4C1GA

Crystal structure of the metallo-beta-lactamase imp-1 with d-captopril
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
219
structure length
219
Chain Sequence
b'SLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE IMP-1
molecule tags Hydrolase
source organism Serratia marcescens
publication title Structural Basis of Metallo-beta-Lactamase Inhibition by Captopril Stereoisomers.
pubmed doi rcsb
total genus 69
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4c1gA00
2FU7A 2E7YA 4HL1A 4UA4A 5KILA 2M5CA 5FQAA 2DOOA 1JJTA 2Y8BA 4C1DA 4JO0A 4TYFA 2YNUA 2NZEA 4BZ3A 4ZO3A 3BK2A 4C09A 4EYLA 2FHXA 4FSBA 4GYUA 2NYPA 3ZR9A 2NZFA 4RL2A 3X2ZA 2FU6A 4RAWA 4Z5ZA 3DHCA 4D1VA 2BR6A 2P97A 2WRSA 2BG8A 5EW0A 2QINA 5ACWA 5ACQA 4J5FA 4RBSA 4GYQA 3DH8A 3PG4A 3ADRA 5HH5A 2DKFA 5ACSA 5IQKA 3I14A 4XUKA 4EYFA 4RAMA 3JXPA 1VMEA 2BC2A 4V0HA 3IEMA 5ACRA 1HLKA 4LE6A 5AYAA 1X8IA 3ZNBA 4UBQA 3X2YA 1SMLA 5EV6A 5AHRA 5LSCA 3FCZA 2QDSA 2GFJA 1A8TA 2HB9A 2YCBA 1WUOA 3IEKA 2BFZB 1DD6A 2GFKA 2QDTA 2WHGA 4FEKA 5B3RA 4Z7RA 3IOGA 1ZTCA 2Q0JA 1BC2A 2QJSA 3IE1A 5FQCA 4PVTA 3F9OA 4NQ6A 3X30A 5K0WA 4D1WA 2ZNBA 5A87A 3BV6A 4O98A 4DIKA 4TZEA 2BG2A 4Z67A 4HL2A 2BFLA 2WYMA 2ZZIA 2BIBA 3SPUA 4Z60A 5A0TA 1KO2A 4XWTA 4D1TA 3VPEA 3T3NA 2YZ3A 1JJEA 5K4KA 5LS3A 2XF4A 2GCUA 1P9EA 4EY2A 2CBNA 2Q42A 4TYTA 5AXOA 3S0ZA 4EXSA 1VGNA 2BG7A 4ZNBA 3RKKA 2YNTB 5EH9A 2FU8A 4U4LA 4AWZA 5KIKA 5A0VA 2YNVB 1WUPA 3R2UA 3MD7A 3DHAA 4Z6XA 3P2UA 5LCAA 5B1UA 3ESHA 3H3EA 5EV8A 3X2XA 5EVKA 4KEQA 2OHJA 3IE2A 3IE0A 3SW3A 1ZKPA 1BMCA 2YNWA 2AZ4A 1XM8A 5HIOA 3SRXA 3KL7A 5AHOA 2BTNA 5HH4A 5LCFA 4UWSB 3FAIA 2BMIA 4KEPA 2BFKA 3I11A 4XWWA 3LVZA 3RPCA 4DILA 2P1EA 5ACUA 3SD9A 2QEDA 2FK6A 1ZNBA 5LMCA 4EXYA 5B15A 2FU9A 4EYBA 1MQOA 3AF6A 3BC2A 3ZQ4A 5AXRA 2A7MA 5HISA 2WYLA 2M5DA 4GCWA 4PVOA 4B87A 1A7TA 3I15A 3VQZA 1YCFA 4BP0A 2XR1A 3PY5A 2Y8AA 5LM6A 3SBLA 4D02A 1QH5A 3ZWFA 4UWPB 3AF5A 3KNRA 3WXCA 5AEBA 2UYXA 1M2XA 1QH3A 2GMNA 2VW8A 4NQ2A 2Q0IA 5LCHA 1X8GA 2GKLA 2WYMC 4P62A 5EVDA 3QH8A 2ZWRA 1X8HA 2YNTA 2BG6A 5ACTA 2BGAA 5HIQA 4YSLA 4WD6A 2FHXB 2BG8B 3IDZA 3TP9A 3SFPA 2AIOA 4AD9A 1KO3A 4RL0A 1L9YA 5HIPA 4Z5YA 1WRAA 5LLDA 2NXAA 3PY6A 4C1CA 2P18A 4CHLA 2Y87A 2P4ZA 5EHTA 3Q6VA 4UWOB 4AX0B 5DPXA 5EWAA 4ZEJA 2OHIA 4D1UA 2Q9UA 5K4MA 3AJ3A 3IELA 3T9MA 1JT1A 3IOFA 2FM6A 3L6NA 1Y44A 2H6AA 1YCGA 4TZ9A 5ACPA 4J5HA 4YSKA 5FQBA 5ACXA 4C1GA 2BFZA 2YNVA 4F6HA 1YCHA 4NQ4A 4AWYB 4ZO2A 1VJNA 1DXKA 1XTOA 4YSBA 1BVTA 4TZFA 3G1PA 4UWRB 4UAMA 1E5DA 4C1EA 2ZO4A 3BK1A 4C1FA 4EFZA 4FR7A 3T3OA 3RKJA 5ACVA 3A4YA 5LE1A 5A5ZA 2I7TA 2I7XA 3KNSA 4F6ZA 3I13A 3I0VA 5EVBA 2R2DA 4HKYA 1K07A 2I7VA 3DHBA 4RM5A 5HH6A 1KR3A 1WW1A 1DDKA 4AX1B 4H0DA 2OHHA 4TZBA 4NQ5A 5K4NA 4C1HA
chains in the Genus database with same CATH superfamily
2FU7A 2E7YA 4HL1A 4UA4A 5KILA 2M5CA 5FQAA 2DOOA 1JJTA 2Y8BA 4C1DA 5AIJA 4JO0A 4AV7A 4TYFA 2YNUA 2NZEA 4BZ3A 4ZO3A 3BK2A 4C09A 4EYLA 2FHXA 4FSBA 4GYUA 2NYPA 3ZR9A 2NZFA 4RL2A 3X2ZA 2FU6A 4RAWA 4Z5ZA 3DHCA 4D1VA 2BR6A 2P97A 2CG2A 2WRSA 2BG8A 5EW0A 2QINA 5ACWA 5ACQA 4J5FA 4RBSA 4GYQA 3DH8A 3PG4A 3ADRA 5HH5A 2DKFA 5ACSA 5IQKA 3I14A 4XUKA 4EYFA 4RAMA 3JXPA 1VMEA 2BC2A 4V0HA 3IEMA 5ACRA 1HLKA 4LE6A 5AYAA 1X8IA 3ZNBA 4UBQA 3X2YA 1SMLA 5EV6A 5AHRA 5LSCA 3FCZA 2QDSA 2GFJA 1A8TA 2HB9A 2CFUA 2YCBA 1WUOA 3IEKA 2BFZB 1DD6A 2GFKA 2QDTA 2WHGA 4FEKA 5B3RA 4Z7RA 3IOGA 1ZTCA 2Q0JA 1BC2A 2QJSA 3IE1A 5FQCA 4PVTA 3F9OA 4NQ6A 3X30A 5K0WA 4D1WA 2ZNBA 5A87A 3BV6A 4O98A 4DIKA 4TZEA 2BG2A 4Z67A 4HL2A 2BFLA 2WYMA 2ZZIA 2BIBA 3SPUA 4Z60A 5A0TA 1KO2A 4XWTA 4D1TA 3VPEA 3T3NA 2YZ3A 1JJEA 5K4KA 5LS3A 2XF4A 2GCUA 1P9EA 5A23A 4EY2A 2CBNA 2Q42A 4TYTA 5AXOA 3S0ZA 4EXSA 1VGNA 2BG7A 4ZNBA 3RKKA 2YNTB 5EH9A 2FU8A 4U4LA 4AWZA 5KIKA 5A0VA 2YNVB 1WUPA 3R2UA 3MD7A 3DHAA 4Z6XA 3P2UA 5LCAA 5B1UA 3ESHA 3H3EA 5EV8A 3X2XA 5EVKA 4KEQA 2OHJA 3IE2A 3IE0A 3SW3A 1ZKPA 1BMCA 2YNWA 2AZ4A 1XM8A 5HIOA 3SRXA 2CFZA 3KL7A 5AHOA 2BTNA 5HH4A 5LCFA 4UWSB 3FAIA 2BMIA 4KEPA 2BFKA 3I11A 4XWWA 3LVZA 3RPCA 4DILA 2P1EA 5ACUA 3SD9A 2QEDA 2FK6A 1ZNBA 5LMCA 4EXYA 5B15A 2FU9A 4EYBA 1MQOA 3AF6A 3BC2A 3ZQ4A 5AXRA 2A7MA 5HISA 2WYLA 2M5DA 4GCWA 4NURA 4PVOA 4B87A 1A7TA 3I15A 3VQZA 1YCFA 4BP0A 2XR1A 3PY5A 2Y8AA 5LM6A 3SBLA 2YHEA 4D02A 1QH5A 3ZWFA 4AXHA 4UWPB 3AF5A 3KNRA 3WXCA 5AEBA 2UYXA 1M2XA 1QH3A 2GMNA 2VW8A 4NQ2A 2Q0IA 5LCHA 1X8GA 2GKLA 2WYMC 4P62A 5EVDA 3QH8A 2ZWRA 1X8HA 2YNTA 2BG6A 5ACTA 2BGAA 5HIQA 4YSLA 4WD6A 2FHXB 2BG8B 3IDZA 3TP9A 3SFPA 2AIOA 4AD9A 1KO3A 4RL0A 1L9YA 5HIPA 4Z5YA 1WRAA 5LLDA 2NXAA 3PY6A 4C1CA 2P18A 4CHLA 2Y87A 2P4ZA 5EHTA 3Q6VA 4UWOB 4AX0B 5DPXA 5EWAA 4ZEJA 2OHIA 4D1UA 2Q9UA 5K4MA 3AJ3A 3IELA 3T9MA 1JT1A 3IOFA 2FM6A 3L6NA 1Y44A 2H6AA 1YCGA 4TZ9A 5ACPA 4J5HA 4YSKA 5FQBA 5ACXA 4C1GA 2BFZA 2CG3A 2YNVA 4F6HA 1YCHA 4NQ4A 4AWYB 4ZO2A 1VJNA 1DXKA 1XTOA 4YSBA 1BVTA 4TZFA 3G1PA 4UWRB 4UAMA 1E5DA 4C1EA 2ZO4A 3BK1A 4C1FA 4EFZA 4FR7A 3T3OA 3RKJA 5ACVA 5AJLA 3A4YA 5LE1A 5A5ZA 2I7TA 2I7XA 3KNSA 4F6ZA 3I13A 3I0VA 5EVBA 2R2DA 4HKYA 1K07A 2I7VA 4PDXA 3DHBA 4RM5A 5HH6A 1KR3A 1WW1A 1DDKA 4AX1B 4H0DA 2OHHA 4TZBA 4NQ5A 5K4NA 4C1HA
chains in the Genus database with same CATH topology
2FU7A 2E7YA 4HL1A 4UA4A 5KILA 2M5CA 5FQAA 2DOOA 1JJTA 2Y8BA 4C1DA 4JO0A 4TYFA 2YNUA 2NZEA 4BZ3A 4ZO3A 3BK2A 4C09A 4EYLA 2FHXA 4FSBA 4GYUA 2NYPA 3ZR9A 2NZFA 4RL2A 3X2ZA 2FU6A 4RAWA 4Z5ZA 3DHCA 4D1VA 2BR6A 2P97A 2WRSA 2BG8A 5EW0A 2QINA 5ACWA 5ACQA 4J5FA 4RBSA 4GYQA 3DH8A 3PG4A 3ADRA 5HH5A 2DKFA 5ACSA 5IQKA 3I14A 4XUKA 4EYFA 4RAMA 3JXPA 1VMEA 2BC2A 4V0HA 3IEMA 5ACRA 1HLKA 4LE6A 5AYAA 1X8IA 3ZNBA 4UBQA 3X2YA 1SMLA 5EV6A 5AHRA 5LSCA 3FCZA 2QDSA 2GFJA 1A8TA 2HB9A 2YCBA 1WUOA 3IEKA 2BFZB 1DD6A 2GFKA 2QDTA 2WHGA 4FEKA 5B3RA 4Z7RA 3IOGA 1ZTCA 2Q0JA 1BC2A 2QJSA 3IE1A 5FQCA 4PVTA 3F9OA 4NQ6A 3X30A 5K0WA 4D1WA 2ZNBA 5A87A 3BV6A 4O98A 4DIKA 4TZEA 2BG2A 4Z67A 4HL2A 2BFLA 2WYMA 2ZZIA 2BIBA 3SPUA 4Z60A 5A0TA 1KO2A 4XWTA 4D1TA 3VPEA 3T3NA 2YZ3A 1JJEA 5K4KA 5LS3A 2XF4A 2GCUA 1P9EA 4EY2A 2CBNA 2Q42A 4TYTA 5AXOA 3S0ZA 4EXSA 1VGNA 2BG7A 4ZNBA 3RKKA 2YNTB 5EH9A 2FU8A 4U4LA 4AWZA 5KIKA 5A0VA 2YNVB 1WUPA 3R2UA 3MD7A 3DHAA 4Z6XA 3P2UA 5LCAA 5B1UA 3ESHA 3H3EA 5EV8A 3X2XA 5EVKA 4KEQA 2OHJA 3IE2A 3IE0A 3SW3A 1ZKPA 1BMCA 2YNWA 2AZ4A 1XM8A 5HIOA 3SRXA 3KL7A 5AHOA 2BTNA 5HH4A 5LCFA 4UWSB 3FAIA 2BMIA 4KEPA 2BFKA 3I11A 4XWWA 3LVZA 3RPCA 4DILA 2P1EA 5ACUA 3SD9A 2QEDA 2FK6A 1ZNBA 5LMCA 4EXYA 5B15A 2FU9A 4EYBA 1MQOA 3AF6A 3BC2A 3ZQ4A 5AXRA 2A7MA 5HISA 2WYLA 2M5DA 4GCWA 4PVOA 4B87A 1A7TA 3I15A 3VQZA 1YCFA 4BP0A 2XR1A 3PY5A 2Y8AA 5LM6A 3SBLA 4D02A 1QH5A 3ZWFA 4UWPB 3AF5A 3KNRA 3WXCA 5AEBA 2UYXA 1M2XA 1QH3A 2GMNA 2VW8A 4NQ2A 2Q0IA 5LCHA 1X8GA 2GKLA 2WYMC 4P62A 5EVDA 3QH8A 2ZWRA 1X8HA 2YNTA 2BG6A 5ACTA 2BGAA 5HIQA 4YSLA 4WD6A 2FHXB 2BG8B 3IDZA 3TP9A 3SFPA 2AIOA 4AD9A 1KO3A 4RL0A 1L9YA 5HIPA 4Z5YA 1WRAA 5LLDA 2NXAA 3PY6A 4C1CA 2P18A 4CHLA 2Y87A 2P4ZA 5EHTA 3Q6VA 4UWOB 4AX0B 5DPXA 5EWAA 4ZEJA 2OHIA 4D1UA 2Q9UA 5K4MA 3AJ3A 3IELA 3T9MA 1JT1A 3IOFA 2FM6A 3L6NA 1Y44A 2H6AA 1YCGA 4TZ9A 5ACPA 4J5HA 4YSKA 5FQBA 5ACXA 4C1GA 2BFZA 2YNVA 4F6HA 1YCHA 4NQ4A 4AWYB 4ZO2A 1VJNA 1DXKA 1XTOA 4YSBA 1BVTA 4TZFA 3G1PA 4UWRB 4UAMA 1E5DA 4C1EA 2ZO4A 3BK1A 4C1FA 4EFZA 4FR7A 3T3OA 3RKJA 5ACVA 3A4YA 5LE1A 5A5ZA 2I7TA 2I7XA 3KNSA 4F6ZA 3I13A 3I0VA 5EVBA 2R2DA 4HKYA 1K07A 2I7VA 3DHBA 4RM5A 5HH6A 1KR3A 1WW1A 1DDKA 4AX1B 4H0DA 2OHHA 4TZBA 4NQ5A 5K4NA 4C1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FU7 A;  2E7Y A;  4HL1 A;  4UA4 A;  5KIL A;  2M5C A;  5FQA A;  2DOO A;  1JJT A;  2Y8B A;  4C1D A;  4JO0 A;  4TYF A;  2YNU A;  2NZE A;  4BZ3 A;  4ZO3 A;  3BK2 A;  4C09 A;  4EYL A;  2FHX A;  4FSB A;  4GYU A;  2NYP A;  3ZR9 A;  2NZF A;  4RL2 A;  3X2Z A;  2FU6 A;  4RAW A;  4Z5Z A;  3DHC A;  4D1V A;  2BR6 A;  2P97 A;  2WRS A;  2BG8 A;  5EW0 A;  2QIN A;  5ACW A;  5ACQ A;  4J5F A;  4RBS A;  4GYQ A;  3DH8 A;  3PG4 A;  3ADR A;  5HH5 A;  2DKF A;  5ACS A;  5IQK A;  3I14 A;  4XUK A;  4EYF A;  4RAM A;  3JXP A;  1VME A;  2BC2 A;  4V0H A;  3IEM A;  5ACR A;  1HLK A;  4LE6 A;  5AYA A;  1X8I A;  3ZNB A;  4UBQ A;  3X2Y A;  1SML A;  5EV6 A;  5AHR A;  5LSC A;  3FCZ A;  2QDS A;  2GFJ A;  1A8T A;  2HB9 A;  2YCB A;  1WUO A;  3IEK A;  2BFZ B;  1DD6 A;  2GFK A;  2QDT A;  2WHG A;  4FEK A;  5B3R A;  4Z7R A;  3IOG A;  1ZTC A;  2Q0J A;  1BC2 A;  2QJS A;  3IE1 A;  5FQC A;  4PVT A;  3F9O A;  4NQ6 A;  3X30 A;  5K0W A;  4D1W A;  2ZNB A;  5A87 A;  3BV6 A;  4O98 A;  4DIK A;  4TZE A;  2BG2 A;  4Z67 A;  4HL2 A;  2BFL A;  2WYM A;  2ZZI A;  2BIB A;  3SPU A;  4Z60 A;  5A0T A;  1KO2 A;  4XWT A;  4D1T A;  3VPE A;  3T3N A;  2YZ3 A;  1JJE A;  5K4K A;  5LS3 A;  2XF4 A;  2GCU A;  1P9E A;  4EY2 A;  2CBN A;  2Q42 A;  4TYT A;  5AXO A;  3S0Z A;  4EXS A;  1VGN A;  2BG7 A;  4ZNB A;  3RKK A;  2YNT B;  5EH9 A;  2FU8 A;  4U4L A;  4AWZ A;  5KIK A;  5A0V A;  2YNV B;  1WUP A;  3R2U A;  3MD7 A;  3DHA A;  4Z6X A;  3P2U A;  5LCA A;  5B1U A;  3ESH A;  3H3E A;  5EV8 A;  3X2X A;  5EVK A;  4KEQ A;  2OHJ A;  3IE2 A;  3IE0 A;  3SW3 A;  1ZKP A;  1BMC A;  2YNW A;  2AZ4 A;  1XM8 A;  5HIO A;  3SRX A;  3KL7 A;  5AHO A;  2BTN A;  5HH4 A;  5LCF A;  4UWS B;  3FAI A;  2BMI A;  4KEP A;  2BFK A;  3I11 A;  4XWW A;  3LVZ A;  3RPC A;  4DIL A;  2P1E A;  5ACU A;  3SD9 A;  2QED A;  2FK6 A;  1ZNB A;  5LMC A;  4EXY A;  5B15 A;  2FU9 A;  4EYB A;  1MQO A;  3AF6 A;  3BC2 A;  3ZQ4 A;  5AXR A;  2A7M A;  5HIS A;  2WYL A;  2M5D A;  4GCW A;  4PVO A;  4B87 A;  1A7T A;  3I15 A;  3VQZ A;  1YCF A;  4BP0 A;  2XR1 A;  3PY5 A;  2Y8A A;  5LM6 A;  3SBL A;  4D02 A;  1QH5 A;  3ZWF A;  4UWP B;  3AF5 A;  3KNR A;  3WXC A;  5AEB A;  2UYX A;  1M2X A;  1QH3 A;  2GMN A;  2VW8 A;  4NQ2 A;  2Q0I A;  5LCH A;  1X8G A;  2GKL A;  2WYM C;  4P62 A;  5EVD A;  3QH8 A;  2ZWR A;  1X8H A;  2YNT A;  2BG6 A;  5ACT A;  2BGA A;  5HIQ A;  4YSL A;  4WD6 A;  2FHX B;  2BG8 B;  3IDZ A;  3TP9 A;  3SFP A;  2AIO A;  4AD9 A;  1KO3 A;  4RL0 A;  1L9Y A;  5HIP A;  4Z5Y A;  1WRA A;  5LLD A;  2NXA A;  3PY6 A;  4C1C A;  2P18 A;  4CHL A;  2Y87 A;  2P4Z A;  5EHT A;  3Q6V A;  4UWO B;  4AX0 B;  5DPX A;  5EWA A;  4ZEJ A;  2OHI A;  4D1U A;  2Q9U A;  5K4M A;  3AJ3 A;  3IEL A;  3T9M A;  1JT1 A;  3IOF A;  2FM6 A;  3L6N A;  1Y44 A;  2H6A A;  1YCG A;  4TZ9 A;  5ACP A;  4J5H A;  4YSK A;  5FQB A;  5ACX A;  4C1G A;  2BFZ A;  2YNV A;  4F6H A;  1YCH A;  4NQ4 A;  4AWY B;  4ZO2 A;  1VJN A;  1DXK A;  1XTO A;  4YSB A;  1BVT A;  4TZF A;  3G1P A;  4UWR B;  4UAM A;  1E5D A;  4C1E A;  2ZO4 A;  3BK1 A;  4C1F A;  4EFZ A;  4FR7 A;  3T3O A;  3RKJ A;  5ACV A;  3A4Y A;  5LE1 A;  5A5Z A;  2I7T A;  2I7X A;  3KNS A;  4F6Z A;  3I13 A;  3I0V A;  5EVB A;  2R2D A;  4HKY A;  1K07 A;  2I7V A;  3DHB A;  4RM5 A;  5HH6 A;  1KR3 A;  1WW1 A;  1DDK A;  4AX1 B;  4H0D A;  2OHH A;  4TZB A;  4NQ5 A;  5K4N A;  4C1H A; 
#chains in the Genus database with same CATH topology
 2FU7 A;  2E7Y A;  4HL1 A;  4UA4 A;  5KIL A;  2M5C A;  5FQA A;  2DOO A;  1JJT A;  2Y8B A;  4C1D A;  5AIJ A;  4JO0 A;  4AV7 A;  4TYF A;  2YNU A;  2NZE A;  4BZ3 A;  4ZO3 A;  3BK2 A;  4C09 A;  4EYL A;  2FHX A;  4FSB A;  4GYU A;  2NYP A;  3ZR9 A;  2NZF A;  4RL2 A;  3X2Z A;  2FU6 A;  4RAW A;  4Z5Z A;  3DHC A;  4D1V A;  2BR6 A;  2P97 A;  2CG2 A;  2WRS A;  2BG8 A;  5EW0 A;  2QIN A;  5ACW A;  5ACQ A;  4J5F A;  4RBS A;  4GYQ A;  3DH8 A;  3PG4 A;  3ADR A;  5HH5 A;  2DKF A;  5ACS A;  5IQK A;  3I14 A;  4XUK A;  4EYF A;  4RAM A;  3JXP A;  1VME A;  2BC2 A;  4V0H A;  3IEM A;  5ACR A;  1HLK A;  4LE6 A;  5AYA A;  1X8I A;  3ZNB A;  4UBQ A;  3X2Y A;  1SML A;  5EV6 A;  5AHR A;  5LSC A;  3FCZ A;  2QDS A;  2GFJ A;  1A8T A;  2HB9 A;  2CFU A;  2YCB A;  1WUO A;  3IEK A;  2BFZ B;  1DD6 A;  2GFK A;  2QDT A;  2WHG A;  4FEK A;  5B3R A;  4Z7R A;  3IOG A;  1ZTC A;  2Q0J A;  1BC2 A;  2QJS A;  3IE1 A;  5FQC A;  4PVT A;  3F9O A;  4NQ6 A;  3X30 A;  5K0W A;  4D1W A;  2ZNB A;  5A87 A;  3BV6 A;  4O98 A;  4DIK A;  4TZE A;  2BG2 A;  4Z67 A;  4HL2 A;  2BFL A;  2WYM A;  2ZZI A;  2BIB A;  3SPU A;  4Z60 A;  5A0T A;  1KO2 A;  4XWT A;  4D1T A;  3VPE A;  3T3N A;  2YZ3 A;  1JJE A;  5K4K A;  5LS3 A;  2XF4 A;  2GCU A;  1P9E A;  5A23 A;  4EY2 A;  2CBN A;  2Q42 A;  4TYT A;  5AXO A;  3S0Z A;  4EXS A;  1VGN A;  2BG7 A;  4ZNB A;  3RKK A;  2YNT B;  5EH9 A;  2FU8 A;  4U4L A;  4AWZ A;  5KIK A;  5A0V A;  2YNV B;  1WUP A;  3R2U A;  3MD7 A;  3DHA A;  4Z6X A;  3P2U A;  5LCA A;  5B1U A;  3ESH A;  3H3E A;  5EV8 A;  3X2X A;  5EVK A;  4KEQ A;  2OHJ A;  3IE2 A;  3IE0 A;  3SW3 A;  1ZKP A;  1BMC A;  2YNW A;  2AZ4 A;  1XM8 A;  5HIO A;  3SRX A;  2CFZ A;  3KL7 A;  5AHO A;  2BTN A;  5HH4 A;  5LCF A;  4UWS B;  3FAI A;  2BMI A;  4KEP A;  2BFK A;  3I11 A;  4XWW A;  3LVZ A;  3RPC A;  4DIL A;  2P1E A;  5ACU A;  3SD9 A;  2QED A;  2FK6 A;  1ZNB A;  5LMC A;  4EXY A;  5B15 A;  2FU9 A;  4EYB A;  1MQO A;  3AF6 A;  3BC2 A;  3ZQ4 A;  5AXR A;  2A7M A;  5HIS A;  2WYL A;  2M5D A;  4GCW A;  4NUR A;  4PVO A;  4B87 A;  1A7T A;  3I15 A;  3VQZ A;  1YCF A;  4BP0 A;  2XR1 A;  3PY5 A;  2Y8A A;  5LM6 A;  3SBL A;  2YHE A;  4D02 A;  1QH5 A;  3ZWF A;  4AXH A;  4UWP B;  3AF5 A;  3KNR A;  3WXC A;  5AEB A;  2UYX A;  1M2X A;  1QH3 A;  2GMN A;  2VW8 A;  4NQ2 A;  2Q0I A;  5LCH A;  1X8G A;  2GKL A;  2WYM C;  4P62 A;  5EVD A;  3QH8 A;  2ZWR A;  1X8H A;  2YNT A;  2BG6 A;  5ACT A;  2BGA A;  5HIQ A;  4YSL A;  4WD6 A;  2FHX B;  2BG8 B;  3IDZ A;  3TP9 A;  3SFP A;  2AIO A;  4AD9 A;  1KO3 A;  4RL0 A;  1L9Y A;  5HIP A;  4Z5Y A;  1WRA A;  5LLD A;  2NXA A;  3PY6 A;  4C1C A;  2P18 A;  4CHL A;  2Y87 A;  2P4Z A;  5EHT A;  3Q6V A;  4UWO B;  4AX0 B;  5DPX A;  5EWA A;  4ZEJ A;  2OHI A;  4D1U A;  2Q9U A;  5K4M A;  3AJ3 A;  3IEL A;  3T9M A;  1JT1 A;  3IOF A;  2FM6 A;  3L6N A;  1Y44 A;  2H6A A;  1YCG A;  4TZ9 A;  5ACP A;  4J5H A;  4YSK A;  5FQB A;  5ACX A;  4C1G A;  2BFZ A;  2CG3 A;  2YNV A;  4F6H A;  1YCH A;  4NQ4 A;  4AWY B;  4ZO2 A;  1VJN A;  1DXK A;  1XTO A;  4YSB A;  1BVT A;  4TZF A;  3G1P A;  4UWR B;  4UAM A;  1E5D A;  4C1E A;  2ZO4 A;  3BK1 A;  4C1F A;  4EFZ A;  4FR7 A;  3T3O A;  3RKJ A;  5ACV A;  5AJL A;  3A4Y A;  5LE1 A;  5A5Z A;  2I7T A;  2I7X A;  3KNS A;  4F6Z A;  3I13 A;  3I0V A;  5EVB A;  2R2D A;  4HKY A;  1K07 A;  2I7V A;  4PDX A;  3DHB A;  4RM5 A;  5HH6 A;  1KR3 A;  1WW1 A;  1DDK A;  4AX1 B;  4H0D A;  2OHH A;  4TZB A;  4NQ5 A;  5K4N A;  4C1H A; 
#chains in the Genus database with same CATH homology
 2FU7 A;  2E7Y A;  4HL1 A;  4UA4 A;  5KIL A;  2M5C A;  5FQA A;  2DOO A;  1JJT A;  2Y8B A;  4C1D A;  4JO0 A;  4TYF A;  2YNU A;  2NZE A;  4BZ3 A;  4ZO3 A;  3BK2 A;  4C09 A;  4EYL A;  2FHX A;  4FSB A;  4GYU A;  2NYP A;  3ZR9 A;  2NZF A;  4RL2 A;  3X2Z A;  2FU6 A;  4RAW A;  4Z5Z A;  3DHC A;  4D1V A;  2BR6 A;  2P97 A;  2WRS A;  2BG8 A;  5EW0 A;  2QIN A;  5ACW A;  5ACQ A;  4J5F A;  4RBS A;  4GYQ A;  3DH8 A;  3PG4 A;  3ADR A;  5HH5 A;  2DKF A;  5ACS A;  5IQK A;  3I14 A;  4XUK A;  4EYF A;  4RAM A;  3JXP A;  1VME A;  2BC2 A;  4V0H A;  3IEM A;  5ACR A;  1HLK A;  4LE6 A;  5AYA A;  1X8I A;  3ZNB A;  4UBQ A;  3X2Y A;  1SML A;  5EV6 A;  5AHR A;  5LSC A;  3FCZ A;  2QDS A;  2GFJ A;  1A8T A;  2HB9 A;  2YCB A;  1WUO A;  3IEK A;  2BFZ B;  1DD6 A;  2GFK A;  2QDT A;  2WHG A;  4FEK A;  5B3R A;  4Z7R A;  3IOG A;  1ZTC A;  2Q0J A;  1BC2 A;  2QJS A;  3IE1 A;  5FQC A;  4PVT A;  3F9O A;  4NQ6 A;  3X30 A;  5K0W A;  4D1W A;  2ZNB A;  5A87 A;  3BV6 A;  4O98 A;  4DIK A;  4TZE A;  2BG2 A;  4Z67 A;  4HL2 A;  2BFL A;  2WYM A;  2ZZI A;  2BIB A;  3SPU A;  4Z60 A;  5A0T A;  1KO2 A;  4XWT A;  4D1T A;  3VPE A;  3T3N A;  2YZ3 A;  1JJE A;  5K4K A;  5LS3 A;  2XF4 A;  2GCU A;  1P9E A;  4EY2 A;  2CBN A;  2Q42 A;  4TYT A;  5AXO A;  3S0Z A;  4EXS A;  1VGN A;  2BG7 A;  4ZNB A;  3RKK A;  2YNT B;  5EH9 A;  2FU8 A;  4U4L A;  4AWZ A;  5KIK A;  5A0V A;  2YNV B;  1WUP A;  3R2U A;  3MD7 A;  3DHA A;  4Z6X A;  3P2U A;  5LCA A;  5B1U A;  3ESH A;  3H3E A;  5EV8 A;  3X2X A;  5EVK A;  4KEQ A;  2OHJ A;  3IE2 A;  3IE0 A;  3SW3 A;  1ZKP A;  1BMC A;  2YNW A;  2AZ4 A;  1XM8 A;  5HIO A;  3SRX A;  3KL7 A;  5AHO A;  2BTN A;  5HH4 A;  5LCF A;  4UWS B;  3FAI A;  2BMI A;  4KEP A;  2BFK A;  3I11 A;  4XWW A;  3LVZ A;  3RPC A;  4DIL A;  2P1E A;  5ACU A;  3SD9 A;  2QED A;  2FK6 A;  1ZNB A;  5LMC A;  4EXY A;  5B15 A;  2FU9 A;  4EYB A;  1MQO A;  3AF6 A;  3BC2 A;  3ZQ4 A;  5AXR A;  2A7M A;  5HIS A;  2WYL A;  2M5D A;  4GCW A;  4PVO A;  4B87 A;  1A7T A;  3I15 A;  3VQZ A;  1YCF A;  4BP0 A;  2XR1 A;  3PY5 A;  2Y8A A;  5LM6 A;  3SBL A;  4D02 A;  1QH5 A;  3ZWF A;  4UWP B;  3AF5 A;  3KNR A;  3WXC A;  5AEB A;  2UYX A;  1M2X A;  1QH3 A;  2GMN A;  2VW8 A;  4NQ2 A;  2Q0I A;  5LCH A;  1X8G A;  2GKL A;  2WYM C;  4P62 A;  5EVD A;  3QH8 A;  2ZWR A;  1X8H A;  2YNT A;  2BG6 A;  5ACT A;  2BGA A;  5HIQ A;  4YSL A;  4WD6 A;  2FHX B;  2BG8 B;  3IDZ A;  3TP9 A;  3SFP A;  2AIO A;  4AD9 A;  1KO3 A;  4RL0 A;  1L9Y A;  5HIP A;  4Z5Y A;  1WRA A;  5LLD A;  2NXA A;  3PY6 A;  4C1C A;  2P18 A;  4CHL A;  2Y87 A;  2P4Z A;  5EHT A;  3Q6V A;  4UWO B;  4AX0 B;  5DPX A;  5EWA A;  4ZEJ A;  2OHI A;  4D1U A;  2Q9U A;  5K4M A;  3AJ3 A;  3IEL A;  3T9M A;  1JT1 A;  3IOF A;  2FM6 A;  3L6N A;  1Y44 A;  2H6A A;  1YCG A;  4TZ9 A;  5ACP A;  4J5H A;  4YSK A;  5FQB A;  5ACX A;  4C1G A;  2BFZ A;  2YNV A;  4F6H A;  1YCH A;  4NQ4 A;  4AWY B;  4ZO2 A;  1VJN A;  1DXK A;  1XTO A;  4YSB A;  1BVT A;  4TZF A;  3G1P A;  4UWR B;  4UAM A;  1E5D A;  4C1E A;  2ZO4 A;  3BK1 A;  4C1F A;  4EFZ A;  4FR7 A;  3T3O A;  3RKJ A;  5ACV A;  3A4Y A;  5LE1 A;  5A5Z A;  2I7T A;  2I7X A;  3KNS A;  4F6Z A;  3I13 A;  3I0V A;  5EVB A;  2R2D A;  4HKY A;  1K07 A;  2I7V A;  3DHB A;  4RM5 A;  5HH6 A;  1KR3 A;  1WW1 A;  1DDK A;  4AX1 B;  4H0D A;  2OHH A;  4TZB A;  4NQ5 A;  5K4N A;  4C1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...