4C1GA

Crystal structure of the metallo-beta-lactamase imp-1 with d-captopril
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
219
structure length
219
Chain Sequence
SLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Metallo-beta-Lactamase Inhibition by Captopril Stereoisomers.
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE IMP-1
total genus 69
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4c1gA00
3KNSA 4AD9A 2BTNA 2DKFA 2QJSA 1DXKA 2YNUA 5LSCA 3MD7A 5EWAA 2NYPA 4TZFA 2FM6A 4UA4A 3Q6VA 1XTOA 4HL1A 2R2DA 5AEBA 3S0ZA 4F6HA 2AIOA 2FHXA 5DPXA 1A8TA 4HKYA 5EVKA 4Z5YA 4EYLA 2HB9A 2DOOA 1ZKPA 3ZNBA 3IOFA 2WHGA 3SFPA 4UAMA 2I7TA 4Z67A 5ACUA 4FEKA 3A4YA 1X8HA 4RBSA 3ESHA 4EXSA 1JT1A 2BG8A 2UYXA 1WRAA 3RKJA 2YCBA 4AWZA 4FR7A 2QEDA 4HL2A 2FHXB 4C1EA 2BG2A 5EV6A 5K4NA 3I0VA 4D02A 5LCHA 3T3NA 3IEKA 3ZQ4A 2Q0JA 5KILA 4RL0A 2QINA 4EYFA 2NXAA 3I15A 5EHTA 5FQCA 3X2ZA 5LLDA 5K4MA 2GMNA 3I13A 4NQ5A 5AHOA 4RAWA 3QH8A 4C1CA 3IDZA 2BMIA 3IE0A 4XUKA 4YSKA 2WYLA 1WW1A 4D1WA 2Q0IA 4EFZA 2FK6A 1MQOA 4Z5ZA 5ACQA 2OHIA 3G1PA 3H3EA 3X30A 5ACSA 1L9YA 3BK1A 3I14A 5HH6A 4C1FA 2WYMA 5AXRA 2WYMC 5LCFA 2NZFA 1BC2A 3SW3A 2ZO4A 2BG6A 3SRXA 1E5DA 2BC2A 4GYQA 1DD6A 4J5FA 3P2UA 3F9OA 2BIBA 2YZ3A 2Q42A 2CBNA 1BVTA 1QH5A 2NZEA 4CHLA 1YCGA 3ZR9A 3KNRA 5A87A 4KEQA 4NQ2A 4U4LA 5HH4A 5ACPA 1HLKA 4NQ4A 3X2YA 1XM8A 3R2UA 4UWRB 4RM5A 4TYFA 2Q9UA 5HIQA 5LCAA 4C09A 4TZEA 3VPEA 5HISA 4YSBA 4O98A 1JJTA 2BFZB 2ZNBA 2VW8A 4H0DA 4UWPB 1SMLA 2M5CA 3RPCA 4RAMA 5ACXA 4LE6A 2YNTB 4PVTA 3X2XA 5AXOA 3IELA 3L6NA 3DH8A 5AYAA 2H6AA 4ZEJA 5LS3A 2P97A 1K07A 3DHAA 3AJ3A 5IQKA 3KL7A 4B87A 4GCWA 4DILA 4JO0A 4C1DA 4Z7RA 4WD6A 1BMCA 4TYTA 2BG8B 1Y44A 4Z6XA 4Z60A 5AHRA 5EW0A 4ZO3A 3I11A 3DHCA 3T3OA 5HIPA 3FAIA 4XWWA 2BFLA 1A7TA 1VMEA 3PY6A 2I7XA 3PG4A 5FQAA 3PY5A 2FU9A 4D1VA 4J5HA 2GFJA 3DHBA 5EVBA 4EXYA 1KO2A 5HIOA 1X8GA 3BV6A 2QDSA 4YSLA 3IE1A 1VGNA 2WRSA 3SBLA 1ZTCA 3IOGA 5ACWA 1X8IA 2M5DA 4C1HA 2A7MA 2FU6A 3SPUA 4EY2A 2YNWA 2XR1A 5LMCA 5B1UA 4TZBA 3AF5A 2QDTA 5EVDA 1QH3A 4BP0A 4TZ9A 1M2XA 4C1GA 3FCZA 5B15A 3SD9A 2BG7A 3VQZA 2GFKA 2FU7A 3LVZA 5B3RA 4UWSB 5ACTA 4BZ3A 5FQBA 2I7VA 3WXCA 3BK2A 1KO3A 2YNTA 1YCHA 4RL2A 3BC2A 5ACVA 4UBQA 4DIKA 3IEMA 2GCUA 4F6ZA 5A5ZA 4AWYB 2Y87A 4ZNBA 5A0VA 1DDKA 2Y8BA 1VJNA 2BFKA 2ZWRA 3AF6A 2P18A 2P4ZA 5ACRA 2P1EA 2BR6A 1P9EA 4GYUA 2XF4A 2E7YA 5K0WA 5HH5A 4ZO2A 1ZNBA 4P62A 1WUPA 4V0HA 2YNVA 4AX1B 5KIKA 5EV8A 2BFZA 2GKLA 2AZ4A 2ZZIA 4KEPA 5LE1A 5LM6A 1WUOA 3TP9A 4FSBA 4XWTA 4EYBA 5K4KA 3T9MA 3JXPA 5A0TA 4D1TA 2OHJA 4D1UA 2FU8A 3RKKA 2OHHA 2BGAA 2YNVB 4UWOB 2Y8AA 1KR3A 3ADRA 1YCFA 5EH9A 3ZWFA 4AX0B 4NQ6A 3IE2A 1JJEA 4PVOA
chains in the Genus database with same CATH superfamily
3KNSA 4AD9A 2BTNA 2DKFA 2QJSA 1DXKA 2YNUA 5LSCA 3MD7A 2CFZA 5EWAA 2NYPA 4TZFA 2FM6A 4UA4A 3Q6VA 1XTOA 4HL1A 2R2DA 5AEBA 3S0ZA 4AV7A 4F6HA 2AIOA 2FHXA 5DPXA 1A8TA 4HKYA 5EVKA 4Z5YA 4EYLA 2HB9A 2DOOA 1ZKPA 3ZNBA 3IOFA 2WHGA 3SFPA 4UAMA 2I7TA 4Z67A 5ACUA 4FEKA 3A4YA 1X8HA 4RBSA 3ESHA 4EXSA 1JT1A 2BG8A 2UYXA 1WRAA 3RKJA 2YCBA 4PDXA 4AWZA 4FR7A 2QEDA 4HL2A 2FHXB 4C1EA 2BG2A 5EV6A 5K4NA 3I0VA 4D02A 5LCHA 3T3NA 3IEKA 3ZQ4A 2Q0JA 5KILA 4RL0A 2QINA 4EYFA 2NXAA 3I15A 5EHTA 5FQCA 3X2ZA 5LLDA 5K4MA 2GMNA 3I13A 4NQ5A 5AHOA 4RAWA 3QH8A 4C1CA 3IDZA 2BMIA 3IE0A 4XUKA 4YSKA 2WYLA 1WW1A 4D1WA 2Q0IA 4EFZA 2FK6A 1MQOA 4Z5ZA 5ACQA 2OHIA 3G1PA 3H3EA 3X30A 5AJLA 5ACSA 1L9YA 3BK1A 3I14A 5HH6A 4C1FA 2WYMA 5AXRA 2WYMC 5LCFA 2NZFA 1BC2A 3SW3A 2YHEA 2ZO4A 2BG6A 3SRXA 1E5DA 2BC2A 4GYQA 1DD6A 4J5FA 3P2UA 3F9OA 2BIBA 2YZ3A 2Q42A 2CBNA 1BVTA 1QH5A 2CG3A 2NZEA 4CHLA 1YCGA 3ZR9A 3KNRA 5A87A 4KEQA 4NQ2A 4U4LA 5HH4A 5ACPA 1HLKA 4NQ4A 3X2YA 1XM8A 3R2UA 4UWRB 4RM5A 4TYFA 2Q9UA 5HIQA 5LCAA 4C09A 4TZEA 3VPEA 5HISA 4YSBA 4O98A 1JJTA 2BFZB 2ZNBA 2VW8A 4H0DA 4UWPB 1SMLA 2M5CA 3RPCA 4RAMA 5ACXA 4LE6A 2YNTB 4PVTA 3X2XA 5AXOA 3IELA 3L6NA 3DH8A 5AYAA 2H6AA 4ZEJA 5LS3A 2P97A 1K07A 3DHAA 3AJ3A 5IQKA 3KL7A 4B87A 4GCWA 4DILA 4JO0A 4C1DA 4Z7RA 4WD6A 1BMCA 4TYTA 2BG8B 5AIJA 1Y44A 4Z6XA 4Z60A 5AHRA 5EW0A 4ZO3A 3I11A 3DHCA 3T3OA 5HIPA 2CG2A 3FAIA 4XWWA 2BFLA 1A7TA 1VMEA 3PY6A 2I7XA 3PG4A 5FQAA 3PY5A 2FU9A 4D1VA 4J5HA 2GFJA 3DHBA 5EVBA 4EXYA 1KO2A 5HIOA 1X8GA 3BV6A 2QDSA 4YSLA 3IE1A 1VGNA 2WRSA 3SBLA 1ZTCA 2CFUA 3IOGA 5ACWA 1X8IA 2M5DA 4C1HA 2A7MA 2FU6A 3SPUA 4EY2A 2YNWA 2XR1A 5LMCA 5B1UA 4TZBA 3AF5A 2QDTA 5EVDA 1QH3A 4BP0A 4TZ9A 1M2XA 4C1GA 3FCZA 5B15A 3SD9A 2BG7A 3VQZA 2GFKA 2FU7A 3LVZA 5B3RA 4UWSB 5ACTA 4BZ3A 5FQBA 4NURA 2I7VA 3WXCA 3BK2A 1KO3A 2YNTA 1YCHA 4RL2A 3BC2A 5ACVA 4UBQA 4DIKA 3IEMA 2GCUA 4F6ZA 5A5ZA 4AWYB 2Y87A 4ZNBA 5A0VA 1DDKA 2Y8BA 1VJNA 2BFKA 2ZWRA 3AF6A 2P18A 2P4ZA 5ACRA 2P1EA 2BR6A 1P9EA 4GYUA 2XF4A 2E7YA 5K0WA 5HH5A 4ZO2A 1ZNBA 4P62A 1WUPA 4V0HA 2YNVA 4AX1B 5KIKA 5EV8A 2BFZA 2GKLA 2AZ4A 2ZZIA 4AXHA 4KEPA 5LE1A 5LM6A 1WUOA 3TP9A 4FSBA 4XWTA 4EYBA 5K4KA 3T9MA 3JXPA 5A0TA 4D1TA 2OHJA 4D1UA 2FU8A 3RKKA 2OHHA 2BGAA 2YNVB 4UWOB 2Y8AA 1KR3A 3ADRA 1YCFA 5EH9A 3ZWFA 4AX0B 4NQ6A 5A23A 3IE2A 1JJEA 4PVOA
chains in the Genus database with same CATH topology
3KNSA 4AD9A 2BTNA 2DKFA 2QJSA 1DXKA 2YNUA 5LSCA 3MD7A 5EWAA 2NYPA 4TZFA 2FM6A 4UA4A 3Q6VA 1XTOA 4HL1A 2R2DA 5AEBA 3S0ZA 4F6HA 2AIOA 2FHXA 5DPXA 1A8TA 4HKYA 5EVKA 4Z5YA 4EYLA 2HB9A 2DOOA 1ZKPA 3ZNBA 3IOFA 2WHGA 3SFPA 4UAMA 2I7TA 4Z67A 5ACUA 4FEKA 3A4YA 1X8HA 4RBSA 3ESHA 4EXSA 1JT1A 2BG8A 2UYXA 1WRAA 3RKJA 2YCBA 4AWZA 4FR7A 2QEDA 4HL2A 2FHXB 4C1EA 2BG2A 5EV6A 5K4NA 3I0VA 4D02A 5LCHA 3T3NA 3IEKA 3ZQ4A 2Q0JA 5KILA 4RL0A 2QINA 4EYFA 2NXAA 3I15A 5EHTA 5FQCA 3X2ZA 5LLDA 5K4MA 2GMNA 3I13A 4NQ5A 5AHOA 4RAWA 3QH8A 4C1CA 3IDZA 2BMIA 3IE0A 4XUKA 4YSKA 2WYLA 1WW1A 4D1WA 2Q0IA 4EFZA 2FK6A 1MQOA 4Z5ZA 5ACQA 2OHIA 3G1PA 3H3EA 3X30A 5ACSA 1L9YA 3BK1A 3I14A 5HH6A 4C1FA 2WYMA 5AXRA 2WYMC 5LCFA 2NZFA 1BC2A 3SW3A 2ZO4A 2BG6A 3SRXA 1E5DA 2BC2A 4GYQA 1DD6A 4J5FA 3P2UA 3F9OA 2BIBA 2YZ3A 2Q42A 2CBNA 1BVTA 1QH5A 2NZEA 4CHLA 1YCGA 3ZR9A 3KNRA 5A87A 4KEQA 4NQ2A 4U4LA 5HH4A 5ACPA 1HLKA 4NQ4A 3X2YA 1XM8A 3R2UA 4UWRB 4RM5A 4TYFA 2Q9UA 5HIQA 5LCAA 4C09A 4TZEA 3VPEA 5HISA 4YSBA 4O98A 1JJTA 2BFZB 2ZNBA 2VW8A 4H0DA 4UWPB 1SMLA 2M5CA 3RPCA 4RAMA 5ACXA 4LE6A 2YNTB 4PVTA 3X2XA 5AXOA 3IELA 3L6NA 3DH8A 5AYAA 2H6AA 4ZEJA 5LS3A 2P97A 1K07A 3DHAA 3AJ3A 5IQKA 3KL7A 4B87A 4GCWA 4DILA 4JO0A 4C1DA 4Z7RA 4WD6A 1BMCA 4TYTA 2BG8B 1Y44A 4Z6XA 4Z60A 5AHRA 5EW0A 4ZO3A 3I11A 3DHCA 3T3OA 5HIPA 3FAIA 4XWWA 2BFLA 1A7TA 1VMEA 3PY6A 2I7XA 3PG4A 5FQAA 3PY5A 2FU9A 4D1VA 4J5HA 2GFJA 3DHBA 5EVBA 4EXYA 1KO2A 5HIOA 1X8GA 3BV6A 2QDSA 4YSLA 3IE1A 1VGNA 2WRSA 3SBLA 1ZTCA 3IOGA 5ACWA 1X8IA 2M5DA 4C1HA 2A7MA 2FU6A 3SPUA 4EY2A 2YNWA 2XR1A 5LMCA 5B1UA 4TZBA 3AF5A 2QDTA 5EVDA 1QH3A 4BP0A 4TZ9A 1M2XA 4C1GA 3FCZA 5B15A 3SD9A 2BG7A 3VQZA 2GFKA 2FU7A 3LVZA 5B3RA 4UWSB 5ACTA 4BZ3A 5FQBA 2I7VA 3WXCA 3BK2A 1KO3A 2YNTA 1YCHA 4RL2A 3BC2A 5ACVA 4UBQA 4DIKA 3IEMA 2GCUA 4F6ZA 5A5ZA 4AWYB 2Y87A 4ZNBA 5A0VA 1DDKA 2Y8BA 1VJNA 2BFKA 2ZWRA 3AF6A 2P18A 2P4ZA 5ACRA 2P1EA 2BR6A 1P9EA 4GYUA 2XF4A 2E7YA 5K0WA 5HH5A 4ZO2A 1ZNBA 4P62A 1WUPA 4V0HA 2YNVA 4AX1B 5KIKA 5EV8A 2BFZA 2GKLA 2AZ4A 2ZZIA 4KEPA 5LE1A 5LM6A 1WUOA 3TP9A 4FSBA 4XWTA 4EYBA 5K4KA 3T9MA 3JXPA 5A0TA 4D1TA 2OHJA 4D1UA 2FU8A 3RKKA 2OHHA 2BGAA 2YNVB 4UWOB 2Y8AA 1KR3A 3ADRA 1YCFA 5EH9A 3ZWFA 4AX0B 4NQ6A 3IE2A 1JJEA 4PVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KNS A;  4AD9 A;  2BTN A;  2DKF A;  2QJS A;  1DXK A;  2YNU A;  5LSC A;  3MD7 A;  5EWA A;  2NYP A;  4TZF A;  2FM6 A;  4UA4 A;  3Q6V A;  1XTO A;  4HL1 A;  2R2D A;  5AEB A;  3S0Z A;  4F6H A;  2AIO A;  2FHX A;  5DPX A;  1A8T A;  4HKY A;  5EVK A;  4Z5Y A;  4EYL A;  2HB9 A;  2DOO A;  1ZKP A;  3ZNB A;  3IOF A;  2WHG A;  3SFP A;  4UAM A;  2I7T A;  4Z67 A;  5ACU A;  4FEK A;  3A4Y A;  1X8H A;  4RBS A;  3ESH A;  4EXS A;  1JT1 A;  2BG8 A;  2UYX A;  1WRA A;  3RKJ A;  2YCB A;  4AWZ A;  4FR7 A;  2QED A;  4HL2 A;  2FHX B;  4C1E A;  2BG2 A;  5EV6 A;  5K4N A;  3I0V A;  4D02 A;  5LCH A;  3T3N A;  3IEK A;  3ZQ4 A;  2Q0J A;  5KIL A;  4RL0 A;  2QIN A;  4EYF A;  2NXA A;  3I15 A;  5EHT A;  5FQC A;  3X2Z A;  5LLD A;  5K4M A;  2GMN A;  3I13 A;  4NQ5 A;  5AHO A;  4RAW A;  3QH8 A;  4C1C A;  3IDZ A;  2BMI A;  3IE0 A;  4XUK A;  4YSK A;  2WYL A;  1WW1 A;  4D1W A;  2Q0I A;  4EFZ A;  2FK6 A;  1MQO A;  4Z5Z A;  5ACQ A;  2OHI A;  3G1P A;  3H3E A;  3X30 A;  5ACS A;  1L9Y A;  3BK1 A;  3I14 A;  5HH6 A;  4C1F A;  2WYM A;  5AXR A;  2WYM C;  5LCF A;  2NZF A;  1BC2 A;  3SW3 A;  2ZO4 A;  2BG6 A;  3SRX A;  1E5D A;  2BC2 A;  4GYQ A;  1DD6 A;  4J5F A;  3P2U A;  3F9O A;  2BIB A;  2YZ3 A;  2Q42 A;  2CBN A;  1BVT A;  1QH5 A;  2NZE A;  4CHL A;  1YCG A;  3ZR9 A;  3KNR A;  5A87 A;  4KEQ A;  4NQ2 A;  4U4L A;  5HH4 A;  5ACP A;  1HLK A;  4NQ4 A;  3X2Y A;  1XM8 A;  3R2U A;  4UWR B;  4RM5 A;  4TYF A;  2Q9U A;  5HIQ A;  5LCA A;  4C09 A;  4TZE A;  3VPE A;  5HIS A;  4YSB A;  4O98 A;  1JJT A;  2BFZ B;  2ZNB A;  2VW8 A;  4H0D A;  4UWP B;  1SML A;  2M5C A;  3RPC A;  4RAM A;  5ACX A;  4LE6 A;  2YNT B;  4PVT A;  3X2X A;  5AXO A;  3IEL A;  3L6N A;  3DH8 A;  5AYA A;  2H6A A;  4ZEJ A;  5LS3 A;  2P97 A;  1K07 A;  3DHA A;  3AJ3 A;  5IQK A;  3KL7 A;  4B87 A;  4GCW A;  4DIL A;  4JO0 A;  4C1D A;  4Z7R A;  4WD6 A;  1BMC A;  4TYT A;  2BG8 B;  1Y44 A;  4Z6X A;  4Z60 A;  5AHR A;  5EW0 A;  4ZO3 A;  3I11 A;  3DHC A;  3T3O A;  5HIP A;  3FAI A;  4XWW A;  2BFL A;  1A7T A;  1VME A;  3PY6 A;  2I7X A;  3PG4 A;  5FQA A;  3PY5 A;  2FU9 A;  4D1V A;  4J5H A;  2GFJ A;  3DHB A;  5EVB A;  4EXY A;  1KO2 A;  5HIO A;  1X8G A;  3BV6 A;  2QDS A;  4YSL A;  3IE1 A;  1VGN A;  2WRS A;  3SBL A;  1ZTC A;  3IOG A;  5ACW A;  1X8I A;  2M5D A;  4C1H A;  2A7M A;  2FU6 A;  3SPU A;  4EY2 A;  2YNW A;  2XR1 A;  5LMC A;  5B1U A;  4TZB A;  3AF5 A;  2QDT A;  5EVD A;  1QH3 A;  4BP0 A;  4TZ9 A;  1M2X A;  4C1G A;  3FCZ A;  5B15 A;  3SD9 A;  2BG7 A;  3VQZ A;  2GFK A;  2FU7 A;  3LVZ A;  5B3R A;  4UWS B;  5ACT A;  4BZ3 A;  5FQB A;  2I7V A;  3WXC A;  3BK2 A;  1KO3 A;  2YNT A;  1YCH A;  4RL2 A;  3BC2 A;  5ACV A;  4UBQ A;  4DIK A;  3IEM A;  2GCU A;  4F6Z A;  5A5Z A;  4AWY B;  2Y87 A;  4ZNB A;  5A0V A;  1DDK A;  2Y8B A;  1VJN A;  2BFK A;  2ZWR A;  3AF6 A;  2P18 A;  2P4Z A;  5ACR A;  2P1E A;  2BR6 A;  1P9E A;  4GYU A;  2XF4 A;  2E7Y A;  5K0W A;  5HH5 A;  4ZO2 A;  1ZNB A;  4P62 A;  1WUP A;  4V0H A;  2YNV A;  4AX1 B;  5KIK A;  5EV8 A;  2BFZ A;  2GKL A;  2AZ4 A;  2ZZI A;  4KEP A;  5LE1 A;  5LM6 A;  1WUO A;  3TP9 A;  4FSB A;  4XWT A;  4EYB A;  5K4K A;  3T9M A;  3JXP A;  5A0T A;  4D1T A;  2OHJ A;  4D1U A;  2FU8 A;  3RKK A;  2OHH A;  2BGA A;  2YNV B;  4UWO B;  2Y8A A;  1KR3 A;  3ADR A;  1YCF A;  5EH9 A;  3ZWF A;  4AX0 B;  4NQ6 A;  3IE2 A;  1JJE A;  4PVO A; 
#chains in the Genus database with same CATH topology
 3KNS A;  4AD9 A;  2BTN A;  2DKF A;  2QJS A;  1DXK A;  2YNU A;  5LSC A;  3MD7 A;  2CFZ A;  5EWA A;  2NYP A;  4TZF A;  2FM6 A;  4UA4 A;  3Q6V A;  1XTO A;  4HL1 A;  2R2D A;  5AEB A;  3S0Z A;  4AV7 A;  4F6H A;  2AIO A;  2FHX A;  5DPX A;  1A8T A;  4HKY A;  5EVK A;  4Z5Y A;  4EYL A;  2HB9 A;  2DOO A;  1ZKP A;  3ZNB A;  3IOF A;  2WHG A;  3SFP A;  4UAM A;  2I7T A;  4Z67 A;  5ACU A;  4FEK A;  3A4Y A;  1X8H A;  4RBS A;  3ESH A;  4EXS A;  1JT1 A;  2BG8 A;  2UYX A;  1WRA A;  3RKJ A;  2YCB A;  4PDX A;  4AWZ A;  4FR7 A;  2QED A;  4HL2 A;  2FHX B;  4C1E A;  2BG2 A;  5EV6 A;  5K4N A;  3I0V A;  4D02 A;  5LCH A;  3T3N A;  3IEK A;  3ZQ4 A;  2Q0J A;  5KIL A;  4RL0 A;  2QIN A;  4EYF A;  2NXA A;  3I15 A;  5EHT A;  5FQC A;  3X2Z A;  5LLD A;  5K4M A;  2GMN A;  3I13 A;  4NQ5 A;  5AHO A;  4RAW A;  3QH8 A;  4C1C A;  3IDZ A;  2BMI A;  3IE0 A;  4XUK A;  4YSK A;  2WYL A;  1WW1 A;  4D1W A;  2Q0I A;  4EFZ A;  2FK6 A;  1MQO A;  4Z5Z A;  5ACQ A;  2OHI A;  3G1P A;  3H3E A;  3X30 A;  5AJL A;  5ACS A;  1L9Y A;  3BK1 A;  3I14 A;  5HH6 A;  4C1F A;  2WYM A;  5AXR A;  2WYM C;  5LCF A;  2NZF A;  1BC2 A;  3SW3 A;  2YHE A;  2ZO4 A;  2BG6 A;  3SRX A;  1E5D A;  2BC2 A;  4GYQ A;  1DD6 A;  4J5F A;  3P2U A;  3F9O A;  2BIB A;  2YZ3 A;  2Q42 A;  2CBN A;  1BVT A;  1QH5 A;  2CG3 A;  2NZE A;  4CHL A;  1YCG A;  3ZR9 A;  3KNR A;  5A87 A;  4KEQ A;  4NQ2 A;  4U4L A;  5HH4 A;  5ACP A;  1HLK A;  4NQ4 A;  3X2Y A;  1XM8 A;  3R2U A;  4UWR B;  4RM5 A;  4TYF A;  2Q9U A;  5HIQ A;  5LCA A;  4C09 A;  4TZE A;  3VPE A;  5HIS A;  4YSB A;  4O98 A;  1JJT A;  2BFZ B;  2ZNB A;  2VW8 A;  4H0D A;  4UWP B;  1SML A;  2M5C A;  3RPC A;  4RAM A;  5ACX A;  4LE6 A;  2YNT B;  4PVT A;  3X2X A;  5AXO A;  3IEL A;  3L6N A;  3DH8 A;  5AYA A;  2H6A A;  4ZEJ A;  5LS3 A;  2P97 A;  1K07 A;  3DHA A;  3AJ3 A;  5IQK A;  3KL7 A;  4B87 A;  4GCW A;  4DIL A;  4JO0 A;  4C1D A;  4Z7R A;  4WD6 A;  1BMC A;  4TYT A;  2BG8 B;  5AIJ A;  1Y44 A;  4Z6X A;  4Z60 A;  5AHR A;  5EW0 A;  4ZO3 A;  3I11 A;  3DHC A;  3T3O A;  5HIP A;  2CG2 A;  3FAI A;  4XWW A;  2BFL A;  1A7T A;  1VME A;  3PY6 A;  2I7X A;  3PG4 A;  5FQA A;  3PY5 A;  2FU9 A;  4D1V A;  4J5H A;  2GFJ A;  3DHB A;  5EVB A;  4EXY A;  1KO2 A;  5HIO A;  1X8G A;  3BV6 A;  2QDS A;  4YSL A;  3IE1 A;  1VGN A;  2WRS A;  3SBL A;  1ZTC A;  2CFU A;  3IOG A;  5ACW A;  1X8I A;  2M5D A;  4C1H A;  2A7M A;  2FU6 A;  3SPU A;  4EY2 A;  2YNW A;  2XR1 A;  5LMC A;  5B1U A;  4TZB A;  3AF5 A;  2QDT A;  5EVD A;  1QH3 A;  4BP0 A;  4TZ9 A;  1M2X A;  4C1G A;  3FCZ A;  5B15 A;  3SD9 A;  2BG7 A;  3VQZ A;  2GFK A;  2FU7 A;  3LVZ A;  5B3R A;  4UWS B;  5ACT A;  4BZ3 A;  5FQB A;  4NUR A;  2I7V A;  3WXC A;  3BK2 A;  1KO3 A;  2YNT A;  1YCH A;  4RL2 A;  3BC2 A;  5ACV A;  4UBQ A;  4DIK A;  3IEM A;  2GCU A;  4F6Z A;  5A5Z A;  4AWY B;  2Y87 A;  4ZNB A;  5A0V A;  1DDK A;  2Y8B A;  1VJN A;  2BFK A;  2ZWR A;  3AF6 A;  2P18 A;  2P4Z A;  5ACR A;  2P1E A;  2BR6 A;  1P9E A;  4GYU A;  2XF4 A;  2E7Y A;  5K0W A;  5HH5 A;  4ZO2 A;  1ZNB A;  4P62 A;  1WUP A;  4V0H A;  2YNV A;  4AX1 B;  5KIK A;  5EV8 A;  2BFZ A;  2GKL A;  2AZ4 A;  2ZZI A;  4AXH A;  4KEP A;  5LE1 A;  5LM6 A;  1WUO A;  3TP9 A;  4FSB A;  4XWT A;  4EYB A;  5K4K A;  3T9M A;  3JXP A;  5A0T A;  4D1T A;  2OHJ A;  4D1U A;  2FU8 A;  3RKK A;  2OHH A;  2BGA A;  2YNV B;  4UWO B;  2Y8A A;  1KR3 A;  3ADR A;  1YCF A;  5EH9 A;  3ZWF A;  4AX0 B;  4NQ6 A;  5A23 A;  3IE2 A;  1JJE A;  4PVO A; 
#chains in the Genus database with same CATH homology
 3KNS A;  4AD9 A;  2BTN A;  2DKF A;  2QJS A;  1DXK A;  2YNU A;  5LSC A;  3MD7 A;  5EWA A;  2NYP A;  4TZF A;  2FM6 A;  4UA4 A;  3Q6V A;  1XTO A;  4HL1 A;  2R2D A;  5AEB A;  3S0Z A;  4F6H A;  2AIO A;  2FHX A;  5DPX A;  1A8T A;  4HKY A;  5EVK A;  4Z5Y A;  4EYL A;  2HB9 A;  2DOO A;  1ZKP A;  3ZNB A;  3IOF A;  2WHG A;  3SFP A;  4UAM A;  2I7T A;  4Z67 A;  5ACU A;  4FEK A;  3A4Y A;  1X8H A;  4RBS A;  3ESH A;  4EXS A;  1JT1 A;  2BG8 A;  2UYX A;  1WRA A;  3RKJ A;  2YCB A;  4AWZ A;  4FR7 A;  2QED A;  4HL2 A;  2FHX B;  4C1E A;  2BG2 A;  5EV6 A;  5K4N A;  3I0V A;  4D02 A;  5LCH A;  3T3N A;  3IEK A;  3ZQ4 A;  2Q0J A;  5KIL A;  4RL0 A;  2QIN A;  4EYF A;  2NXA A;  3I15 A;  5EHT A;  5FQC A;  3X2Z A;  5LLD A;  5K4M A;  2GMN A;  3I13 A;  4NQ5 A;  5AHO A;  4RAW A;  3QH8 A;  4C1C A;  3IDZ A;  2BMI A;  3IE0 A;  4XUK A;  4YSK A;  2WYL A;  1WW1 A;  4D1W A;  2Q0I A;  4EFZ A;  2FK6 A;  1MQO A;  4Z5Z A;  5ACQ A;  2OHI A;  3G1P A;  3H3E A;  3X30 A;  5ACS A;  1L9Y A;  3BK1 A;  3I14 A;  5HH6 A;  4C1F A;  2WYM A;  5AXR A;  2WYM C;  5LCF A;  2NZF A;  1BC2 A;  3SW3 A;  2ZO4 A;  2BG6 A;  3SRX A;  1E5D A;  2BC2 A;  4GYQ A;  1DD6 A;  4J5F A;  3P2U A;  3F9O A;  2BIB A;  2YZ3 A;  2Q42 A;  2CBN A;  1BVT A;  1QH5 A;  2NZE A;  4CHL A;  1YCG A;  3ZR9 A;  3KNR A;  5A87 A;  4KEQ A;  4NQ2 A;  4U4L A;  5HH4 A;  5ACP A;  1HLK A;  4NQ4 A;  3X2Y A;  1XM8 A;  3R2U A;  4UWR B;  4RM5 A;  4TYF A;  2Q9U A;  5HIQ A;  5LCA A;  4C09 A;  4TZE A;  3VPE A;  5HIS A;  4YSB A;  4O98 A;  1JJT A;  2BFZ B;  2ZNB A;  2VW8 A;  4H0D A;  4UWP B;  1SML A;  2M5C A;  3RPC A;  4RAM A;  5ACX A;  4LE6 A;  2YNT B;  4PVT A;  3X2X A;  5AXO A;  3IEL A;  3L6N A;  3DH8 A;  5AYA A;  2H6A A;  4ZEJ A;  5LS3 A;  2P97 A;  1K07 A;  3DHA A;  3AJ3 A;  5IQK A;  3KL7 A;  4B87 A;  4GCW A;  4DIL A;  4JO0 A;  4C1D A;  4Z7R A;  4WD6 A;  1BMC A;  4TYT A;  2BG8 B;  1Y44 A;  4Z6X A;  4Z60 A;  5AHR A;  5EW0 A;  4ZO3 A;  3I11 A;  3DHC A;  3T3O A;  5HIP A;  3FAI A;  4XWW A;  2BFL A;  1A7T A;  1VME A;  3PY6 A;  2I7X A;  3PG4 A;  5FQA A;  3PY5 A;  2FU9 A;  4D1V A;  4J5H A;  2GFJ A;  3DHB A;  5EVB A;  4EXY A;  1KO2 A;  5HIO A;  1X8G A;  3BV6 A;  2QDS A;  4YSL A;  3IE1 A;  1VGN A;  2WRS A;  3SBL A;  1ZTC A;  3IOG A;  5ACW A;  1X8I A;  2M5D A;  4C1H A;  2A7M A;  2FU6 A;  3SPU A;  4EY2 A;  2YNW A;  2XR1 A;  5LMC A;  5B1U A;  4TZB A;  3AF5 A;  2QDT A;  5EVD A;  1QH3 A;  4BP0 A;  4TZ9 A;  1M2X A;  4C1G A;  3FCZ A;  5B15 A;  3SD9 A;  2BG7 A;  3VQZ A;  2GFK A;  2FU7 A;  3LVZ A;  5B3R A;  4UWS B;  5ACT A;  4BZ3 A;  5FQB A;  2I7V A;  3WXC A;  3BK2 A;  1KO3 A;  2YNT A;  1YCH A;  4RL2 A;  3BC2 A;  5ACV A;  4UBQ A;  4DIK A;  3IEM A;  2GCU A;  4F6Z A;  5A5Z A;  4AWY B;  2Y87 A;  4ZNB A;  5A0V A;  1DDK A;  2Y8B A;  1VJN A;  2BFK A;  2ZWR A;  3AF6 A;  2P18 A;  2P4Z A;  5ACR A;  2P1E A;  2BR6 A;  1P9E A;  4GYU A;  2XF4 A;  2E7Y A;  5K0W A;  5HH5 A;  4ZO2 A;  1ZNB A;  4P62 A;  1WUP A;  4V0H A;  2YNV A;  4AX1 B;  5KIK A;  5EV8 A;  2BFZ A;  2GKL A;  2AZ4 A;  2ZZI A;  4KEP A;  5LE1 A;  5LM6 A;  1WUO A;  3TP9 A;  4FSB A;  4XWT A;  4EYB A;  5K4K A;  3T9M A;  3JXP A;  5A0T A;  4D1T A;  2OHJ A;  4D1U A;  2FU8 A;  3RKK A;  2OHH A;  2BGA A;  2YNV B;  4UWO B;  2Y8A A;  1KR3 A;  3ADR A;  1YCF A;  5EH9 A;  3ZWF A;  4AX0 B;  4NQ6 A;  3IE2 A;  1JJE A;  4PVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...