 2WYMC 3S0ZA 3T3NA 4C1DA 1ZTCA 3X2YA 4Z7RA 4ZO3A 4EYLA 4UBQA 3IELA
chains in the Genus database with same CATH superfamily
5A0TA 3SFPA 1DXKA 5K4NA 4F6ZA 3T9MA 1YCGA 4Z5YA 2CG3A 1JT1A 1MQOA 3ZQ4A 2Q42A 1VJNA 4XUKA 4GCWA 4NURA 5ACQA 3KNSA 4FR7A 3VQZA 2GFJA 3ZWFA 5LCAA 4D1VA 1XM8A 4LE6A 3BK2A 1VMEA 3P2UA 5EH9A 4TYFA 1WW1A 2BC2A 4AXHA 2Y8AA 3IE1A 4V0HA 3VPEA 5HIQA 5FQAA 2GKLA 3RPCA 4C1HA 5AXOA 2GFKA 2UYXA 2NYPA 5ACXA 4YSBA 4AWYB 3LVZA 2YZ3A 4UAMA 4ZEJA 5EW0A 3JXPA 5EVBA 5HIOA 4RBSA 5HH6A 4ZO2A 3I15A 1X8GA 4FSBA 3G1PA 5KIKA 4AD9A 2VW8A 5LCHA 4YSLA 2BG8B 1KR3A 4FEKA 4RL2A 2YNVB 2QJSA 2WRSA 2FK6A 2YNUA 3AF5A 2WHGA 4PVTA 5HH4A 4C1GA 3TP9A 3IE2A 2ZWRA 5AXRA 2ZNBA 3I13A 2DKFA 1BVTA 3IE0A 3SPUA 2YNVA 4H0DA 2I7VA 2BFLA 2Q0JA 4DIKA 2FHXB 3FAIA 3I0VA 5A87A 3IEMA 3KL7A 5B1UA 5FQBA 4GYUA 3SD9A 3IEKA 4CHLA 5EVDA 4RAMA 1BC2A 2CG2A 4NQ2A 1DDKA 2AIOA 4C09A 1KO2A 1Y44A 5AYAA 4B87A 5AHOA 3BC2A 2QDTA 5A5ZA 2WYMA 1X8HA 2WYLA 5LM6A 4TYTA 2BG7A 4PVOA 3RKKA 1YCFA 3DHAA 2YNTA 3MD7A 4F6HA 5FQCA 1XTOA 4Z60A 1L9YA 4JO0A 2BG6A 2R2DA 4AWZA 2M5CA 4TZBA 4ZNBA 4HKYA 1K07A 5K4KA 4O98A 1DD6A 3SBLA 2BG8A 3DH8A 5AHRA 2BFZB 4UWRB 5LS3A 4GYQA 4DILA 5A0VA 4HL1A 1HLKA 5K4MA 2XR1A 2ZO4A 5LE1A 5B3RA 4UWOB 5LSCA 3F9OA 1WUOA 2Y87A 2H6AA 4PDXA 5K0WA 3AF6A 5DPXA 4D02A 5ACVA 2P4ZA 4BZ3A 3L6NA 1JJEA 1QH5A 3AJ3A 3DHCA 5LCFA 5AIJA 3X2XA 4D1TA 5IQKA 5A23A 1YCHA 4XWTA 5ACUA 4Z67A 2GCUA 3PY6A 3KNRA 3X2ZA 4KEQA 4EXYA 4C1EA 2XF4A 3WXCA 3SRXA 1JJTA 2I7TA 4TZEA 2BG2A 2P97A 1P9EA 5HH5A 5LMCA 2I7XA 4WD6A 2FU9A 4UWSB 2CFZA 3X30A 2BFZA 4NQ6A 4P62A 4TZ9A 4D1WA 2P18A 5ACSA 2M5DA 3ADRA 4Z5ZA 2YHEA 4Z6XA 2HB9A 4BP0A 2A7MA 2Y8BA 4UWPB 3IDZA 2QINA 1ZNBA 5ACTA 4J5FA 1ZKPA 2YNTB 1KO3A 5B15A 4C1FA 4TZFA 4D1UA 2GMNA 5LLDA 4AV7A 4UA4A 3H3EA 4HL2A 4RL0A 3BV6A 2FU8A 3BK1A 1A7TA 1VGNA 2QDSA 4KEPA 3A4YA 5AJLA 3IOFA 4EFZA 2NZFA 3I14A 2FU6A 3PY5A 5AEBA 1A8TA 1E5DA 5HIPA 2BTNA 5ACWA 5HISA 3Q6VA 4AX1B 3QH8A 2OHIA 3I11A 4RM5A 3PG4A 2QEDA 5KILA 4NQ5A 4C1CA 4EXSA 4J5HA 4U4LA 1BMCA 4YSKA 5EV6A 2OHJA 2YCBA 2Q0IA 5EWAA 1M2XA 3ZR9A 2P1EA 4EY2A 4AX0B 5EV8A 1QH3A 2AZ4A 2E7YA 1SMLA 2BGAA 3ZNBA 3RKJA 2BIBA 2FHXA 3SW3A 2FU7A 5EVKA 4EYFA 3R2UA 3ESHA 2CFUA 2Q9UA 1WRAA 2OHHA 2YNWA 2ZZIA 3T3OA 5EHTA 4RAWA 2BFKA 2CBNA 2FM6A 3FCZA 5ACPA 2BMIA 4EYBA 2DOOA 1WUPA 2NXAA 5ACRA 4NQ4A 2BR6A 2NZEA 1X8IA 3IOGA 3DHBA 4XWWA 2WYMC 3S0ZA 3T3NA 4C1DA 1ZTCA 3X2YA 4Z7RA 4ZO3A 4EYLA 4UBQA 3IELA
chains in the Genus database with same CATH topology
5A0TA 3SFPA 1DXKA 5K4NA 4F6ZA 3T9MA 1YCGA 4Z5YA 1JT1A 1MQOA 3ZQ4A 2Q42A 1VJNA 4XUKA 4GCWA 5ACQA 3KNSA 4FR7A 3VQZA 2GFJA 3ZWFA 5LCAA 4D1VA 1XM8A 4LE6A 3BK2A 1VMEA 3P2UA 5EH9A 4TYFA 1WW1A 2BC2A 2Y8AA 3IE1A 4V0HA 3VPEA 5HIQA 5FQAA 2GKLA 3RPCA 4C1HA 5AXOA 2GFKA 2UYXA 2NYPA 5ACXA 4YSBA 4AWYB 3LVZA 2YZ3A 4UAMA 4ZEJA 5EW0A 3JXPA 5EVBA 5HIOA 4RBSA 5HH6A 4ZO2A 3I15A 1X8GA 4FSBA 5KIKA 3G1PA 4AD9A 5LCHA 2VW8A 4YSLA 2BG8B 1KR3A 4FEKA 4RL2A 2YNVB 2QJSA 2WRSA 2FK6A 2YNUA 3AF5A 2WHGA 4PVTA 5HH4A 4C1GA 3TP9A 3IE2A 2ZWRA 5AXRA 2ZNBA 3I13A 2DKFA 1BVTA 3IE0A 3SPUA 2YNVA 4H0DA 2I7VA 2BFLA 2Q0JA 4DIKA 2FHXB 3FAIA 3I0VA 5A87A 3IEMA 3KL7A 5B1UA 5FQBA 4GYUA 3SD9A 3IEKA 4CHLA 5EVDA 4RAMA 1BC2A 4NQ2A 1DDKA 2AIOA 4C09A 1KO2A 1Y44A 5AYAA 4B87A 5AHOA 3BC2A 2QDTA 5A5ZA 2WYMA 1X8HA 2WYLA 5LM6A 4TYTA 2BG7A 4PVOA 3RKKA 1YCFA 3DHAA 2YNTA 3MD7A 4F6HA 5FQCA 1XTOA 4Z60A 1L9YA 4JO0A 2BG6A 2R2DA 4AWZA 2M5CA 4TZBA 4ZNBA 4HKYA 1K07A 5K4KA 4O98A 1DD6A 3SBLA 2BG8A 3DH8A 5AHRA 2BFZB 4UWRB 5LS3A 4GYQA 4DILA 5A0VA 4HL1A 1HLKA 5K4MA 2XR1A 5LE1A 2ZO4A 5B3RA 4UWOB 5LSCA 3F9OA 1WUOA 2Y87A 2H6AA 5K0WA 3AF6A 5DPXA 4D02A 5ACVA 2P4ZA 4BZ3A 3L6NA 1JJEA 1QH5A 3AJ3A 3DHCA 5LCFA 3X2XA 4D1TA 5IQKA 1YCHA 4XWTA 5ACUA 4Z67A 2GCUA 3PY6A 3KNRA 3X2ZA 4KEQA 4EXYA 4C1EA 2XF4A 3WXCA 3SRXA 1JJTA 2I7TA 4TZEA 2BG2A 2P97A 1P9EA 5HH5A 5LMCA 2I7XA 4WD6A 2FU9A 4UWSB 3X30A 2BFZA 4NQ6A 4P62A 4TZ9A 4D1WA 2P18A 5ACSA 2M5DA 3ADRA 4Z5ZA 4Z6XA 2HB9A 4BP0A 2A7MA 2Y8BA 4UWPB 3IDZA 2QINA 1ZNBA 5ACTA 4J5FA 1ZKPA 2YNTB 1KO3A 5B15A 4C1FA 4TZFA 4D1UA 2GMNA 5LLDA 4UA4A 3H3EA 4HL2A 4RL0A 3BV6A 2FU8A 3BK1A 1A7TA 1VGNA 2QDSA 4KEPA 3A4YA 3IOFA 4EFZA 2NZFA 3I14A 2FU6A 3PY5A 5AEBA 1A8TA 1E5DA 5HIPA 2BTNA 5ACWA 5HISA 3Q6VA 4AX1B 3QH8A 2OHIA 3I11A 4RM5A 3PG4A 2QEDA 5KILA 4NQ5A 4C1CA 4EXSA 4J5HA 4U4LA 1BMCA 4YSKA 5EV6A 2OHJA 2YCBA 2Q0IA 5EWAA 1M2XA 3ZR9A 2P1EA 4EY2A 4AX0B 5EV8A 1QH3A 2AZ4A 2E7YA 1SMLA 2BGAA 3ZNBA 3RKJA 2BIBA 2FHXA 3SW3A 2FU7A 5EVKA 4EYFA 3R2UA 3ESHA 2Q9UA 1WRAA 2OHHA 2YNWA 2ZZIA 3T3OA 5EHTA 4RAWA 2BFKA 2CBNA 2FM6A 3FCZA 5ACPA 2BMIA 4EYBA 2DOOA 1WUPA 2NXAA 5ACRA 4NQ4A 2BR6A 2NZEA 1X8IA 3IOGA 3DHBA 4XWWA 2WYMC 3S0ZA 3T3NA 4C1DA 1ZTCA 3X2YA 4Z7RA 4ZO3A 4EYLA 4UBQA 3IELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A0T A;  3SFP A;  1DXK A;  5K4N A;  4F6Z A;  3T9M A;  1YCG A;  4Z5Y A;  1JT1 A;  1MQO A;  3ZQ4 A;  2Q42 A;  1VJN A;  4XUK A;  4GCW A;  5ACQ A;  3KNS A;  4FR7 A;  3VQZ A;  2GFJ A;  3ZWF A;  5LCA A;  4D1V A;  1XM8 A;  4LE6 A;  3BK2 A;  1VME A;  3P2U A;  5EH9 A;  4TYF A;  1WW1 A;  2BC2 A;  2Y8A A;  3IE1 A;  4V0H A;  3VPE A;  5HIQ A;  5FQA A;  2GKL A;  3RPC A;  4C1H A;  5AXO A;  2GFK A;  2UYX A;  2NYP A;  5ACX A;  4YSB A;  4AWY B;  3LVZ A;  2YZ3 A;  4UAM A;  4ZEJ A;  5EW0 A;  3JXP A;  5EVB A;  5HIO A;  4RBS A;  5HH6 A;  4ZO2 A;  3I15 A;  1X8G A;  4FSB A;  5KIK A;  3G1P A;  4AD9 A;  5LCH A;  2VW8 A;  4YSL A;  2BG8 B;  1KR3 A;  4FEK A;  4RL2 A;  2YNV B;  2QJS A;  2WRS A;  2FK6 A;  2YNU A;  3AF5 A;  2WHG A;  4PVT A;  5HH4 A;  4C1G A;  3TP9 A;  3IE2 A;  2ZWR A;  5AXR A;  2ZNB A;  3I13 A;  2DKF A;  1BVT A;  3IE0 A;  3SPU A;  2YNV A;  4H0D A;  2I7V A;  2BFL A;  2Q0J A;  4DIK A;  2FHX B;  3FAI A;  3I0V A;  5A87 A;  3IEM A;  3KL7 A;  5B1U A;  5FQB A;  4GYU A;  3SD9 A;  3IEK A;  4CHL A;  5EVD A;  4RAM A;  1BC2 A;  4NQ2 A;  1DDK A;  2AIO A;  4C09 A;  1KO2 A;  1Y44 A;  5AYA A;  4B87 A;  5AHO A;  3BC2 A;  2QDT A;  5A5Z A;  2WYM A;  1X8H A;  2WYL A;  5LM6 A;  4TYT A;  2BG7 A;  4PVO A;  3RKK A;  1YCF A;  3DHA A;  2YNT A;  3MD7 A;  4F6H A;  5FQC A;  1XTO A;  4Z60 A;  1L9Y A;  4JO0 A;  2BG6 A;  2R2D A;  4AWZ A;  2M5C A;  4TZB A;  4ZNB A;  4HKY A;  1K07 A;  5K4K A;  4O98 A;  1DD6 A;  3SBL A;  2BG8 A;  3DH8 A;  5AHR A;  2BFZ B;  4UWR B;  5LS3 A;  4GYQ A;  4DIL A;  5A0V A;  4HL1 A;  1HLK A;  5K4M A;  2XR1 A;  5LE1 A;  2ZO4 A;  5B3R A;  4UWO B;  5LSC A;  3F9O A;  1WUO A;  2Y87 A;  2H6A A;  5K0W A;  3AF6 A;  5DPX A;  4D02 A;  5ACV A;  2P4Z A;  4BZ3 A;  3L6N A;  1JJE A;  1QH5 A;  3AJ3 A;  3DHC A;  5LCF A;  3X2X A;  4D1T A;  5IQK A;  1YCH A;  4XWT A;  5ACU A;  4Z67 A;  2GCU A;  3PY6 A;  3KNR A;  3X2Z A;  4KEQ A;  4EXY A;  4C1E A;  2XF4 A;  3WXC A;  3SRX A;  1JJT A;  2I7T A;  4TZE A;  2BG2 A;  2P97 A;  1P9E A;  5HH5 A;  5LMC A;  2I7X A;  4WD6 A;  2FU9 A;  4UWS B;  3X30 A;  2BFZ A;  4NQ6 A;  4P62 A;  4TZ9 A;  4D1W A;  2P18 A;  5ACS A;  2M5D A;  3ADR A;  4Z5Z A;  4Z6X A;  2HB9 A;  4BP0 A;  2A7M A;  2Y8B A;  4UWP B;  3IDZ A;  2QIN A;  1ZNB A;  5ACT A;  4J5F A;  1ZKP A;  2YNT B;  1KO3 A;  5B15 A;  4C1F A;  4TZF A;  4D1U A;  2GMN A;  5LLD A;  4UA4 A;  3H3E A;  4HL2 A;  4RL0 A;  3BV6 A;  2FU8 A;  3BK1 A;  1A7T A;  1VGN A;  2QDS A;  4KEP A;  3A4Y A;  3IOF A;  4EFZ A;  2NZF A;  3I14 A;  2FU6 A;  3PY5 A;  5AEB A;  1A8T A;  1E5D A;  5HIP A;  2BTN A;  5ACW A;  5HIS A;  3Q6V A;  4AX1 B;  3QH8 A;  2OHI A;  3I11 A;  4RM5 A;  3PG4 A;  2QED A;  5KIL A;  4NQ5 A;  4C1C A;  4EXS A;  4J5H A;  4U4L A;  1BMC A;  4YSK A;  5EV6 A;  2OHJ A;  2YCB A;  2Q0I A;  5EWA A;  1M2X A;  3ZR9 A;  2P1E A;  4EY2 A;  4AX0 B;  5EV8 A;  1QH3 A;  2AZ4 A;  2E7Y A;  1SML A;  2BGA A;  3ZNB A;  3RKJ A;  2BIB A;  2FHX A;  3SW3 A;  2FU7 A;  5EVK A;  4EYF A;  3R2U A;  3ESH A;  2Q9U A;  1WRA A;  2OHH A;  2YNW A;  2ZZI A;  3T3O A;  5EHT A;  4RAW A;  2BFK A;  2CBN A;  2FM6 A;  3FCZ A;  5ACP A;  2BMI A;  4EYB A;  2DOO A;  1WUP A;  2NXA A;  5ACR A;  4NQ4 A;  2BR6 A;  2NZE A;  1X8I A;  3IOG A;  3DHB A;  4XWW A;  2WYM C;  3S0Z A;  3T3N A;  4C1D A;  1ZTC A;  3X2Y A;  4Z7R A;  4ZO3 A;  4EYL A;  4UBQ A;  3IEL A; 
#chains in the Genus database with same CATH topology
 5A0T A;  3SFP A;  1DXK A;  5K4N A;  4F6Z A;  3T9M A;  1YCG A;  4Z5Y A;  2CG3 A;  1JT1 A;  1MQO A;  3ZQ4 A;  2Q42 A;  1VJN A;  4XUK A;  4GCW A;  4NUR A;  5ACQ A;  3KNS A;  4FR7 A;  3VQZ A;  2GFJ A;  3ZWF A;  5LCA A;  4D1V A;  1XM8 A;  4LE6 A;  3BK2 A;  1VME A;  3P2U A;  5EH9 A;  4TYF A;  1WW1 A;  2BC2 A;  4AXH A;  2Y8A A;  3IE1 A;  4V0H A;  3VPE A;  5HIQ A;  5FQA A;  2GKL A;  3RPC A;  4C1H A;  5AXO A;  2GFK A;  2UYX A;  2NYP A;  5ACX A;  4YSB A;  4AWY B;  3LVZ A;  2YZ3 A;  4UAM A;  4ZEJ A;  5EW0 A;  3JXP A;  5EVB A;  5HIO A;  4RBS A;  5HH6 A;  4ZO2 A;  3I15 A;  1X8G A;  4FSB A;  3G1P A;  5KIK A;  4AD9 A;  2VW8 A;  5LCH A;  4YSL A;  2BG8 B;  1KR3 A;  4FEK A;  4RL2 A;  2YNV B;  2QJS A;  2WRS A;  2FK6 A;  2YNU A;  3AF5 A;  2WHG A;  4PVT A;  5HH4 A;  4C1G A;  3TP9 A;  3IE2 A;  2ZWR A;  5AXR A;  2ZNB A;  3I13 A;  2DKF A;  1BVT A;  3IE0 A;  3SPU A;  2YNV A;  4H0D A;  2I7V A;  2BFL A;  2Q0J A;  4DIK A;  2FHX B;  3FAI A;  3I0V A;  5A87 A;  3IEM A;  3KL7 A;  5B1U A;  5FQB A;  4GYU A;  3SD9 A;  3IEK A;  4CHL A;  5EVD A;  4RAM A;  1BC2 A;  2CG2 A;  4NQ2 A;  1DDK A;  2AIO A;  4C09 A;  1KO2 A;  1Y44 A;  5AYA A;  4B87 A;  5AHO A;  3BC2 A;  2QDT A;  5A5Z A;  2WYM A;  1X8H A;  2WYL A;  5LM6 A;  4TYT A;  2BG7 A;  4PVO A;  3RKK A;  1YCF A;  3DHA A;  2YNT A;  3MD7 A;  4F6H A;  5FQC A;  1XTO A;  4Z60 A;  1L9Y A;  4JO0 A;  2BG6 A;  2R2D A;  4AWZ A;  2M5C A;  4TZB A;  4ZNB A;  4HKY A;  1K07 A;  5K4K A;  4O98 A;  1DD6 A;  3SBL A;  2BG8 A;  3DH8 A;  5AHR A;  2BFZ B;  4UWR B;  5LS3 A;  4GYQ A;  4DIL A;  5A0V A;  4HL1 A;  1HLK A;  5K4M A;  2XR1 A;  2ZO4 A;  5LE1 A;  5B3R A;  4UWO B;  5LSC A;  3F9O A;  1WUO A;  2Y87 A;  2H6A A;  4PDX A;  5K0W A;  3AF6 A;  5DPX A;  4D02 A;  5ACV A;  2P4Z A;  4BZ3 A;  3L6N A;  1JJE A;  1QH5 A;  3AJ3 A;  3DHC A;  5LCF A;  5AIJ A;  3X2X A;  4D1T A;  5IQK A;  5A23 A;  1YCH A;  4XWT A;  5ACU A;  4Z67 A;  2GCU A;  3PY6 A;  3KNR A;  3X2Z A;  4KEQ A;  4EXY A;  4C1E A;  2XF4 A;  3WXC A;  3SRX A;  1JJT A;  2I7T A;  4TZE A;  2BG2 A;  2P97 A;  1P9E A;  5HH5 A;  5LMC A;  2I7X A;  4WD6 A;  2FU9 A;  4UWS B;  2CFZ A;  3X30 A;  2BFZ A;  4NQ6 A;  4P62 A;  4TZ9 A;  4D1W A;  2P18 A;  5ACS A;  2M5D A;  3ADR A;  4Z5Z A;  2YHE A;  4Z6X A;  2HB9 A;  4BP0 A;  2A7M A;  2Y8B A;  4UWP B;  3IDZ A;  2QIN A;  1ZNB A;  5ACT A;  4J5F A;  1ZKP A;  2YNT B;  1KO3 A;  5B15 A;  4C1F A;  4TZF A;  4D1U A;  2GMN A;  5LLD A;  4AV7 A;  4UA4 A;  3H3E A;  4HL2 A;  4RL0 A;  3BV6 A;  2FU8 A;  3BK1 A;  1A7T A;  1VGN A;  2QDS A;  4KEP A;  3A4Y A;  5AJL A;  3IOF A;  4EFZ A;  2NZF A;  3I14 A;  2FU6 A;  3PY5 A;  5AEB A;  1A8T A;  1E5D A;  5HIP A;  2BTN A;  5ACW A;  5HIS A;  3Q6V A;  4AX1 B;  3QH8 A;  2OHI A;  3I11 A;  4RM5 A;  3PG4 A;  2QED A;  5KIL A;  4NQ5 A;  4C1C A;  4EXS A;  4J5H A;  4U4L A;  1BMC A;  4YSK A;  5EV6 A;  2OHJ A;  2YCB A;  2Q0I A;  5EWA A;  1M2X A;  3ZR9 A;  2P1E A;  4EY2 A;  4AX0 B;  5EV8 A;  1QH3 A;  2AZ4 A;  2E7Y A;  1SML A;  2BGA A;  3ZNB A;  3RKJ A;  2BIB A;  2FHX A;  3SW3 A;  2FU7 A;  5EVK A;  4EYF A;  3R2U A;  3ESH A;  2CFU A;  2Q9U A;  1WRA A;  2OHH A;  2YNW A;  2ZZI A;  3T3O A;  5EHT A;  4RAW A;  2BFK A;  2CBN A;  2FM6 A;  3FCZ A;  5ACP A;  2BMI A;  4EYB A;  2DOO A;  1WUP A;  2NXA A;  5ACR A;  4NQ4 A;  2BR6 A;  2NZE A;  1X8I A;  3IOG A;  3DHB A;  4XWW A;  2WYM C;  3S0Z A;  3T3N A;  4C1D A;  1ZTC A;  3X2Y A;  4Z7R A;  4ZO3 A;  4EYL A;  4UBQ A;  3IEL A; 
#chains in the Genus database with same CATH homology
 5A0T A;  3SFP A;  1DXK A;  5K4N A;  4F6Z A;  3T9M A;  1YCG A;  4Z5Y A;  1JT1 A;  1MQO A;  3ZQ4 A;  2Q42 A;  1VJN A;  4XUK A;  4GCW A;  5ACQ A;  3KNS A;  4FR7 A;  3VQZ A;  2GFJ A;  3ZWF A;  5LCA A;  4D1V A;  1XM8 A;  4LE6 A;  3BK2 A;  1VME A;  3P2U A;  5EH9 A;  4TYF A;  1WW1 A;  2BC2 A;  2Y8A A;  3IE1 A;  4V0H A;  3VPE A;  5HIQ A;  5FQA A;  2GKL A;  3RPC A;  4C1H A;  5AXO A;  2GFK A;  2UYX A;  2NYP A;  5ACX A;  4YSB A;  4AWY B;  3LVZ A;  2YZ3 A;  4UAM A;  4ZEJ A;  5EW0 A;  3JXP A;  5EVB A;  5HIO A;  4RBS A;  5HH6 A;  4ZO2 A;  3I15 A;  1X8G A;  4FSB A;  5KIK A;  3G1P A;  4AD9 A;  5LCH A;  2VW8 A;  4YSL A;  2BG8 B;  1KR3 A;  4FEK A;  4RL2 A;  2YNV B;  2QJS A;  2WRS A;  2FK6 A;  2YNU A;  3AF5 A;  2WHG A;  4PVT A;  5HH4 A;  4C1G A;  3TP9 A;  3IE2 A;  2ZWR A;  5AXR A;  2ZNB A;  3I13 A;  2DKF A;  1BVT A;  3IE0 A;  3SPU A;  2YNV A;  4H0D A;  2I7V A;  2BFL A;  2Q0J A;  4DIK A;  2FHX B;  3FAI A;  3I0V A;  5A87 A;  3IEM A;  3KL7 A;  5B1U A;  5FQB A;  4GYU A;  3SD9 A;  3IEK A;  4CHL A;  5EVD A;  4RAM A;  1BC2 A;  4NQ2 A;  1DDK A;  2AIO A;  4C09 A;  1KO2 A;  1Y44 A;  5AYA A;  4B87 A;  5AHO A;  3BC2 A;  2QDT A;  5A5Z A;  2WYM A;  1X8H A;  2WYL A;  5LM6 A;  4TYT A;  2BG7 A;  4PVO A;  3RKK A;  1YCF A;  3DHA A;  2YNT A;  3MD7 A;  4F6H A;  5FQC A;  1XTO A;  4Z60 A;  1L9Y A;  4JO0 A;  2BG6 A;  2R2D A;  4AWZ A;  2M5C A;  4TZB A;  4ZNB A;  4HKY A;  1K07 A;  5K4K A;  4O98 A;  1DD6 A;  3SBL A;  2BG8 A;  3DH8 A;  5AHR A;  2BFZ B;  4UWR B;  5LS3 A;  4GYQ A;  4DIL A;  5A0V A;  4HL1 A;  1HLK A;  5K4M A;  2XR1 A;  5LE1 A;  2ZO4 A;  5B3R A;  4UWO B;  5LSC A;  3F9O A;  1WUO A;  2Y87 A;  2H6A A;  5K0W A;  3AF6 A;  5DPX A;  4D02 A;  5ACV A;  2P4Z A;  4BZ3 A;  3L6N A;  1JJE A;  1QH5 A;  3AJ3 A;  3DHC A;  5LCF A;  3X2X A;  4D1T A;  5IQK A;  1YCH A;  4XWT A;  5ACU A;  4Z67 A;  2GCU A;  3PY6 A;  3KNR A;  3X2Z A;  4KEQ A;  4EXY A;  4C1E A;  2XF4 A;  3WXC A;  3SRX A;  1JJT A;  2I7T A;  4TZE A;  2BG2 A;  2P97 A;  1P9E A;  5HH5 A;  5LMC A;  2I7X A;  4WD6 A;  2FU9 A;  4UWS B;  3X30 A;  2BFZ A;  4NQ6 A;  4P62 A;  4TZ9 A;  4D1W A;  2P18 A;  5ACS A;  2M5D A;  3ADR A;  4Z5Z A;  4Z6X A;  2HB9 A;  4BP0 A;  2A7M A;  2Y8B A;  4UWP B;  3IDZ A;  2QIN A;  1ZNB A;  5ACT A;  4J5F A;  1ZKP A;  2YNT B;  1KO3 A;  5B15 A;  4C1F A;  4TZF A;  4D1U A;  2GMN A;  5LLD A;  4UA4 A;  3H3E A;  4HL2 A;  4RL0 A;  3BV6 A;  2FU8 A;  3BK1 A;  1A7T A;  1VGN A;  2QDS A;  4KEP A;  3A4Y A;  3IOF A;  4EFZ A;  2NZF A;  3I14 A;  2FU6 A;  3PY5 A;  5AEB A;  1A8T A;  1E5D A;  5HIP A;  2BTN A;  5ACW A;  5HIS A;  3Q6V A;  4AX1 B;  3QH8 A;  2OHI A;  3I11 A;  4RM5 A;  3PG4 A;  2QED A;  5KIL A;  4NQ5 A;  4C1C A;  4EXS A;  4J5H A;  4U4L A;  1BMC A;  4YSK A;  5EV6 A;  2OHJ A;  2YCB A;  2Q0I A;  5EWA A;  1M2X A;  3ZR9 A;  2P1E A;  4EY2 A;  4AX0 B;  5EV8 A;  1QH3 A;  2AZ4 A;  2E7Y A;  1SML A;  2BGA A;  3ZNB A;  3RKJ A;  2BIB A;  2FHX A;  3SW3 A;  2FU7 A;  5EVK A;  4EYF A;  3R2U A;  3ESH A;  2Q9U A;  1WRA A;  2OHH A;  2YNW A;  2ZZI A;  3T3O A;  5EHT A;  4RAW A;  2BFK A;  2CBN A;  2FM6 A;  3FCZ A;  5ACP A;  2BMI A;  4EYB A;  2DOO A;  1WUP A;  2NXA A;  5ACR A;  4NQ4 A;  2BR6 A;  2NZE A;  1X8I A;  3IOG A;  3DHB A;  4XWW A;  2WYM C;  3S0Z A;  3T3N A;  4C1D A;  1ZTC A;  3X2Y A;  4Z7R A;  4ZO3 A;  4EYL A;  4UBQ A;  3IEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...