4AWZA

Crystal structure of the mobile metallo-beta-lactamase aim-1 from pseudomonas aeruginosa: insights into antibiotic binding and the role of gln157
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
269
structure length
269
Chain Sequence
ASRGCADDAGWNDPAMPLKVYGNTWYVGTCGISALLVTSDAGHILVDAATPQAGPQILANIRALGFRPEDVRAIVFSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLPDRTDPQFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRSCEGDDCRQMVYADSLTAISDDVFRYSDDAAHPGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRIGPRAAAPLMDTTACRRYAQGARQRLEKRLAEEAAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METALLO-BETA-LACTAMASE AIM-1
publication title Crystal Structure of the Mobile Metallo-Beta-Lactamase Aim-1 from Pseudomonas Aeruginosa: Insights Into Antibiotic Binding and the Role of Gln157.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 90
structure length 269
sequence length 269
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4awzA00
2GMNA 3IEKA 3AF5A 4FEKA 1VGNA 2XF4A 4C1GA 3RPCA 1QH5A 1MQOA 4RM5A 2Q9UA 5LSCA 5LLDA 1Y44A 2YNUA 1M2XA 3X2ZA 5B3RA 2UYXA 3ZQ4A 2I7TA 4D02A 3I0VA 4AD9A 5EV6A 5LCFA 5AXOA 2BG6A 3S0ZA 1SMLA 3G1PA 3I14A 5FQCA 4TYFA 1WRAA 1YCFA 3Q6VA 4UBQA 4YSKA 2Q0JA 2FU7A 2I7VA 4C09A 4HL2A 4D1UA 2QEDA 4TZBA 2ZZIA 5LE1A 5K4KA 1E5DA 3IE0A 2BGAA 5HH5A 2BR6A 5AXRA 5ACQA 2BG8B 4ZEJA 4RAMA 3T3NA 3H3EA 4RL2A 2XR1A 3FCZA 4Z67A 5FQBA 5K0WA 5KILA 3PY6A 4YSLA 3X2YA 5EW0A 4D1WA 2FU8A 1ZNBA 4RL0A 5IQKA 5K4MA 2YNTA 4Z7RA 2ZNBA 2GFKA 2A7MA 3SD9A 4XWTA 2Y87A 4EYFA 4KEQA 4Z6XA 3I15A 4EYLA 4C1HA 1KO3A 3T9MA 4TZ9A 3SBLA 4NQ5A 2M5CA 1A8TA 3VQZA 4NQ4A 3IELA 4AWYB 4UWPB 1BC2A 3TP9A 5LS3A 2NXAA 2WYMA 3BK1A 3MD7A 2WYMC 2GFJA 3IOGA 4J5FA 4KEPA 4RAWA 3PY5A 4AWZA 2Y8BA 5AHRA 5EHTA 3ZWFA 2BG2A 4UA4A 1YCGA 2FM6A 2FU6A 3SRXA 3WXCA 5A5ZA 1DXKA 5ACRA 5A0TA 1WW1A 4UAMA 4Z60A 2BTNA 2M5DA 5LCAA 2BFZB 2Q42A 2WRSA 4U4LA 4EXYA 2E7YA 4XWWA 3ESHA 1KR3A 4TZEA 1DDKA 4O98A 4V0HA 1XM8A 2VW8A 5ACXA 1YCHA 2BFZA 2GKLA 2P18A 3PG4A 2FHXA 4GCWA 2R2DA 5HH4A 4GYQA 5HISA 2NZEA 2QINA 4EFZA 2NYPA 2BG7A 5LM6A 5EVDA 2CBNA 4EYBA 1WUOA 1BMCA 4ZNBA 3ADRA 4ZO2A 5HH6A 4DIKA 2WHGA 4D1TA 2YNTB 1HLKA 4YSBA 2ZO4A 5ACSA 3DHAA 4Z5ZA 5AYAA 1QH3A 2DOOA 5ACTA 3LVZA 4UWOB 4GYUA 1K07A 4J5HA 3BC2A 3DH8A 3ZNBA 1X8HA 3VPEA 2DKFA 2WYLA 3KL7A 2BFLA 4PVOA 4NQ2A 1VMEA 3T3OA 3IE2A 3I13A 4HL1A 2YCBA 3ZR9A 4UWSB 2YNVB 4CHLA 2H6AA 3P2UA 3FAIA 2OHHA 2AIOA 1P9EA 3SW3A 2OHJA 2YZ3A 4C1CA 4AX0B 2YNVA 5ACVA 4XUKA 3X2XA 4RBSA 1KO2A 2NZFA 2QDSA 4B87A 4H0DA 5FQAA 4F6ZA 3RKJA 1JT1A 2FU9A 1A7TA 2P1EA 5ACWA 4FR7A 5EVKA 2FHXB 1WUPA 2P97A 5LMCA 2FK6A 4FSBA 3L6NA 4Z5YA 5EVBA 5EWAA 1JJEA 3F9OA 1X8GA 2OHIA 5AHOA 4DILA 4C1FA 4F6HA 2YNWA 3AJ3A 2I7XA 5HIPA 2QJSA 3I11A 2AZ4A 2BMIA 2P4ZA 3SPUA 1DD6A 3R2UA 1XTOA 5HIOA 4LE6A 4TZFA 2GCUA 2BC2A 3IEMA 4UWRB 4BZ3A 3SFPA 4JO0A 3DHBA 5K4NA 5HIQA 5ACUA 5AEBA 3QH8A 2QDTA 3IDZA 3BV6A 5B1UA 3IOFA 4C1DA 4HKYA 4ZO3A 2HB9A 2ZWRA 1VJNA 4BP0A 5A87A 4D1VA 3AF6A 5EH9A 5ACPA 1L9YA 2Q0IA 2BG8A 2BFKA 4NQ6A 1ZTCA 5A0VA 4WD6A 4EXSA 3A4YA 4C1EA 3BK2A 3KNSA 4P62A 3IE1A 2BIBA 5DPXA 1ZKPA 3X30A 2Y8AA 5KIKA 4EY2A 4TYTA 1X8IA 3DHCA 5EV8A 3RKKA 4AX1B 5LCHA 3JXPA 1JJTA 3KNRA 1BVTA 4PVTA 5B15A
chains in the Genus database with same CATH superfamily
2GMNA 3IEKA 3AF5A 4FEKA 1VGNA 2XF4A 4C1GA 3RPCA 1QH5A 1MQOA 4RM5A 2Q9UA 5LSCA 5LLDA 1Y44A 2YNUA 1M2XA 3X2ZA 5B3RA 2UYXA 3ZQ4A 2I7TA 4D02A 3I0VA 4AD9A 5EV6A 5LCFA 5AXOA 2BG6A 3S0ZA 1SMLA 3G1PA 3I14A 5FQCA 4TYFA 1WRAA 1YCFA 3Q6VA 4UBQA 4YSKA 2Q0JA 2FU7A 2I7VA 4C09A 4HL2A 4D1UA 2QEDA 4TZBA 2ZZIA 5LE1A 5K4KA 1E5DA 3IE0A 2BGAA 5HH5A 2BR6A 5AXRA 5ACQA 2BG8B 4ZEJA 4RAMA 3T3NA 3H3EA 4RL2A 2XR1A 3FCZA 4Z67A 5FQBA 5K0WA 5KILA 3PY6A 4YSLA 3X2YA 5EW0A 4D1WA 2FU8A 1ZNBA 4RL0A 5IQKA 5K4MA 2YNTA 4Z7RA 2ZNBA 2GFKA 2CFZA 2A7MA 3SD9A 4XWTA 2Y87A 4EYFA 4KEQA 4Z6XA 3I15A 4EYLA 4C1HA 1KO3A 3T9MA 4TZ9A 3SBLA 4NQ5A 2M5CA 1A8TA 3VQZA 4NQ4A 3IELA 4AWYB 4UWPB 1BC2A 3TP9A 5LS3A 2NXAA 2WYMA 3BK1A 3MD7A 2WYMC 2GFJA 3IOGA 4J5FA 4KEPA 4RAWA 3PY5A 4AWZA 2Y8BA 5AHRA 5EHTA 3ZWFA 2BG2A 4UA4A 1YCGA 2FM6A 2FU6A 3SRXA 3WXCA 5A5ZA 1DXKA 5ACRA 5A0TA 1WW1A 4UAMA 4Z60A 2BTNA 2M5DA 5LCAA 2BFZB 2Q42A 2WRSA 4U4LA 4EXYA 2E7YA 4XWWA 3ESHA 4NURA 1KR3A 4TZEA 1DDKA 4O98A 4V0HA 1XM8A 2VW8A 5ACXA 1YCHA 2BFZA 2GKLA 2P18A 3PG4A 2FHXA 4GCWA 2R2DA 5HH4A 4GYQA 5HISA 2NZEA 2QINA 4EFZA 2NYPA 2BG7A 5LM6A 5EVDA 2CBNA 4EYBA 1WUOA 1BMCA 4ZNBA 3ADRA 5AJLA 4ZO2A 5HH6A 4DIKA 2WHGA 4D1TA 2YNTB 1HLKA 4YSBA 2ZO4A 5ACSA 3DHAA 4Z5ZA 5AYAA 1QH3A 2DOOA 5ACTA 3LVZA 4UWOB 4GYUA 1K07A 4J5HA 3BC2A 3DH8A 3ZNBA 1X8HA 3VPEA 2DKFA 2WYLA 3KL7A 2BFLA 4PVOA 4NQ2A 1VMEA 3T3OA 3IE2A 3I13A 4HL1A 2YCBA 3ZR9A 4UWSB 2YNVB 4AV7A 4CHLA 2H6AA 3P2UA 2YHEA 3FAIA 2OHHA 2AIOA 1P9EA 3SW3A 2OHJA 2YZ3A 4PDXA 4C1CA 4AX0B 2YNVA 5ACVA 4XUKA 3X2XA 4RBSA 1KO2A 2NZFA 2QDSA 4B87A 4H0DA 5FQAA 5AIJA 4F6ZA 3RKJA 1JT1A 2FU9A 1A7TA 2P1EA 5ACWA 4FR7A 5EVKA 2FHXB 1WUPA 2P97A 5LMCA 2FK6A 4AXHA 4FSBA 3L6NA 4Z5YA 5EVBA 5EWAA 1JJEA 3F9OA 1X8GA 2OHIA 5AHOA 4DILA 4C1FA 4F6HA 2YNWA 3AJ3A 2I7XA 5HIPA 2QJSA 3I11A 2AZ4A 2BMIA 2CFUA 2P4ZA 3SPUA 1DD6A 3R2UA 1XTOA 5HIOA 4LE6A 4TZFA 2GCUA 2BC2A 3IEMA 4UWRB 4BZ3A 3SFPA 4JO0A 3DHBA 5K4NA 5HIQA 5ACUA 5AEBA 3QH8A 2QDTA 3IDZA 3BV6A 5B1UA 3IOFA 4C1DA 4HKYA 4ZO3A 2HB9A 2ZWRA 1VJNA 4BP0A 5A87A 4D1VA 3AF6A 5EH9A 5ACPA 1L9YA 2Q0IA 2BG8A 2BFKA 4NQ6A 1ZTCA 5A0VA 4WD6A 4EXSA 3A4YA 4C1EA 3BK2A 3KNSA 4P62A 3IE1A 2BIBA 5DPXA 1ZKPA 2CG3A 3X30A 2Y8AA 5KIKA 4EY2A 4TYTA 1X8IA 3DHCA 5EV8A 3RKKA 4AX1B 5LCHA 3JXPA 1JJTA 5A23A 3KNRA 1BVTA 2CG2A 4PVTA 5B15A
chains in the Genus database with same CATH topology
2GMNA 3IEKA 3AF5A 4FEKA 1VGNA 2XF4A 4C1GA 3RPCA 1QH5A 1MQOA 4RM5A 2Q9UA 5LSCA 5LLDA 1Y44A 2YNUA 1M2XA 3X2ZA 5B3RA 2UYXA 3ZQ4A 2I7TA 4D02A 3I0VA 4AD9A 5EV6A 5LCFA 5AXOA 2BG6A 3S0ZA 1SMLA 3G1PA 3I14A 5FQCA 4TYFA 1WRAA 1YCFA 3Q6VA 4UBQA 4YSKA 2Q0JA 2FU7A 2I7VA 4C09A 4HL2A 4D1UA 2QEDA 4TZBA 2ZZIA 5LE1A 5K4KA 1E5DA 3IE0A 2BGAA 5HH5A 2BR6A 5AXRA 5ACQA 2BG8B 4ZEJA 4RAMA 3T3NA 3H3EA 4RL2A 2XR1A 3FCZA 4Z67A 5FQBA 5K0WA 5KILA 3PY6A 4YSLA 3X2YA 5EW0A 4D1WA 2FU8A 1ZNBA 4RL0A 5IQKA 5K4MA 2YNTA 4Z7RA 2ZNBA 2GFKA 2A7MA 3SD9A 4XWTA 2Y87A 4EYFA 4KEQA 4Z6XA 3I15A 4EYLA 4C1HA 1KO3A 3T9MA 4TZ9A 3SBLA 4NQ5A 2M5CA 1A8TA 3VQZA 4NQ4A 3IELA 4AWYB 4UWPB 1BC2A 3TP9A 5LS3A 2NXAA 2WYMA 3BK1A 3MD7A 2WYMC 2GFJA 3IOGA 4J5FA 4KEPA 4RAWA 3PY5A 4AWZA 2Y8BA 5AHRA 5EHTA 3ZWFA 2BG2A 4UA4A 1YCGA 2FM6A 2FU6A 3SRXA 3WXCA 5A5ZA 1DXKA 5ACRA 5A0TA 1WW1A 4UAMA 4Z60A 2BTNA 2M5DA 5LCAA 2BFZB 2Q42A 2WRSA 4U4LA 4EXYA 2E7YA 4XWWA 3ESHA 1KR3A 4TZEA 1DDKA 4O98A 4V0HA 1XM8A 2VW8A 5ACXA 1YCHA 2BFZA 2GKLA 2P18A 3PG4A 2FHXA 4GCWA 2R2DA 5HH4A 4GYQA 5HISA 2NZEA 2QINA 4EFZA 2NYPA 2BG7A 5LM6A 5EVDA 2CBNA 4EYBA 1WUOA 1BMCA 4ZNBA 3ADRA 4ZO2A 5HH6A 4DIKA 2WHGA 4D1TA 2YNTB 1HLKA 4YSBA 2ZO4A 5ACSA 3DHAA 4Z5ZA 5AYAA 1QH3A 2DOOA 5ACTA 3LVZA 4UWOB 4GYUA 1K07A 4J5HA 3BC2A 3DH8A 3ZNBA 1X8HA 3VPEA 2DKFA 2WYLA 3KL7A 2BFLA 4PVOA 4NQ2A 1VMEA 3T3OA 3IE2A 3I13A 4HL1A 2YCBA 3ZR9A 4UWSB 2YNVB 4CHLA 2H6AA 3P2UA 3FAIA 2OHHA 2AIOA 1P9EA 3SW3A 2OHJA 2YZ3A 4C1CA 4AX0B 2YNVA 5ACVA 4XUKA 3X2XA 4RBSA 1KO2A 2NZFA 2QDSA 4B87A 4H0DA 5FQAA 4F6ZA 3RKJA 1JT1A 2FU9A 1A7TA 2P1EA 5ACWA 4FR7A 5EVKA 2FHXB 1WUPA 2P97A 5LMCA 2FK6A 4FSBA 3L6NA 4Z5YA 5EVBA 5EWAA 1JJEA 3F9OA 1X8GA 2OHIA 5AHOA 4DILA 4C1FA 4F6HA 2YNWA 3AJ3A 2I7XA 5HIPA 2QJSA 3I11A 2AZ4A 2BMIA 2P4ZA 3SPUA 1DD6A 3R2UA 1XTOA 5HIOA 4LE6A 4TZFA 2GCUA 2BC2A 3IEMA 4UWRB 4BZ3A 3SFPA 4JO0A 3DHBA 5K4NA 5HIQA 5ACUA 5AEBA 3QH8A 2QDTA 3IDZA 3BV6A 5B1UA 3IOFA 4C1DA 4HKYA 4ZO3A 2HB9A 2ZWRA 1VJNA 4BP0A 5A87A 4D1VA 3AF6A 5EH9A 5ACPA 1L9YA 2Q0IA 2BG8A 2BFKA 4NQ6A 1ZTCA 5A0VA 4WD6A 4EXSA 3A4YA 4C1EA 3BK2A 3KNSA 4P62A 3IE1A 2BIBA 5DPXA 1ZKPA 3X30A 2Y8AA 5KIKA 4EY2A 4TYTA 1X8IA 3DHCA 5EV8A 3RKKA 4AX1B 5LCHA 3JXPA 1JJTA 3KNRA 1BVTA 4PVTA 5B15A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GMN A;  3IEK A;  3AF5 A;  4FEK A;  1VGN A;  2XF4 A;  4C1G A;  3RPC A;  1QH5 A;  1MQO A;  4RM5 A;  2Q9U A;  5LSC A;  5LLD A;  1Y44 A;  2YNU A;  1M2X A;  3X2Z A;  5B3R A;  2UYX A;  3ZQ4 A;  2I7T A;  4D02 A;  3I0V A;  4AD9 A;  5EV6 A;  5LCF A;  5AXO A;  2BG6 A;  3S0Z A;  1SML A;  3G1P A;  3I14 A;  5FQC A;  4TYF A;  1WRA A;  1YCF A;  3Q6V A;  4UBQ A;  4YSK A;  2Q0J A;  2FU7 A;  2I7V A;  4C09 A;  4HL2 A;  4D1U A;  2QED A;  4TZB A;  2ZZI A;  5LE1 A;  5K4K A;  1E5D A;  3IE0 A;  2BGA A;  5HH5 A;  2BR6 A;  5AXR A;  5ACQ A;  2BG8 B;  4ZEJ A;  4RAM A;  3T3N A;  3H3E A;  4RL2 A;  2XR1 A;  3FCZ A;  4Z67 A;  5FQB A;  5K0W A;  5KIL A;  3PY6 A;  4YSL A;  3X2Y A;  5EW0 A;  4D1W A;  2FU8 A;  1ZNB A;  4RL0 A;  5IQK A;  5K4M A;  2YNT A;  4Z7R A;  2ZNB A;  2GFK A;  2A7M A;  3SD9 A;  4XWT A;  2Y87 A;  4EYF A;  4KEQ A;  4Z6X A;  3I15 A;  4EYL A;  4C1H A;  1KO3 A;  3T9M A;  4TZ9 A;  3SBL A;  4NQ5 A;  2M5C A;  1A8T A;  3VQZ A;  4NQ4 A;  3IEL A;  4AWY B;  4UWP B;  1BC2 A;  3TP9 A;  5LS3 A;  2NXA A;  2WYM A;  3BK1 A;  3MD7 A;  2WYM C;  2GFJ A;  3IOG A;  4J5F A;  4KEP A;  4RAW A;  3PY5 A;  4AWZ A;  2Y8B A;  5AHR A;  5EHT A;  3ZWF A;  2BG2 A;  4UA4 A;  1YCG A;  2FM6 A;  2FU6 A;  3SRX A;  3WXC A;  5A5Z A;  1DXK A;  5ACR A;  5A0T A;  1WW1 A;  4UAM A;  4Z60 A;  2BTN A;  2M5D A;  5LCA A;  2BFZ B;  2Q42 A;  2WRS A;  4U4L A;  4EXY A;  2E7Y A;  4XWW A;  3ESH A;  1KR3 A;  4TZE A;  1DDK A;  4O98 A;  4V0H A;  1XM8 A;  2VW8 A;  5ACX A;  1YCH A;  2BFZ A;  2GKL A;  2P18 A;  3PG4 A;  2FHX A;  4GCW A;  2R2D A;  5HH4 A;  4GYQ A;  5HIS A;  2NZE A;  2QIN A;  4EFZ A;  2NYP A;  2BG7 A;  5LM6 A;  5EVD A;  2CBN A;  4EYB A;  1WUO A;  1BMC A;  4ZNB A;  3ADR A;  4ZO2 A;  5HH6 A;  4DIK A;  2WHG A;  4D1T A;  2YNT B;  1HLK A;  4YSB A;  2ZO4 A;  5ACS A;  3DHA A;  4Z5Z A;  5AYA A;  1QH3 A;  2DOO A;  5ACT A;  3LVZ A;  4UWO B;  4GYU A;  1K07 A;  4J5H A;  3BC2 A;  3DH8 A;  3ZNB A;  1X8H A;  3VPE A;  2DKF A;  2WYL A;  3KL7 A;  2BFL A;  4PVO A;  4NQ2 A;  1VME A;  3T3O A;  3IE2 A;  3I13 A;  4HL1 A;  2YCB A;  3ZR9 A;  4UWS B;  2YNV B;  4CHL A;  2H6A A;  3P2U A;  3FAI A;  2OHH A;  2AIO A;  1P9E A;  3SW3 A;  2OHJ A;  2YZ3 A;  4C1C A;  4AX0 B;  2YNV A;  5ACV A;  4XUK A;  3X2X A;  4RBS A;  1KO2 A;  2NZF A;  2QDS A;  4B87 A;  4H0D A;  5FQA A;  4F6Z A;  3RKJ A;  1JT1 A;  2FU9 A;  1A7T A;  2P1E A;  5ACW A;  4FR7 A;  5EVK A;  2FHX B;  1WUP A;  2P97 A;  5LMC A;  2FK6 A;  4FSB A;  3L6N A;  4Z5Y A;  5EVB A;  5EWA A;  1JJE A;  3F9O A;  1X8G A;  2OHI A;  5AHO A;  4DIL A;  4C1F A;  4F6H A;  2YNW A;  3AJ3 A;  2I7X A;  5HIP A;  2QJS A;  3I11 A;  2AZ4 A;  2BMI A;  2P4Z A;  3SPU A;  1DD6 A;  3R2U A;  1XTO A;  5HIO A;  4LE6 A;  4TZF A;  2GCU A;  2BC2 A;  3IEM A;  4UWR B;  4BZ3 A;  3SFP A;  4JO0 A;  3DHB A;  5K4N A;  5HIQ A;  5ACU A;  5AEB A;  3QH8 A;  2QDT A;  3IDZ A;  3BV6 A;  5B1U A;  3IOF A;  4C1D A;  4HKY A;  4ZO3 A;  2HB9 A;  2ZWR A;  1VJN A;  4BP0 A;  5A87 A;  4D1V A;  3AF6 A;  5EH9 A;  5ACP A;  1L9Y A;  2Q0I A;  2BG8 A;  2BFK A;  4NQ6 A;  1ZTC A;  5A0V A;  4WD6 A;  4EXS A;  3A4Y A;  4C1E A;  3BK2 A;  3KNS A;  4P62 A;  3IE1 A;  2BIB A;  5DPX A;  1ZKP A;  3X30 A;  2Y8A A;  5KIK A;  4EY2 A;  4TYT A;  1X8I A;  3DHC A;  5EV8 A;  3RKK A;  4AX1 B;  5LCH A;  3JXP A;  1JJT A;  3KNR A;  1BVT A;  4PVT A;  5B15 A; 
#chains in the Genus database with same CATH topology
 2GMN A;  3IEK A;  3AF5 A;  4FEK A;  1VGN A;  2XF4 A;  4C1G A;  3RPC A;  1QH5 A;  1MQO A;  4RM5 A;  2Q9U A;  5LSC A;  5LLD A;  1Y44 A;  2YNU A;  1M2X A;  3X2Z A;  5B3R A;  2UYX A;  3ZQ4 A;  2I7T A;  4D02 A;  3I0V A;  4AD9 A;  5EV6 A;  5LCF A;  5AXO A;  2BG6 A;  3S0Z A;  1SML A;  3G1P A;  3I14 A;  5FQC A;  4TYF A;  1WRA A;  1YCF A;  3Q6V A;  4UBQ A;  4YSK A;  2Q0J A;  2FU7 A;  2I7V A;  4C09 A;  4HL2 A;  4D1U A;  2QED A;  4TZB A;  2ZZI A;  5LE1 A;  5K4K A;  1E5D A;  3IE0 A;  2BGA A;  5HH5 A;  2BR6 A;  5AXR A;  5ACQ A;  2BG8 B;  4ZEJ A;  4RAM A;  3T3N A;  3H3E A;  4RL2 A;  2XR1 A;  3FCZ A;  4Z67 A;  5FQB A;  5K0W A;  5KIL A;  3PY6 A;  4YSL A;  3X2Y A;  5EW0 A;  4D1W A;  2FU8 A;  1ZNB A;  4RL0 A;  5IQK A;  5K4M A;  2YNT A;  4Z7R A;  2ZNB A;  2GFK A;  2CFZ A;  2A7M A;  3SD9 A;  4XWT A;  2Y87 A;  4EYF A;  4KEQ A;  4Z6X A;  3I15 A;  4EYL A;  4C1H A;  1KO3 A;  3T9M A;  4TZ9 A;  3SBL A;  4NQ5 A;  2M5C A;  1A8T A;  3VQZ A;  4NQ4 A;  3IEL A;  4AWY B;  4UWP B;  1BC2 A;  3TP9 A;  5LS3 A;  2NXA A;  2WYM A;  3BK1 A;  3MD7 A;  2WYM C;  2GFJ A;  3IOG A;  4J5F A;  4KEP A;  4RAW A;  3PY5 A;  4AWZ A;  2Y8B A;  5AHR A;  5EHT A;  3ZWF A;  2BG2 A;  4UA4 A;  1YCG A;  2FM6 A;  2FU6 A;  3SRX A;  3WXC A;  5A5Z A;  1DXK A;  5ACR A;  5A0T A;  1WW1 A;  4UAM A;  4Z60 A;  2BTN A;  2M5D A;  5LCA A;  2BFZ B;  2Q42 A;  2WRS A;  4U4L A;  4EXY A;  2E7Y A;  4XWW A;  3ESH A;  4NUR A;  1KR3 A;  4TZE A;  1DDK A;  4O98 A;  4V0H A;  1XM8 A;  2VW8 A;  5ACX A;  1YCH A;  2BFZ A;  2GKL A;  2P18 A;  3PG4 A;  2FHX A;  4GCW A;  2R2D A;  5HH4 A;  4GYQ A;  5HIS A;  2NZE A;  2QIN A;  4EFZ A;  2NYP A;  2BG7 A;  5LM6 A;  5EVD A;  2CBN A;  4EYB A;  1WUO A;  1BMC A;  4ZNB A;  3ADR A;  5AJL A;  4ZO2 A;  5HH6 A;  4DIK A;  2WHG A;  4D1T A;  2YNT B;  1HLK A;  4YSB A;  2ZO4 A;  5ACS A;  3DHA A;  4Z5Z A;  5AYA A;  1QH3 A;  2DOO A;  5ACT A;  3LVZ A;  4UWO B;  4GYU A;  1K07 A;  4J5H A;  3BC2 A;  3DH8 A;  3ZNB A;  1X8H A;  3VPE A;  2DKF A;  2WYL A;  3KL7 A;  2BFL A;  4PVO A;  4NQ2 A;  1VME A;  3T3O A;  3IE2 A;  3I13 A;  4HL1 A;  2YCB A;  3ZR9 A;  4UWS B;  2YNV B;  4AV7 A;  4CHL A;  2H6A A;  3P2U A;  2YHE A;  3FAI A;  2OHH A;  2AIO A;  1P9E A;  3SW3 A;  2OHJ A;  2YZ3 A;  4PDX A;  4C1C A;  4AX0 B;  2YNV A;  5ACV A;  4XUK A;  3X2X A;  4RBS A;  1KO2 A;  2NZF A;  2QDS A;  4B87 A;  4H0D A;  5FQA A;  5AIJ A;  4F6Z A;  3RKJ A;  1JT1 A;  2FU9 A;  1A7T A;  2P1E A;  5ACW A;  4FR7 A;  5EVK A;  2FHX B;  1WUP A;  2P97 A;  5LMC A;  2FK6 A;  4AXH A;  4FSB A;  3L6N A;  4Z5Y A;  5EVB A;  5EWA A;  1JJE A;  3F9O A;  1X8G A;  2OHI A;  5AHO A;  4DIL A;  4C1F A;  4F6H A;  2YNW A;  3AJ3 A;  2I7X A;  5HIP A;  2QJS A;  3I11 A;  2AZ4 A;  2BMI A;  2CFU A;  2P4Z A;  3SPU A;  1DD6 A;  3R2U A;  1XTO A;  5HIO A;  4LE6 A;  4TZF A;  2GCU A;  2BC2 A;  3IEM A;  4UWR B;  4BZ3 A;  3SFP A;  4JO0 A;  3DHB A;  5K4N A;  5HIQ A;  5ACU A;  5AEB A;  3QH8 A;  2QDT A;  3IDZ A;  3BV6 A;  5B1U A;  3IOF A;  4C1D A;  4HKY A;  4ZO3 A;  2HB9 A;  2ZWR A;  1VJN A;  4BP0 A;  5A87 A;  4D1V A;  3AF6 A;  5EH9 A;  5ACP A;  1L9Y A;  2Q0I A;  2BG8 A;  2BFK A;  4NQ6 A;  1ZTC A;  5A0V A;  4WD6 A;  4EXS A;  3A4Y A;  4C1E A;  3BK2 A;  3KNS A;  4P62 A;  3IE1 A;  2BIB A;  5DPX A;  1ZKP A;  2CG3 A;  3X30 A;  2Y8A A;  5KIK A;  4EY2 A;  4TYT A;  1X8I A;  3DHC A;  5EV8 A;  3RKK A;  4AX1 B;  5LCH A;  3JXP A;  1JJT A;  5A23 A;  3KNR A;  1BVT A;  2CG2 A;  4PVT A;  5B15 A; 
#chains in the Genus database with same CATH homology
 2GMN A;  3IEK A;  3AF5 A;  4FEK A;  1VGN A;  2XF4 A;  4C1G A;  3RPC A;  1QH5 A;  1MQO A;  4RM5 A;  2Q9U A;  5LSC A;  5LLD A;  1Y44 A;  2YNU A;  1M2X A;  3X2Z A;  5B3R A;  2UYX A;  3ZQ4 A;  2I7T A;  4D02 A;  3I0V A;  4AD9 A;  5EV6 A;  5LCF A;  5AXO A;  2BG6 A;  3S0Z A;  1SML A;  3G1P A;  3I14 A;  5FQC A;  4TYF A;  1WRA A;  1YCF A;  3Q6V A;  4UBQ A;  4YSK A;  2Q0J A;  2FU7 A;  2I7V A;  4C09 A;  4HL2 A;  4D1U A;  2QED A;  4TZB A;  2ZZI A;  5LE1 A;  5K4K A;  1E5D A;  3IE0 A;  2BGA A;  5HH5 A;  2BR6 A;  5AXR A;  5ACQ A;  2BG8 B;  4ZEJ A;  4RAM A;  3T3N A;  3H3E A;  4RL2 A;  2XR1 A;  3FCZ A;  4Z67 A;  5FQB A;  5K0W A;  5KIL A;  3PY6 A;  4YSL A;  3X2Y A;  5EW0 A;  4D1W A;  2FU8 A;  1ZNB A;  4RL0 A;  5IQK A;  5K4M A;  2YNT A;  4Z7R A;  2ZNB A;  2GFK A;  2A7M A;  3SD9 A;  4XWT A;  2Y87 A;  4EYF A;  4KEQ A;  4Z6X A;  3I15 A;  4EYL A;  4C1H A;  1KO3 A;  3T9M A;  4TZ9 A;  3SBL A;  4NQ5 A;  2M5C A;  1A8T A;  3VQZ A;  4NQ4 A;  3IEL A;  4AWY B;  4UWP B;  1BC2 A;  3TP9 A;  5LS3 A;  2NXA A;  2WYM A;  3BK1 A;  3MD7 A;  2WYM C;  2GFJ A;  3IOG A;  4J5F A;  4KEP A;  4RAW A;  3PY5 A;  4AWZ A;  2Y8B A;  5AHR A;  5EHT A;  3ZWF A;  2BG2 A;  4UA4 A;  1YCG A;  2FM6 A;  2FU6 A;  3SRX A;  3WXC A;  5A5Z A;  1DXK A;  5ACR A;  5A0T A;  1WW1 A;  4UAM A;  4Z60 A;  2BTN A;  2M5D A;  5LCA A;  2BFZ B;  2Q42 A;  2WRS A;  4U4L A;  4EXY A;  2E7Y A;  4XWW A;  3ESH A;  1KR3 A;  4TZE A;  1DDK A;  4O98 A;  4V0H A;  1XM8 A;  2VW8 A;  5ACX A;  1YCH A;  2BFZ A;  2GKL A;  2P18 A;  3PG4 A;  2FHX A;  4GCW A;  2R2D A;  5HH4 A;  4GYQ A;  5HIS A;  2NZE A;  2QIN A;  4EFZ A;  2NYP A;  2BG7 A;  5LM6 A;  5EVD A;  2CBN A;  4EYB A;  1WUO A;  1BMC A;  4ZNB A;  3ADR A;  4ZO2 A;  5HH6 A;  4DIK A;  2WHG A;  4D1T A;  2YNT B;  1HLK A;  4YSB A;  2ZO4 A;  5ACS A;  3DHA A;  4Z5Z A;  5AYA A;  1QH3 A;  2DOO A;  5ACT A;  3LVZ A;  4UWO B;  4GYU A;  1K07 A;  4J5H A;  3BC2 A;  3DH8 A;  3ZNB A;  1X8H A;  3VPE A;  2DKF A;  2WYL A;  3KL7 A;  2BFL A;  4PVO A;  4NQ2 A;  1VME A;  3T3O A;  3IE2 A;  3I13 A;  4HL1 A;  2YCB A;  3ZR9 A;  4UWS B;  2YNV B;  4CHL A;  2H6A A;  3P2U A;  3FAI A;  2OHH A;  2AIO A;  1P9E A;  3SW3 A;  2OHJ A;  2YZ3 A;  4C1C A;  4AX0 B;  2YNV A;  5ACV A;  4XUK A;  3X2X A;  4RBS A;  1KO2 A;  2NZF A;  2QDS A;  4B87 A;  4H0D A;  5FQA A;  4F6Z A;  3RKJ A;  1JT1 A;  2FU9 A;  1A7T A;  2P1E A;  5ACW A;  4FR7 A;  5EVK A;  2FHX B;  1WUP A;  2P97 A;  5LMC A;  2FK6 A;  4FSB A;  3L6N A;  4Z5Y A;  5EVB A;  5EWA A;  1JJE A;  3F9O A;  1X8G A;  2OHI A;  5AHO A;  4DIL A;  4C1F A;  4F6H A;  2YNW A;  3AJ3 A;  2I7X A;  5HIP A;  2QJS A;  3I11 A;  2AZ4 A;  2BMI A;  2P4Z A;  3SPU A;  1DD6 A;  3R2U A;  1XTO A;  5HIO A;  4LE6 A;  4TZF A;  2GCU A;  2BC2 A;  3IEM A;  4UWR B;  4BZ3 A;  3SFP A;  4JO0 A;  3DHB A;  5K4N A;  5HIQ A;  5ACU A;  5AEB A;  3QH8 A;  2QDT A;  3IDZ A;  3BV6 A;  5B1U A;  3IOF A;  4C1D A;  4HKY A;  4ZO3 A;  2HB9 A;  2ZWR A;  1VJN A;  4BP0 A;  5A87 A;  4D1V A;  3AF6 A;  5EH9 A;  5ACP A;  1L9Y A;  2Q0I A;  2BG8 A;  2BFK A;  4NQ6 A;  1ZTC A;  5A0V A;  4WD6 A;  4EXS A;  3A4Y A;  4C1E A;  3BK2 A;  3KNS A;  4P62 A;  3IE1 A;  2BIB A;  5DPX A;  1ZKP A;  3X30 A;  2Y8A A;  5KIK A;  4EY2 A;  4TYT A;  1X8I A;  3DHC A;  5EV8 A;  3RKK A;  4AX1 B;  5LCH A;  3JXP A;  1JJT A;  3KNR A;  1BVT A;  4PVT A;  5B15 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...