4C1GA

Crystal structure of the metallo-beta-lactamase imp-1 with d-captopril
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
219
structure length
219
Chain Sequence
SLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE IMP-1
publication title Structural Basis of Metallo-beta-Lactamase Inhibition by Captopril Stereoisomers.
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Hydrolase
total genus 69
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4c1gA00
3VPEA 1DDKA 4XWTA 2YNTA 4GYQA 1A8TA 2BFZA 2Q0IA 3KNRA 4DILA 4EXSA 4ZNBA 5HH5A 4GYUA 2GFJA 1BC2A 1ZTCA 2Y8AA 2QDSA 1KO2A 3T9MA 2YZ3A 5A0TA 1P9EA 3I11A 3AF5A 5KILA 3BK1A 3SBLA 5LCAA 4UA4A 2BIBA 3IOGA 5ACWA 3BC2A 1M2XA 3SD9A 2QEDA 5EH9A 2Q42A 5EV6A 5EW0A 4Z60A 2FM6A 1XM8A 4C1HA 3DHBA 1JT1A 4AWZA 2GKLA 4EYBA 5LLDA 2WRSA 5LCFA 4B87A 3SFPA 2HB9A 4HL1A 3FCZA 1VJNA 1E5DA 3KNSA 2BR6A 2BGAA 2A7MA 1K07A 2YNVB 3ZQ4A 2DKFA 3PY5A 4UAMA 3SRXA 1QH5A 1SMLA 3X2YA 2NZFA 5ACQA 3JXPA 4FSBA 1ZKPA 3WXCA 5ACUA 4HKYA 4RBSA 5LMCA 5AHRA 5LE1A 4KEQA 5B3RA 5EV8A 4Z7RA 4WD6A 3LVZA 1WW1A 4ZEJA 2BG8B 4TZEA 3G1PA 5K0WA 2P18A 2BG7A 5EHTA 2XR1A 4Z5YA 4AWYB 3IEKA 1YCFA 4NQ2A 2WYMA 5EVBA 5HH4A 4D1WA 5AHOA 2BC2A 3SW3A 4BZ3A 3L6NA 2NZEA 5HIOA 4GCWA 4RL2A 1WRAA 2BFLA 4H0DA 2FHXB 4AD9A 2ZNBA 2AIOA 2Y8BA 2Q9UA 2P97A 2YNVA 2BFKA 3DHAA 4UWPB 4RL0A 3ZNBA 3FAIA 5AXOA 4TYFA 2AZ4A 4NQ6A 5ACTA 5A5ZA 1VGNA 2YNUA 2BG8A 4EYFA 5LS3A 3PY6A 5FQCA 2P4ZA 2YCBA 2OHJA 4KEPA 2GCUA 1KR3A 4EYLA 2VW8A 3AJ3A 2BG2A 4D02A 1YCGA 4D1TA 2R2DA 3IEMA 3I13A 4J5FA 2FU6A 3BK2A 1DXKA 3X30A 2M5DA 3SPUA 2QDTA 3X2ZA 2FHXA 4CHLA 2OHIA 5AYAA 1YCHA 3AF6A 3A4YA 5DPXA 3DHCA 1JJEA 5FQBA 4RAWA 4EFZA 5LM6A 4TZFA 2UYXA 3Q6VA 3P2UA 1HLKA 1ZNBA 4PVOA 4TZ9A 4EY2A 1JJTA 1BVTA 4C1EA 2FU9A 2YNWA 3X2XA 4YSLA 2XF4A 5LCHA 1Y44A 5ACXA 3IE1A 3IDZA 2I7XA 4FR7A 2P1EA 3T3NA 5HIPA 3RPCA 3IELA 4U4LA 2E7YA 5HIQA 4Z5ZA 3QH8A 4C1DA 4D1VA 2ZWRA 4AX0B 2GMNA 5HH6A 3IE2A 2Q0JA 1MQOA 5ACVA 4NQ4A 4F6ZA 2WHGA 4LE6A 2I7TA 4YSBA 2DOOA 5B15A 4C1CA 2H6AA 2OHHA 1KO3A 2FU8A 4F6HA 1QH3A 5ACSA 4C1GA 3H3EA 2BTNA 4RM5A 5IQKA 3TP9A 4Z67A 4TZBA 3I14A 1WUOA 5EVKA 2Y87A 4UWOB 3S0ZA 3MD7A 2BMIA 1X8GA 2I7VA 3RKKA 4V0HA 4TYTA 3VQZA 2BG6A 3IOFA 2NYPA 3ESHA 5ACRA 1X8HA 3I0VA 5EWAA 5LSCA 2WYLA 2YNTB 4EXYA 2BFZB 3F9OA 4O98A 2ZO4A 1BMCA 3KL7A 1X8IA 2M5CA 3ADRA 3R2UA 3PG4A 4XUKA 5K4NA 4JO0A 4BP0A 4ZO2A 2FK6A 2CBNA 2ZZIA 3T3OA 2QJSA 5AEBA 3I15A 5K4KA 5FQAA 4YSKA 3RKJA 2NXAA 5B1UA 4HL2A 2QINA 2WYMC 4UWRB 5KIKA 3ZWFA 1XTOA 4J5HA 4C09A 4AX1B 5AXRA 3BV6A 1DD6A 5A0VA 4C1FA 4D1UA 4NQ5A 4P62A 5HISA 1VMEA 2FU7A 3IE0A 5K4MA 5EVDA 4UWSB 5ACPA 4FEKA 4UBQA 4DIKA 4XWWA 3DH8A 3ZR9A 4Z6XA 4PVTA 4RAMA 4ZO3A 1WUPA 5A87A 1L9YA 1A7TA 2GFKA
chains in the Genus database with same CATH superfamily
3VPEA 1DDKA 2CFZA 4XWTA 2YNTA 4GYQA 1A8TA 2BFZA 2Q0IA 3KNRA 4DILA 4EXSA 4ZNBA 5HH5A 4GYUA 2CFUA 2GFJA 1BC2A 1ZTCA 2Y8AA 2QDSA 1KO2A 3T9MA 2YZ3A 5A0TA 1P9EA 3I11A 3AF5A 5KILA 3BK1A 3SBLA 5LCAA 4UA4A 2BIBA 3IOGA 5ACWA 3BC2A 1M2XA 3SD9A 2QEDA 5EH9A 2Q42A 5EV6A 5EW0A 4Z60A 2FM6A 1XM8A 4C1HA 5A23A 3DHBA 1JT1A 4AWZA 2GKLA 4EYBA 5LLDA 2WRSA 5LCFA 4B87A 3SFPA 2HB9A 4HL1A 3FCZA 1VJNA 1E5DA 3KNSA 2BR6A 2BGAA 2A7MA 1K07A 2YNVB 3ZQ4A 2DKFA 3PY5A 4UAMA 3SRXA 1QH5A 1SMLA 3X2YA 2CG3A 2NZFA 5ACQA 3JXPA 4FSBA 1ZKPA 3WXCA 5AJLA 5ACUA 4HKYA 4RBSA 5LMCA 5AHRA 5LE1A 4KEQA 5B3RA 5EV8A 4Z7RA 4WD6A 3LVZA 1WW1A 4ZEJA 2BG8B 4TZEA 3G1PA 5K0WA 2P18A 2BG7A 5EHTA 2XR1A 4Z5YA 4AWYB 3IEKA 1YCFA 4NQ2A 2WYMA 5EVBA 5HH4A 4D1WA 5AHOA 2BC2A 3SW3A 4BZ3A 3L6NA 2NZEA 5HIOA 4GCWA 4RL2A 1WRAA 2BFLA 4H0DA 2FHXB 4AD9A 2ZNBA 2AIOA 2Y8BA 2Q9UA 2P97A 2YNVA 2BFKA 3DHAA 4UWPB 4RL0A 3ZNBA 3FAIA 5AXOA 4TYFA 2AZ4A 4NQ6A 5ACTA 5A5ZA 1VGNA 2YNUA 2BG8A 4EYFA 5LS3A 3PY6A 5FQCA 2P4ZA 2YCBA 2OHJA 4KEPA 2GCUA 1KR3A 4EYLA 2VW8A 3AJ3A 2BG2A 4D02A 1YCGA 4D1TA 2R2DA 3IEMA 3I13A 4J5FA 2FU6A 3BK2A 1DXKA 3X30A 2M5DA 3SPUA 2QDTA 3X2ZA 2FHXA 4CHLA 2OHIA 5AYAA 1YCHA 4NURA 3AF6A 3A4YA 5DPXA 3DHCA 1JJEA 5FQBA 4RAWA 4EFZA 5LM6A 4TZFA 2UYXA 3Q6VA 3P2UA 1HLKA 1ZNBA 4PVOA 4TZ9A 4EY2A 1JJTA 1BVTA 4C1EA 2FU9A 2YNWA 3X2XA 4YSLA 2XF4A 5LCHA 1Y44A 5ACXA 3IE1A 3IDZA 2I7XA 4FR7A 2P1EA 3T3NA 5HIPA 3RPCA 3IELA 4U4LA 2E7YA 5HIQA 4Z5ZA 3QH8A 4C1DA 4D1VA 2ZWRA 4AV7A 4AX0B 2GMNA 5HH6A 3IE2A 2Q0JA 1MQOA 5ACVA 4NQ4A 4F6ZA 2WHGA 4LE6A 2I7TA 4YSBA 2DOOA 5B15A 4C1CA 4AXHA 2H6AA 2OHHA 1KO3A 2FU8A 4F6HA 1QH3A 5ACSA 4C1GA 3H3EA 2BTNA 4RM5A 5IQKA 3TP9A 4Z67A 4TZBA 3I14A 1WUOA 5EVKA 2Y87A 4UWOB 3S0ZA 3MD7A 2BMIA 1X8GA 2I7VA 3RKKA 4V0HA 4TYTA 3VQZA 2BG6A 3IOFA 2NYPA 3ESHA 5ACRA 1X8HA 3I0VA 5EWAA 5LSCA 2WYLA 2YNTB 4EXYA 2BFZB 3F9OA 4O98A 2ZO4A 1BMCA 3KL7A 1X8IA 2M5CA 3ADRA 3R2UA 3PG4A 4XUKA 5K4NA 4JO0A 4BP0A 4ZO2A 2FK6A 2CBNA 2ZZIA 3T3OA 2QJSA 5AEBA 3I15A 5K4KA 5FQAA 4YSKA 3RKJA 2NXAA 5B1UA 4HL2A 2QINA 2WYMC 4UWRB 5KIKA 3ZWFA 1XTOA 4J5HA 4C09A 4AX1B 5AXRA 3BV6A 1DD6A 5A0VA 4C1FA 4D1UA 4NQ5A 4P62A 5HISA 1VMEA 2FU7A 3IE0A 5K4MA 5EVDA 4UWSB 2YHEA 5ACPA 4FEKA 4UBQA 4PDXA 4DIKA 4XWWA 3DH8A 2CG2A 3ZR9A 4Z6XA 4PVTA 4RAMA 4ZO3A 1WUPA 5A87A 1L9YA 5AIJA 1A7TA 2GFKA
chains in the Genus database with same CATH topology
3VPEA 1DDKA 4XWTA 2YNTA 4GYQA 1A8TA 2BFZA 2Q0IA 3KNRA 4DILA 4EXSA 4ZNBA 5HH5A 4GYUA 2GFJA 1BC2A 1ZTCA 2Y8AA 2QDSA 1KO2A 3T9MA 2YZ3A 5A0TA 1P9EA 3I11A 3AF5A 5KILA 3BK1A 3SBLA 5LCAA 4UA4A 2BIBA 3IOGA 5ACWA 3BC2A 1M2XA 3SD9A 2QEDA 5EH9A 2Q42A 5EV6A 5EW0A 4Z60A 2FM6A 1XM8A 4C1HA 3DHBA 1JT1A 4AWZA 2GKLA 4EYBA 5LLDA 2WRSA 5LCFA 4B87A 3SFPA 2HB9A 4HL1A 3FCZA 1VJNA 1E5DA 3KNSA 2BR6A 2BGAA 2A7MA 1K07A 2YNVB 3ZQ4A 2DKFA 3PY5A 4UAMA 3SRXA 1QH5A 1SMLA 3X2YA 2NZFA 5ACQA 3JXPA 4FSBA 1ZKPA 3WXCA 5ACUA 4HKYA 4RBSA 5LMCA 5AHRA 5LE1A 4KEQA 5B3RA 5EV8A 4Z7RA 4WD6A 3LVZA 1WW1A 4ZEJA 2BG8B 4TZEA 3G1PA 5K0WA 2P18A 2BG7A 5EHTA 2XR1A 4Z5YA 4AWYB 3IEKA 1YCFA 4NQ2A 2WYMA 5EVBA 5HH4A 4D1WA 5AHOA 2BC2A 3SW3A 4BZ3A 3L6NA 2NZEA 5HIOA 4GCWA 4RL2A 1WRAA 2BFLA 4H0DA 2FHXB 4AD9A 2ZNBA 2AIOA 2Y8BA 2Q9UA 2P97A 2YNVA 2BFKA 3DHAA 4UWPB 4RL0A 3ZNBA 3FAIA 5AXOA 4TYFA 2AZ4A 4NQ6A 5ACTA 5A5ZA 1VGNA 2YNUA 2BG8A 4EYFA 5LS3A 3PY6A 5FQCA 2P4ZA 2YCBA 2OHJA 4KEPA 2GCUA 1KR3A 4EYLA 2VW8A 3AJ3A 2BG2A 4D02A 1YCGA 4D1TA 2R2DA 3IEMA 3I13A 4J5FA 2FU6A 3BK2A 1DXKA 3X30A 2M5DA 3SPUA 2QDTA 3X2ZA 2FHXA 4CHLA 2OHIA 5AYAA 1YCHA 3AF6A 3A4YA 5DPXA 3DHCA 1JJEA 5FQBA 4RAWA 4EFZA 5LM6A 4TZFA 2UYXA 3Q6VA 3P2UA 1HLKA 1ZNBA 4PVOA 4TZ9A 4EY2A 1JJTA 1BVTA 4C1EA 2FU9A 2YNWA 3X2XA 4YSLA 2XF4A 5LCHA 1Y44A 5ACXA 3IE1A 3IDZA 2I7XA 4FR7A 2P1EA 3T3NA 5HIPA 3RPCA 3IELA 4U4LA 2E7YA 5HIQA 4Z5ZA 3QH8A 4C1DA 4D1VA 2ZWRA 4AX0B 2GMNA 5HH6A 3IE2A 2Q0JA 1MQOA 5ACVA 4NQ4A 4F6ZA 2WHGA 4LE6A 2I7TA 4YSBA 2DOOA 5B15A 4C1CA 2H6AA 2OHHA 1KO3A 2FU8A 4F6HA 1QH3A 5ACSA 4C1GA 3H3EA 2BTNA 4RM5A 5IQKA 3TP9A 4Z67A 4TZBA 3I14A 1WUOA 5EVKA 2Y87A 4UWOB 3S0ZA 3MD7A 2BMIA 1X8GA 2I7VA 3RKKA 4V0HA 4TYTA 3VQZA 2BG6A 3IOFA 2NYPA 3ESHA 5ACRA 1X8HA 3I0VA 5EWAA 5LSCA 2WYLA 2YNTB 4EXYA 2BFZB 3F9OA 4O98A 2ZO4A 1BMCA 3KL7A 1X8IA 2M5CA 3ADRA 3R2UA 3PG4A 4XUKA 5K4NA 4JO0A 4BP0A 4ZO2A 2FK6A 2CBNA 2ZZIA 3T3OA 2QJSA 5AEBA 3I15A 5K4KA 5FQAA 4YSKA 3RKJA 2NXAA 5B1UA 4HL2A 2QINA 2WYMC 4UWRB 5KIKA 3ZWFA 1XTOA 4J5HA 4C09A 4AX1B 5AXRA 3BV6A 1DD6A 5A0VA 4C1FA 4D1UA 4NQ5A 4P62A 5HISA 1VMEA 2FU7A 3IE0A 5K4MA 5EVDA 4UWSB 5ACPA 4FEKA 4UBQA 4DIKA 4XWWA 3DH8A 3ZR9A 4Z6XA 4PVTA 4RAMA 4ZO3A 1WUPA 5A87A 1L9YA 1A7TA 2GFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VPE A;  1DDK A;  4XWT A;  2YNT A;  4GYQ A;  1A8T A;  2BFZ A;  2Q0I A;  3KNR A;  4DIL A;  4EXS A;  4ZNB A;  5HH5 A;  4GYU A;  2GFJ A;  1BC2 A;  1ZTC A;  2Y8A A;  2QDS A;  1KO2 A;  3T9M A;  2YZ3 A;  5A0T A;  1P9E A;  3I11 A;  3AF5 A;  5KIL A;  3BK1 A;  3SBL A;  5LCA A;  4UA4 A;  2BIB A;  3IOG A;  5ACW A;  3BC2 A;  1M2X A;  3SD9 A;  2QED A;  5EH9 A;  2Q42 A;  5EV6 A;  5EW0 A;  4Z60 A;  2FM6 A;  1XM8 A;  4C1H A;  3DHB A;  1JT1 A;  4AWZ A;  2GKL A;  4EYB A;  5LLD A;  2WRS A;  5LCF A;  4B87 A;  3SFP A;  2HB9 A;  4HL1 A;  3FCZ A;  1VJN A;  1E5D A;  3KNS A;  2BR6 A;  2BGA A;  2A7M A;  1K07 A;  2YNV B;  3ZQ4 A;  2DKF A;  3PY5 A;  4UAM A;  3SRX A;  1QH5 A;  1SML A;  3X2Y A;  2NZF A;  5ACQ A;  3JXP A;  4FSB A;  1ZKP A;  3WXC A;  5ACU A;  4HKY A;  4RBS A;  5LMC A;  5AHR A;  5LE1 A;  4KEQ A;  5B3R A;  5EV8 A;  4Z7R A;  4WD6 A;  3LVZ A;  1WW1 A;  4ZEJ A;  2BG8 B;  4TZE A;  3G1P A;  5K0W A;  2P18 A;  2BG7 A;  5EHT A;  2XR1 A;  4Z5Y A;  4AWY B;  3IEK A;  1YCF A;  4NQ2 A;  2WYM A;  5EVB A;  5HH4 A;  4D1W A;  5AHO A;  2BC2 A;  3SW3 A;  4BZ3 A;  3L6N A;  2NZE A;  5HIO A;  4GCW A;  4RL2 A;  1WRA A;  2BFL A;  4H0D A;  2FHX B;  4AD9 A;  2ZNB A;  2AIO A;  2Y8B A;  2Q9U A;  2P97 A;  2YNV A;  2BFK A;  3DHA A;  4UWP B;  4RL0 A;  3ZNB A;  3FAI A;  5AXO A;  4TYF A;  2AZ4 A;  4NQ6 A;  5ACT A;  5A5Z A;  1VGN A;  2YNU A;  2BG8 A;  4EYF A;  5LS3 A;  3PY6 A;  5FQC A;  2P4Z A;  2YCB A;  2OHJ A;  4KEP A;  2GCU A;  1KR3 A;  4EYL A;  2VW8 A;  3AJ3 A;  2BG2 A;  4D02 A;  1YCG A;  4D1T A;  2R2D A;  3IEM A;  3I13 A;  4J5F A;  2FU6 A;  3BK2 A;  1DXK A;  3X30 A;  2M5D A;  3SPU A;  2QDT A;  3X2Z A;  2FHX A;  4CHL A;  2OHI A;  5AYA A;  1YCH A;  3AF6 A;  3A4Y A;  5DPX A;  3DHC A;  1JJE A;  5FQB A;  4RAW A;  4EFZ A;  5LM6 A;  4TZF A;  2UYX A;  3Q6V A;  3P2U A;  1HLK A;  1ZNB A;  4PVO A;  4TZ9 A;  4EY2 A;  1JJT A;  1BVT A;  4C1E A;  2FU9 A;  2YNW A;  3X2X A;  4YSL A;  2XF4 A;  5LCH A;  1Y44 A;  5ACX A;  3IE1 A;  3IDZ A;  2I7X A;  4FR7 A;  2P1E A;  3T3N A;  5HIP A;  3RPC A;  3IEL A;  4U4L A;  2E7Y A;  5HIQ A;  4Z5Z A;  3QH8 A;  4C1D A;  4D1V A;  2ZWR A;  4AX0 B;  2GMN A;  5HH6 A;  3IE2 A;  2Q0J A;  1MQO A;  5ACV A;  4NQ4 A;  4F6Z A;  2WHG A;  4LE6 A;  2I7T A;  4YSB A;  2DOO A;  5B15 A;  4C1C A;  2H6A A;  2OHH A;  1KO3 A;  2FU8 A;  4F6H A;  1QH3 A;  5ACS A;  4C1G A;  3H3E A;  2BTN A;  4RM5 A;  5IQK A;  3TP9 A;  4Z67 A;  4TZB A;  3I14 A;  1WUO A;  5EVK A;  2Y87 A;  4UWO B;  3S0Z A;  3MD7 A;  2BMI A;  1X8G A;  2I7V A;  3RKK A;  4V0H A;  4TYT A;  3VQZ A;  2BG6 A;  3IOF A;  2NYP A;  3ESH A;  5ACR A;  1X8H A;  3I0V A;  5EWA A;  5LSC A;  2WYL A;  2YNT B;  4EXY A;  2BFZ B;  3F9O A;  4O98 A;  2ZO4 A;  1BMC A;  3KL7 A;  1X8I A;  2M5C A;  3ADR A;  3R2U A;  3PG4 A;  4XUK A;  5K4N A;  4JO0 A;  4BP0 A;  4ZO2 A;  2FK6 A;  2CBN A;  2ZZI A;  3T3O A;  2QJS A;  5AEB A;  3I15 A;  5K4K A;  5FQA A;  4YSK A;  3RKJ A;  2NXA A;  5B1U A;  4HL2 A;  2QIN A;  2WYM C;  4UWR B;  5KIK A;  3ZWF A;  1XTO A;  4J5H A;  4C09 A;  4AX1 B;  5AXR A;  3BV6 A;  1DD6 A;  5A0V A;  4C1F A;  4D1U A;  4NQ5 A;  4P62 A;  5HIS A;  1VME A;  2FU7 A;  3IE0 A;  5K4M A;  5EVD A;  4UWS B;  5ACP A;  4FEK A;  4UBQ A;  4DIK A;  4XWW A;  3DH8 A;  3ZR9 A;  4Z6X A;  4PVT A;  4RAM A;  4ZO3 A;  1WUP A;  5A87 A;  1L9Y A;  1A7T A;  2GFK A; 
#chains in the Genus database with same CATH topology
 3VPE A;  1DDK A;  2CFZ A;  4XWT A;  2YNT A;  4GYQ A;  1A8T A;  2BFZ A;  2Q0I A;  3KNR A;  4DIL A;  4EXS A;  4ZNB A;  5HH5 A;  4GYU A;  2CFU A;  2GFJ A;  1BC2 A;  1ZTC A;  2Y8A A;  2QDS A;  1KO2 A;  3T9M A;  2YZ3 A;  5A0T A;  1P9E A;  3I11 A;  3AF5 A;  5KIL A;  3BK1 A;  3SBL A;  5LCA A;  4UA4 A;  2BIB A;  3IOG A;  5ACW A;  3BC2 A;  1M2X A;  3SD9 A;  2QED A;  5EH9 A;  2Q42 A;  5EV6 A;  5EW0 A;  4Z60 A;  2FM6 A;  1XM8 A;  4C1H A;  5A23 A;  3DHB A;  1JT1 A;  4AWZ A;  2GKL A;  4EYB A;  5LLD A;  2WRS A;  5LCF A;  4B87 A;  3SFP A;  2HB9 A;  4HL1 A;  3FCZ A;  1VJN A;  1E5D A;  3KNS A;  2BR6 A;  2BGA A;  2A7M A;  1K07 A;  2YNV B;  3ZQ4 A;  2DKF A;  3PY5 A;  4UAM A;  3SRX A;  1QH5 A;  1SML A;  3X2Y A;  2CG3 A;  2NZF A;  5ACQ A;  3JXP A;  4FSB A;  1ZKP A;  3WXC A;  5AJL A;  5ACU A;  4HKY A;  4RBS A;  5LMC A;  5AHR A;  5LE1 A;  4KEQ A;  5B3R A;  5EV8 A;  4Z7R A;  4WD6 A;  3LVZ A;  1WW1 A;  4ZEJ A;  2BG8 B;  4TZE A;  3G1P A;  5K0W A;  2P18 A;  2BG7 A;  5EHT A;  2XR1 A;  4Z5Y A;  4AWY B;  3IEK A;  1YCF A;  4NQ2 A;  2WYM A;  5EVB A;  5HH4 A;  4D1W A;  5AHO A;  2BC2 A;  3SW3 A;  4BZ3 A;  3L6N A;  2NZE A;  5HIO A;  4GCW A;  4RL2 A;  1WRA A;  2BFL A;  4H0D A;  2FHX B;  4AD9 A;  2ZNB A;  2AIO A;  2Y8B A;  2Q9U A;  2P97 A;  2YNV A;  2BFK A;  3DHA A;  4UWP B;  4RL0 A;  3ZNB A;  3FAI A;  5AXO A;  4TYF A;  2AZ4 A;  4NQ6 A;  5ACT A;  5A5Z A;  1VGN A;  2YNU A;  2BG8 A;  4EYF A;  5LS3 A;  3PY6 A;  5FQC A;  2P4Z A;  2YCB A;  2OHJ A;  4KEP A;  2GCU A;  1KR3 A;  4EYL A;  2VW8 A;  3AJ3 A;  2BG2 A;  4D02 A;  1YCG A;  4D1T A;  2R2D A;  3IEM A;  3I13 A;  4J5F A;  2FU6 A;  3BK2 A;  1DXK A;  3X30 A;  2M5D A;  3SPU A;  2QDT A;  3X2Z A;  2FHX A;  4CHL A;  2OHI A;  5AYA A;  1YCH A;  4NUR A;  3AF6 A;  3A4Y A;  5DPX A;  3DHC A;  1JJE A;  5FQB A;  4RAW A;  4EFZ A;  5LM6 A;  4TZF A;  2UYX A;  3Q6V A;  3P2U A;  1HLK A;  1ZNB A;  4PVO A;  4TZ9 A;  4EY2 A;  1JJT A;  1BVT A;  4C1E A;  2FU9 A;  2YNW A;  3X2X A;  4YSL A;  2XF4 A;  5LCH A;  1Y44 A;  5ACX A;  3IE1 A;  3IDZ A;  2I7X A;  4FR7 A;  2P1E A;  3T3N A;  5HIP A;  3RPC A;  3IEL A;  4U4L A;  2E7Y A;  5HIQ A;  4Z5Z A;  3QH8 A;  4C1D A;  4D1V A;  2ZWR A;  4AV7 A;  4AX0 B;  2GMN A;  5HH6 A;  3IE2 A;  2Q0J A;  1MQO A;  5ACV A;  4NQ4 A;  4F6Z A;  2WHG A;  4LE6 A;  2I7T A;  4YSB A;  2DOO A;  5B15 A;  4C1C A;  4AXH A;  2H6A A;  2OHH A;  1KO3 A;  2FU8 A;  4F6H A;  1QH3 A;  5ACS A;  4C1G A;  3H3E A;  2BTN A;  4RM5 A;  5IQK A;  3TP9 A;  4Z67 A;  4TZB A;  3I14 A;  1WUO A;  5EVK A;  2Y87 A;  4UWO B;  3S0Z A;  3MD7 A;  2BMI A;  1X8G A;  2I7V A;  3RKK A;  4V0H A;  4TYT A;  3VQZ A;  2BG6 A;  3IOF A;  2NYP A;  3ESH A;  5ACR A;  1X8H A;  3I0V A;  5EWA A;  5LSC A;  2WYL A;  2YNT B;  4EXY A;  2BFZ B;  3F9O A;  4O98 A;  2ZO4 A;  1BMC A;  3KL7 A;  1X8I A;  2M5C A;  3ADR A;  3R2U A;  3PG4 A;  4XUK A;  5K4N A;  4JO0 A;  4BP0 A;  4ZO2 A;  2FK6 A;  2CBN A;  2ZZI A;  3T3O A;  2QJS A;  5AEB A;  3I15 A;  5K4K A;  5FQA A;  4YSK A;  3RKJ A;  2NXA A;  5B1U A;  4HL2 A;  2QIN A;  2WYM C;  4UWR B;  5KIK A;  3ZWF A;  1XTO A;  4J5H A;  4C09 A;  4AX1 B;  5AXR A;  3BV6 A;  1DD6 A;  5A0V A;  4C1F A;  4D1U A;  4NQ5 A;  4P62 A;  5HIS A;  1VME A;  2FU7 A;  3IE0 A;  5K4M A;  5EVD A;  4UWS B;  2YHE A;  5ACP A;  4FEK A;  4UBQ A;  4PDX A;  4DIK A;  4XWW A;  3DH8 A;  2CG2 A;  3ZR9 A;  4Z6X A;  4PVT A;  4RAM A;  4ZO3 A;  1WUP A;  5A87 A;  1L9Y A;  5AIJ A;  1A7T A;  2GFK A; 
#chains in the Genus database with same CATH homology
 3VPE A;  1DDK A;  4XWT A;  2YNT A;  4GYQ A;  1A8T A;  2BFZ A;  2Q0I A;  3KNR A;  4DIL A;  4EXS A;  4ZNB A;  5HH5 A;  4GYU A;  2GFJ A;  1BC2 A;  1ZTC A;  2Y8A A;  2QDS A;  1KO2 A;  3T9M A;  2YZ3 A;  5A0T A;  1P9E A;  3I11 A;  3AF5 A;  5KIL A;  3BK1 A;  3SBL A;  5LCA A;  4UA4 A;  2BIB A;  3IOG A;  5ACW A;  3BC2 A;  1M2X A;  3SD9 A;  2QED A;  5EH9 A;  2Q42 A;  5EV6 A;  5EW0 A;  4Z60 A;  2FM6 A;  1XM8 A;  4C1H A;  3DHB A;  1JT1 A;  4AWZ A;  2GKL A;  4EYB A;  5LLD A;  2WRS A;  5LCF A;  4B87 A;  3SFP A;  2HB9 A;  4HL1 A;  3FCZ A;  1VJN A;  1E5D A;  3KNS A;  2BR6 A;  2BGA A;  2A7M A;  1K07 A;  2YNV B;  3ZQ4 A;  2DKF A;  3PY5 A;  4UAM A;  3SRX A;  1QH5 A;  1SML A;  3X2Y A;  2NZF A;  5ACQ A;  3JXP A;  4FSB A;  1ZKP A;  3WXC A;  5ACU A;  4HKY A;  4RBS A;  5LMC A;  5AHR A;  5LE1 A;  4KEQ A;  5B3R A;  5EV8 A;  4Z7R A;  4WD6 A;  3LVZ A;  1WW1 A;  4ZEJ A;  2BG8 B;  4TZE A;  3G1P A;  5K0W A;  2P18 A;  2BG7 A;  5EHT A;  2XR1 A;  4Z5Y A;  4AWY B;  3IEK A;  1YCF A;  4NQ2 A;  2WYM A;  5EVB A;  5HH4 A;  4D1W A;  5AHO A;  2BC2 A;  3SW3 A;  4BZ3 A;  3L6N A;  2NZE A;  5HIO A;  4GCW A;  4RL2 A;  1WRA A;  2BFL A;  4H0D A;  2FHX B;  4AD9 A;  2ZNB A;  2AIO A;  2Y8B A;  2Q9U A;  2P97 A;  2YNV A;  2BFK A;  3DHA A;  4UWP B;  4RL0 A;  3ZNB A;  3FAI A;  5AXO A;  4TYF A;  2AZ4 A;  4NQ6 A;  5ACT A;  5A5Z A;  1VGN A;  2YNU A;  2BG8 A;  4EYF A;  5LS3 A;  3PY6 A;  5FQC A;  2P4Z A;  2YCB A;  2OHJ A;  4KEP A;  2GCU A;  1KR3 A;  4EYL A;  2VW8 A;  3AJ3 A;  2BG2 A;  4D02 A;  1YCG A;  4D1T A;  2R2D A;  3IEM A;  3I13 A;  4J5F A;  2FU6 A;  3BK2 A;  1DXK A;  3X30 A;  2M5D A;  3SPU A;  2QDT A;  3X2Z A;  2FHX A;  4CHL A;  2OHI A;  5AYA A;  1YCH A;  3AF6 A;  3A4Y A;  5DPX A;  3DHC A;  1JJE A;  5FQB A;  4RAW A;  4EFZ A;  5LM6 A;  4TZF A;  2UYX A;  3Q6V A;  3P2U A;  1HLK A;  1ZNB A;  4PVO A;  4TZ9 A;  4EY2 A;  1JJT A;  1BVT A;  4C1E A;  2FU9 A;  2YNW A;  3X2X A;  4YSL A;  2XF4 A;  5LCH A;  1Y44 A;  5ACX A;  3IE1 A;  3IDZ A;  2I7X A;  4FR7 A;  2P1E A;  3T3N A;  5HIP A;  3RPC A;  3IEL A;  4U4L A;  2E7Y A;  5HIQ A;  4Z5Z A;  3QH8 A;  4C1D A;  4D1V A;  2ZWR A;  4AX0 B;  2GMN A;  5HH6 A;  3IE2 A;  2Q0J A;  1MQO A;  5ACV A;  4NQ4 A;  4F6Z A;  2WHG A;  4LE6 A;  2I7T A;  4YSB A;  2DOO A;  5B15 A;  4C1C A;  2H6A A;  2OHH A;  1KO3 A;  2FU8 A;  4F6H A;  1QH3 A;  5ACS A;  4C1G A;  3H3E A;  2BTN A;  4RM5 A;  5IQK A;  3TP9 A;  4Z67 A;  4TZB A;  3I14 A;  1WUO A;  5EVK A;  2Y87 A;  4UWO B;  3S0Z A;  3MD7 A;  2BMI A;  1X8G A;  2I7V A;  3RKK A;  4V0H A;  4TYT A;  3VQZ A;  2BG6 A;  3IOF A;  2NYP A;  3ESH A;  5ACR A;  1X8H A;  3I0V A;  5EWA A;  5LSC A;  2WYL A;  2YNT B;  4EXY A;  2BFZ B;  3F9O A;  4O98 A;  2ZO4 A;  1BMC A;  3KL7 A;  1X8I A;  2M5C A;  3ADR A;  3R2U A;  3PG4 A;  4XUK A;  5K4N A;  4JO0 A;  4BP0 A;  4ZO2 A;  2FK6 A;  2CBN A;  2ZZI A;  3T3O A;  2QJS A;  5AEB A;  3I15 A;  5K4K A;  5FQA A;  4YSK A;  3RKJ A;  2NXA A;  5B1U A;  4HL2 A;  2QIN A;  2WYM C;  4UWR B;  5KIK A;  3ZWF A;  1XTO A;  4J5H A;  4C09 A;  4AX1 B;  5AXR A;  3BV6 A;  1DD6 A;  5A0V A;  4C1F A;  4D1U A;  4NQ5 A;  4P62 A;  5HIS A;  1VME A;  2FU7 A;  3IE0 A;  5K4M A;  5EVD A;  4UWS B;  5ACP A;  4FEK A;  4UBQ A;  4DIK A;  4XWW A;  3DH8 A;  3ZR9 A;  4Z6X A;  4PVT A;  4RAM A;  4ZO3 A;  1WUP A;  5A87 A;  1L9Y A;  1A7T A;  2GFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...