2A7MA

1.6 angstrom resolution structure of the quorum-quenching n-acyl homoserine lactone hydrolase of bacillus thuringiensis
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
250
structure length
250
Chain Sequence
MTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIETEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acyl homoserine lactone hydrolase
publication title Three-dimensional structure of the quorum-quenching N-acyl homoserine lactone hydrolase from Bacillus thuringiensis
pubmed doi rcsb
source organism Bacillus thuringiensis serovar kurstaki
molecule tags Hydrolase
total genus 77
structure length 250
sequence length 250
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2005-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2a7mA01
5ACTA 5B1UA 3TP9A 5HH6A 1M2XA 1DDKA 1QH3A 1VJNA 4D1VA 4BP0A 2YNTA 5ACRA 2FU8A 2ZNBA 4U4LA 4TYTA 4EFZA 4C09A 3KL7A 4C1CA 2Q0JA 2HB9A 3VQZA 3ESHA 5KIKA 2BFKA 5EVBA 2P4ZA 4EYFA 4EYBA 1DD6A 4AX0B 1KO2A 5KILA 2YNVA 3SPUA 3A4YA 2DKFA 2ZO4A 2BC2A 3T3OA 2BFLA 3T9MA 2FHXA 4NQ5A 2AIOA 1VGNA 4NQ4A 5LLDA 4UWSB 4JO0A 2NYPA 4FEKA 3DHAA 1X8GA 4AD9A 2BGAA 2OHJA 2WHGA 2GFKA 4GCWA 2I7XA 3SW3A 5LS3A 2YZ3A 4YSLA 3IE1A 2Y8BA 4TZ9A 3FCZA 2OHHA 1QH5A 3X2YA 4Z60A 4EXYA 2GKLA 5LCHA 4C1GA 3SFPA 2A7MA 3MD7A 1JT1A 5ACQA 1E5DA 5ACSA 2ZZIA 2Y8AA 2BR6A 2WYMA 2BG6A 3PG4A 2YCBA 3IOGA 1K07A 3KNRA 5LCFA 4TZBA 5EVKA 2XF4A 4UWRB 1WW1A 5K0WA 5AEBA 4UBQA 4UWPB 1DXKA 4HKYA 4TZFA 5HISA 3BC2A 4C1EA 3BK1A 2GMNA 3WXCA 1KO3A 4HL2A 4AWZA 4BZ3A 2CBNA 3BK2A 3I15A 4GYUA 4HL1A 3QH8A 4P62A 4EY2A 1MQOA 3RKJA 5EW0A 5ACPA 1SMLA 2QDTA 4J5HA 3IEKA 3S0ZA 3I14A 2P18A 3IE2A 3F9OA 3DHBA 2R2DA 1BC2A 5LCAA 4XWWA 4D1TA 3H3EA 4NQ6A 4D02A 5A0TA 4O98A 5B15A 2I7VA 3SD9A 4D1WA 2I7TA 1KR3A 3I11A 3ZR9A 2M5DA 4J5FA 4CHLA 4AX1B 4KEPA 5LMCA 2XR1A 1BVTA 2FU6A 2BG7A 3BV6A 4RL2A 4Z5YA 5EV8A 5FQCA 5ACWA 4EYLA 2UYXA 4WD6A 5A0VA 5EWAA 3VPEA 4B87A 3G1PA 2BMIA 1YCHA 1ZKPA 5HH4A 5FQAA 4FSBA 2FK6A 4PVTA 5HH5A 2H6AA 2WYMC 5AXRA 3PY6A 4KEQA 5HIOA 4YSBA 5K4KA 1A7TA 4PVOA 3P2UA 4Z7RA 1JJTA 4RL0A 2OHIA 5HIQA 5IQKA 4C1FA 3RPCA 1YCFA 2YNUA 4LE6A 4Z67A 1X8IA 2NZEA 2BG8B 4Z6XA 4RBSA 1P9EA 3AF6A 2ZWRA 3DH8A 2E7YA 2Q42A 2FU9A 5ACUA 4DILA 4H0DA 2BG8A 5K4NA 3AJ3A 2P97A 3FAIA 5HIPA 2WYLA 2VW8A 4YSKA 3R2UA 3RKKA 2BTNA 1VMEA 3KNSA 2QDSA 5EV6A 5DPXA 2M5CA 2GCUA 1JJEA 2DOOA 4ZO3A 2YNTB 4UAMA 2BIBA 3JXPA 1BMCA 1WUOA 2BFZB 2NXAA 4TZEA 1ZTCA 3IE0A 4EXSA 4F6ZA 4RAMA 5A87A 3I0VA 3IDZA 5FQBA 4FR7A 5AHRA 1HLKA 3AF5A 5A5ZA 4XWTA 4ZNBA 4V0HA 2YNVB 4RAWA 2FM6A 5AHOA 1X8HA 2BFZA 4D1UA 3SRXA 1YCGA 4RM5A 5LM6A 2FHXB 3ZWFA 2GFJA 4UA4A 2YNWA 3PY5A 3I13A 5ACVA 1L9YA 5EH9A 1XM8A 2QJSA 3IELA 3IOFA 1WUPA 3X2XA 3X30A 5LE1A 1ZNBA 4C1HA 3Q6VA 3X2ZA 2Y87A 4ZO2A 5B3RA 3L6NA 2AZ4A 4C1DA 2NZFA 2Q9UA 1XTOA 2WRSA 3ZQ4A 3ZNBA 4UWOB 3LVZA 5LSCA 2FU7A 5EVDA 2P1EA 4DIKA 4AWYB 4GYQA 5EHTA 5AXOA 1Y44A 3SBLA 5AYAA 1A8TA 4TYFA 4ZEJA 4XUKA 2BG2A 5K4MA 1WRAA 3IEMA 3DHCA 3ADRA 3T3NA 4F6HA 5ACXA 4Z5ZA 2QEDA 2QINA 4NQ2A 2Q0IA
chains in the Genus database with same CATH superfamily
5ACTA 5B1UA 3TP9A 5HH6A 1M2XA 1DDKA 1QH3A 1VJNA 4D1VA 4BP0A 2YNTA 5ACRA 2FU8A 2ZNBA 4U4LA 2CFZA 4TYTA 4EFZA 4C09A 3KL7A 4C1CA 2Q0JA 2HB9A 3VQZA 3ESHA 5KIKA 2BFKA 5EVBA 4AXHA 2P4ZA 4EYFA 4EYBA 1DD6A 4AX0B 1KO2A 5KILA 2YNVA 3SPUA 3A4YA 2DKFA 2ZO4A 2BC2A 3T3OA 2BFLA 3T9MA 2FHXA 4NQ5A 2AIOA 1VGNA 4NQ4A 5LLDA 4UWSB 4JO0A 2NYPA 4PDXA 4FEKA 3DHAA 1X8GA 4AD9A 2BGAA 2OHJA 2WHGA 2GFKA 4GCWA 2I7XA 3SW3A 5LS3A 2YZ3A 4YSLA 3IE1A 2CG2A 2Y8BA 4TZ9A 3FCZA 2OHHA 1QH5A 3X2YA 4Z60A 4EXYA 2GKLA 5LCHA 4C1GA 3SFPA 2A7MA 3MD7A 1JT1A 5ACQA 1E5DA 5ACSA 2ZZIA 2Y8AA 2BR6A 2WYMA 2BG6A 3PG4A 2YCBA 3IOGA 1K07A 3KNRA 5LCFA 4TZBA 5EVKA 2XF4A 4UWRB 1WW1A 5K0WA 5AEBA 4UBQA 4UWPB 1DXKA 4HKYA 4TZFA 5HISA 3BC2A 4C1EA 3BK1A 5AJLA 2GMNA 3WXCA 1KO3A 4HL2A 4AWZA 4BZ3A 2CBNA 3BK2A 3I15A 4GYUA 4HL1A 3QH8A 4P62A 4EY2A 1MQOA 3RKJA 5EW0A 5ACPA 1SMLA 2QDTA 4J5HA 3IEKA 3S0ZA 3I14A 2P18A 3IE2A 3F9OA 3DHBA 2R2DA 1BC2A 5LCAA 4XWWA 4D1TA 3H3EA 4NQ6A 4D02A 5A0TA 4O98A 5B15A 2I7VA 3SD9A 4D1WA 2I7TA 1KR3A 3I11A 3ZR9A 5AIJA 2M5DA 4J5FA 4CHLA 4AX1B 4KEPA 5LMCA 2XR1A 1BVTA 2FU6A 2BG7A 3BV6A 4RL2A 4Z5YA 5EV8A 5FQCA 5ACWA 4EYLA 2UYXA 4WD6A 5A0VA 5EWAA 3VPEA 4B87A 3G1PA 2BMIA 1YCHA 1ZKPA 5HH4A 5FQAA 4FSBA 5A23A 2FK6A 4PVTA 5HH5A 2H6AA 2WYMC 5AXRA 3PY6A 4KEQA 5HIOA 4YSBA 5K4KA 1A7TA 4PVOA 3P2UA 4Z7RA 1JJTA 4RL0A 2OHIA 5HIQA 5IQKA 4C1FA 2YHEA 3RPCA 1YCFA 2YNUA 4LE6A 4Z67A 1X8IA 2NZEA 2BG8B 4Z6XA 4RBSA 1P9EA 3AF6A 2ZWRA 3DH8A 2E7YA 2Q42A 2FU9A 5ACUA 4DILA 4H0DA 2BG8A 5K4NA 3AJ3A 2P97A 3FAIA 5HIPA 2WYLA 2VW8A 4YSKA 3R2UA 3RKKA 2BTNA 1VMEA 3KNSA 2QDSA 5EV6A 5DPXA 2M5CA 2GCUA 1JJEA 2DOOA 4ZO3A 2YNTB 4UAMA 2BIBA 3JXPA 1BMCA 1WUOA 2BFZB 2NXAA 4TZEA 1ZTCA 3IE0A 4EXSA 4F6ZA 4RAMA 5A87A 3I0VA 3IDZA 2CFUA 4FR7A 5FQBA 5AHRA 1HLKA 3AF5A 5A5ZA 4XWTA 4ZNBA 4V0HA 2YNVB 4RAWA 2FM6A 5AHOA 1X8HA 2BFZA 4D1UA 3SRXA 1YCGA 4RM5A 5LM6A 2FHXB 3ZWFA 2GFJA 4UA4A 2YNWA 3PY5A 3I13A 5ACVA 1L9YA 5EH9A 1XM8A 2QJSA 3IELA 3IOFA 1WUPA 3X2XA 3X30A 5LE1A 1ZNBA 4C1HA 3Q6VA 3X2ZA 2Y87A 4ZO2A 5B3RA 3L6NA 2AZ4A 4C1DA 2NZFA 2Q9UA 1XTOA 2WRSA 3ZQ4A 3ZNBA 4UWOB 3LVZA 5LSCA 2FU7A 5EVDA 2P1EA 4DIKA 4AWYB 4GYQA 5EHTA 5AXOA 1Y44A 3SBLA 5AYAA 1A8TA 4TYFA 4ZEJA 4XUKA 2CG3A 4AV7A 2BG2A 5K4MA 1WRAA 4NURA 3IEMA 3DHCA 3ADRA 3T3NA 4F6HA 5ACXA 4Z5ZA 2QEDA 2QINA 4NQ2A 2Q0IA
chains in the Genus database with same CATH topology
5ACTA 5B1UA 3TP9A 5HH6A 1M2XA 1DDKA 1QH3A 1VJNA 4D1VA 4BP0A 2YNTA 5ACRA 2FU8A 2ZNBA 4U4LA 4TYTA 4EFZA 4C09A 3KL7A 4C1CA 2Q0JA 2HB9A 3VQZA 3ESHA 5KIKA 2BFKA 5EVBA 2P4ZA 4EYFA 4EYBA 1DD6A 4AX0B 1KO2A 5KILA 2YNVA 3SPUA 3A4YA 2DKFA 2ZO4A 2BC2A 3T3OA 2BFLA 3T9MA 2FHXA 4NQ5A 2AIOA 1VGNA 4NQ4A 5LLDA 4UWSB 4JO0A 2NYPA 4FEKA 3DHAA 1X8GA 4AD9A 2BGAA 2OHJA 2WHGA 2GFKA 4GCWA 2I7XA 3SW3A 5LS3A 2YZ3A 4YSLA 3IE1A 2Y8BA 4TZ9A 3FCZA 2OHHA 1QH5A 3X2YA 4Z60A 4EXYA 2GKLA 5LCHA 4C1GA 3SFPA 2A7MA 3MD7A 1JT1A 5ACQA 1E5DA 5ACSA 2ZZIA 2Y8AA 2BR6A 2WYMA 2BG6A 3PG4A 2YCBA 3IOGA 1K07A 3KNRA 5LCFA 4TZBA 5EVKA 2XF4A 4UWRB 1WW1A 5K0WA 5AEBA 4UBQA 4UWPB 1DXKA 4HKYA 4TZFA 5HISA 3BC2A 4C1EA 3BK1A 2GMNA 3WXCA 1KO3A 4HL2A 4AWZA 4BZ3A 2CBNA 3BK2A 3I15A 4GYUA 4HL1A 3QH8A 4P62A 4EY2A 1MQOA 3RKJA 5EW0A 5ACPA 1SMLA 2QDTA 4J5HA 3IEKA 3S0ZA 3I14A 2P18A 3IE2A 3F9OA 3DHBA 2R2DA 1BC2A 5LCAA 4XWWA 4D1TA 3H3EA 4NQ6A 4D02A 5A0TA 4O98A 5B15A 2I7VA 3SD9A 4D1WA 2I7TA 1KR3A 3I11A 3ZR9A 2M5DA 4J5FA 4CHLA 4AX1B 4KEPA 5LMCA 2XR1A 1BVTA 2FU6A 2BG7A 3BV6A 4RL2A 4Z5YA 5EV8A 5FQCA 5ACWA 4EYLA 2UYXA 4WD6A 5A0VA 5EWAA 3VPEA 4B87A 3G1PA 2BMIA 1YCHA 1ZKPA 5HH4A 5FQAA 4FSBA 2FK6A 4PVTA 5HH5A 2H6AA 2WYMC 5AXRA 3PY6A 4KEQA 5HIOA 4YSBA 5K4KA 1A7TA 4PVOA 3P2UA 4Z7RA 1JJTA 4RL0A 2OHIA 5HIQA 5IQKA 4C1FA 3RPCA 1YCFA 2YNUA 4LE6A 4Z67A 1X8IA 2NZEA 2BG8B 4Z6XA 4RBSA 1P9EA 3AF6A 2ZWRA 3DH8A 2E7YA 2Q42A 2FU9A 5ACUA 4DILA 4H0DA 2BG8A 5K4NA 3AJ3A 2P97A 3FAIA 5HIPA 2WYLA 2VW8A 4YSKA 3R2UA 3RKKA 2BTNA 1VMEA 3KNSA 2QDSA 5EV6A 5DPXA 2M5CA 2GCUA 1JJEA 2DOOA 4ZO3A 2YNTB 4UAMA 2BIBA 3JXPA 1BMCA 1WUOA 2BFZB 2NXAA 4TZEA 1ZTCA 3IE0A 4EXSA 4F6ZA 4RAMA 5A87A 3I0VA 3IDZA 5FQBA 4FR7A 5AHRA 1HLKA 3AF5A 5A5ZA 4XWTA 4ZNBA 4V0HA 2YNVB 4RAWA 2FM6A 5AHOA 1X8HA 2BFZA 4D1UA 3SRXA 1YCGA 4RM5A 5LM6A 2FHXB 3ZWFA 2GFJA 4UA4A 2YNWA 3PY5A 3I13A 5ACVA 1L9YA 5EH9A 1XM8A 2QJSA 3IELA 3IOFA 1WUPA 3X2XA 3X30A 5LE1A 1ZNBA 4C1HA 3Q6VA 3X2ZA 2Y87A 4ZO2A 5B3RA 3L6NA 2AZ4A 4C1DA 2NZFA 2Q9UA 1XTOA 2WRSA 3ZQ4A 3ZNBA 4UWOB 3LVZA 5LSCA 2FU7A 5EVDA 2P1EA 4DIKA 4AWYB 4GYQA 5EHTA 5AXOA 1Y44A 3SBLA 5AYAA 1A8TA 4TYFA 4ZEJA 4XUKA 2BG2A 5K4MA 1WRAA 3IEMA 3DHCA 3ADRA 3T3NA 4F6HA 5ACXA 4Z5ZA 2QEDA 2QINA 4NQ2A 2Q0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ACT A;  5B1U A;  3TP9 A;  5HH6 A;  1M2X A;  1DDK A;  1QH3 A;  1VJN A;  4D1V A;  4BP0 A;  2YNT A;  5ACR A;  2FU8 A;  2ZNB A;  4U4L A;  4TYT A;  4EFZ A;  4C09 A;  3KL7 A;  4C1C A;  2Q0J A;  2HB9 A;  3VQZ A;  3ESH A;  5KIK A;  2BFK A;  5EVB A;  2P4Z A;  4EYF A;  4EYB A;  1DD6 A;  4AX0 B;  1KO2 A;  5KIL A;  2YNV A;  3SPU A;  3A4Y A;  2DKF A;  2ZO4 A;  2BC2 A;  3T3O A;  2BFL A;  3T9M A;  2FHX A;  4NQ5 A;  2AIO A;  1VGN A;  4NQ4 A;  5LLD A;  4UWS B;  4JO0 A;  2NYP A;  4FEK A;  3DHA A;  1X8G A;  4AD9 A;  2BGA A;  2OHJ A;  2WHG A;  2GFK A;  4GCW A;  2I7X A;  3SW3 A;  5LS3 A;  2YZ3 A;  4YSL A;  3IE1 A;  2Y8B A;  4TZ9 A;  3FCZ A;  2OHH A;  1QH5 A;  3X2Y A;  4Z60 A;  4EXY A;  2GKL A;  5LCH A;  4C1G A;  3SFP A;  2A7M A;  3MD7 A;  1JT1 A;  5ACQ A;  1E5D A;  5ACS A;  2ZZI A;  2Y8A A;  2BR6 A;  2WYM A;  2BG6 A;  3PG4 A;  2YCB A;  3IOG A;  1K07 A;  3KNR A;  5LCF A;  4TZB A;  5EVK A;  2XF4 A;  4UWR B;  1WW1 A;  5K0W A;  5AEB A;  4UBQ A;  4UWP B;  1DXK A;  4HKY A;  4TZF A;  5HIS A;  3BC2 A;  4C1E A;  3BK1 A;  2GMN A;  3WXC A;  1KO3 A;  4HL2 A;  4AWZ A;  4BZ3 A;  2CBN A;  3BK2 A;  3I15 A;  4GYU A;  4HL1 A;  3QH8 A;  4P62 A;  4EY2 A;  1MQO A;  3RKJ A;  5EW0 A;  5ACP A;  1SML A;  2QDT A;  4J5H A;  3IEK A;  3S0Z A;  3I14 A;  2P18 A;  3IE2 A;  3F9O A;  3DHB A;  2R2D A;  1BC2 A;  5LCA A;  4XWW A;  4D1T A;  3H3E A;  4NQ6 A;  4D02 A;  5A0T A;  4O98 A;  5B15 A;  2I7V A;  3SD9 A;  4D1W A;  2I7T A;  1KR3 A;  3I11 A;  3ZR9 A;  2M5D A;  4J5F A;  4CHL A;  4AX1 B;  4KEP A;  5LMC A;  2XR1 A;  1BVT A;  2FU6 A;  2BG7 A;  3BV6 A;  4RL2 A;  4Z5Y A;  5EV8 A;  5FQC A;  5ACW A;  4EYL A;  2UYX A;  4WD6 A;  5A0V A;  5EWA A;  3VPE A;  4B87 A;  3G1P A;  2BMI A;  1YCH A;  1ZKP A;  5HH4 A;  5FQA A;  4FSB A;  2FK6 A;  4PVT A;  5HH5 A;  2H6A A;  2WYM C;  5AXR A;  3PY6 A;  4KEQ A;  5HIO A;  4YSB A;  5K4K A;  1A7T A;  4PVO A;  3P2U A;  4Z7R A;  1JJT A;  4RL0 A;  2OHI A;  5HIQ A;  5IQK A;  4C1F A;  3RPC A;  1YCF A;  2YNU A;  4LE6 A;  4Z67 A;  1X8I A;  2NZE A;  2BG8 B;  4Z6X A;  4RBS A;  1P9E A;  3AF6 A;  2ZWR A;  3DH8 A;  2E7Y A;  2Q42 A;  2FU9 A;  5ACU A;  4DIL A;  4H0D A;  2BG8 A;  5K4N A;  3AJ3 A;  2P97 A;  3FAI A;  5HIP A;  2WYL A;  2VW8 A;  4YSK A;  3R2U A;  3RKK A;  2BTN A;  1VME A;  3KNS A;  2QDS A;  5EV6 A;  5DPX A;  2M5C A;  2GCU A;  1JJE A;  2DOO A;  4ZO3 A;  2YNT B;  4UAM A;  2BIB A;  3JXP A;  1BMC A;  1WUO A;  2BFZ B;  2NXA A;  4TZE A;  1ZTC A;  3IE0 A;  4EXS A;  4F6Z A;  4RAM A;  5A87 A;  3I0V A;  3IDZ A;  5FQB A;  4FR7 A;  5AHR A;  1HLK A;  3AF5 A;  5A5Z A;  4XWT A;  4ZNB A;  4V0H A;  2YNV B;  4RAW A;  2FM6 A;  5AHO A;  1X8H A;  2BFZ A;  4D1U A;  3SRX A;  1YCG A;  4RM5 A;  5LM6 A;  2FHX B;  3ZWF A;  2GFJ A;  4UA4 A;  2YNW A;  3PY5 A;  3I13 A;  5ACV A;  1L9Y A;  5EH9 A;  1XM8 A;  2QJS A;  3IEL A;  3IOF A;  1WUP A;  3X2X A;  3X30 A;  5LE1 A;  1ZNB A;  4C1H A;  3Q6V A;  3X2Z A;  2Y87 A;  4ZO2 A;  5B3R A;  3L6N A;  2AZ4 A;  4C1D A;  2NZF A;  2Q9U A;  1XTO A;  2WRS A;  3ZQ4 A;  3ZNB A;  4UWO B;  3LVZ A;  5LSC A;  2FU7 A;  5EVD A;  2P1E A;  4DIK A;  4AWY B;  4GYQ A;  5EHT A;  5AXO A;  1Y44 A;  3SBL A;  5AYA A;  1A8T A;  4TYF A;  4ZEJ A;  4XUK A;  2BG2 A;  5K4M A;  1WRA A;  3IEM A;  3DHC A;  3ADR A;  3T3N A;  4F6H A;  5ACX A;  4Z5Z A;  2QED A;  2QIN A;  4NQ2 A;  2Q0I A; 
#chains in the Genus database with same CATH topology
 5ACT A;  5B1U A;  3TP9 A;  5HH6 A;  1M2X A;  1DDK A;  1QH3 A;  1VJN A;  4D1V A;  4BP0 A;  2YNT A;  5ACR A;  2FU8 A;  2ZNB A;  4U4L A;  2CFZ A;  4TYT A;  4EFZ A;  4C09 A;  3KL7 A;  4C1C A;  2Q0J A;  2HB9 A;  3VQZ A;  3ESH A;  5KIK A;  2BFK A;  5EVB A;  4AXH A;  2P4Z A;  4EYF A;  4EYB A;  1DD6 A;  4AX0 B;  1KO2 A;  5KIL A;  2YNV A;  3SPU A;  3A4Y A;  2DKF A;  2ZO4 A;  2BC2 A;  3T3O A;  2BFL A;  3T9M A;  2FHX A;  4NQ5 A;  2AIO A;  1VGN A;  4NQ4 A;  5LLD A;  4UWS B;  4JO0 A;  2NYP A;  4PDX A;  4FEK A;  3DHA A;  1X8G A;  4AD9 A;  2BGA A;  2OHJ A;  2WHG A;  2GFK A;  4GCW A;  2I7X A;  3SW3 A;  5LS3 A;  2YZ3 A;  4YSL A;  3IE1 A;  2CG2 A;  2Y8B A;  4TZ9 A;  3FCZ A;  2OHH A;  1QH5 A;  3X2Y A;  4Z60 A;  4EXY A;  2GKL A;  5LCH A;  4C1G A;  3SFP A;  2A7M A;  3MD7 A;  1JT1 A;  5ACQ A;  1E5D A;  5ACS A;  2ZZI A;  2Y8A A;  2BR6 A;  2WYM A;  2BG6 A;  3PG4 A;  2YCB A;  3IOG A;  1K07 A;  3KNR A;  5LCF A;  4TZB A;  5EVK A;  2XF4 A;  4UWR B;  1WW1 A;  5K0W A;  5AEB A;  4UBQ A;  4UWP B;  1DXK A;  4HKY A;  4TZF A;  5HIS A;  3BC2 A;  4C1E A;  3BK1 A;  5AJL A;  2GMN A;  3WXC A;  1KO3 A;  4HL2 A;  4AWZ A;  4BZ3 A;  2CBN A;  3BK2 A;  3I15 A;  4GYU A;  4HL1 A;  3QH8 A;  4P62 A;  4EY2 A;  1MQO A;  3RKJ A;  5EW0 A;  5ACP A;  1SML A;  2QDT A;  4J5H A;  3IEK A;  3S0Z A;  3I14 A;  2P18 A;  3IE2 A;  3F9O A;  3DHB A;  2R2D A;  1BC2 A;  5LCA A;  4XWW A;  4D1T A;  3H3E A;  4NQ6 A;  4D02 A;  5A0T A;  4O98 A;  5B15 A;  2I7V A;  3SD9 A;  4D1W A;  2I7T A;  1KR3 A;  3I11 A;  3ZR9 A;  5AIJ A;  2M5D A;  4J5F A;  4CHL A;  4AX1 B;  4KEP A;  5LMC A;  2XR1 A;  1BVT A;  2FU6 A;  2BG7 A;  3BV6 A;  4RL2 A;  4Z5Y A;  5EV8 A;  5FQC A;  5ACW A;  4EYL A;  2UYX A;  4WD6 A;  5A0V A;  5EWA A;  3VPE A;  4B87 A;  3G1P A;  2BMI A;  1YCH A;  1ZKP A;  5HH4 A;  5FQA A;  4FSB A;  5A23 A;  2FK6 A;  4PVT A;  5HH5 A;  2H6A A;  2WYM C;  5AXR A;  3PY6 A;  4KEQ A;  5HIO A;  4YSB A;  5K4K A;  1A7T A;  4PVO A;  3P2U A;  4Z7R A;  1JJT A;  4RL0 A;  2OHI A;  5HIQ A;  5IQK A;  4C1F A;  2YHE A;  3RPC A;  1YCF A;  2YNU A;  4LE6 A;  4Z67 A;  1X8I A;  2NZE A;  2BG8 B;  4Z6X A;  4RBS A;  1P9E A;  3AF6 A;  2ZWR A;  3DH8 A;  2E7Y A;  2Q42 A;  2FU9 A;  5ACU A;  4DIL A;  4H0D A;  2BG8 A;  5K4N A;  3AJ3 A;  2P97 A;  3FAI A;  5HIP A;  2WYL A;  2VW8 A;  4YSK A;  3R2U A;  3RKK A;  2BTN A;  1VME A;  3KNS A;  2QDS A;  5EV6 A;  5DPX A;  2M5C A;  2GCU A;  1JJE A;  2DOO A;  4ZO3 A;  2YNT B;  4UAM A;  2BIB A;  3JXP A;  1BMC A;  1WUO A;  2BFZ B;  2NXA A;  4TZE A;  1ZTC A;  3IE0 A;  4EXS A;  4F6Z A;  4RAM A;  5A87 A;  3I0V A;  3IDZ A;  2CFU A;  4FR7 A;  5FQB A;  5AHR A;  1HLK A;  3AF5 A;  5A5Z A;  4XWT A;  4ZNB A;  4V0H A;  2YNV B;  4RAW A;  2FM6 A;  5AHO A;  1X8H A;  2BFZ A;  4D1U A;  3SRX A;  1YCG A;  4RM5 A;  5LM6 A;  2FHX B;  3ZWF A;  2GFJ A;  4UA4 A;  2YNW A;  3PY5 A;  3I13 A;  5ACV A;  1L9Y A;  5EH9 A;  1XM8 A;  2QJS A;  3IEL A;  3IOF A;  1WUP A;  3X2X A;  3X30 A;  5LE1 A;  1ZNB A;  4C1H A;  3Q6V A;  3X2Z A;  2Y87 A;  4ZO2 A;  5B3R A;  3L6N A;  2AZ4 A;  4C1D A;  2NZF A;  2Q9U A;  1XTO A;  2WRS A;  3ZQ4 A;  3ZNB A;  4UWO B;  3LVZ A;  5LSC A;  2FU7 A;  5EVD A;  2P1E A;  4DIK A;  4AWY B;  4GYQ A;  5EHT A;  5AXO A;  1Y44 A;  3SBL A;  5AYA A;  1A8T A;  4TYF A;  4ZEJ A;  4XUK A;  2CG3 A;  4AV7 A;  2BG2 A;  5K4M A;  1WRA A;  4NUR A;  3IEM A;  3DHC A;  3ADR A;  3T3N A;  4F6H A;  5ACX A;  4Z5Z A;  2QED A;  2QIN A;  4NQ2 A;  2Q0I A; 
#chains in the Genus database with same CATH homology
 5ACT A;  5B1U A;  3TP9 A;  5HH6 A;  1M2X A;  1DDK A;  1QH3 A;  1VJN A;  4D1V A;  4BP0 A;  2YNT A;  5ACR A;  2FU8 A;  2ZNB A;  4U4L A;  4TYT A;  4EFZ A;  4C09 A;  3KL7 A;  4C1C A;  2Q0J A;  2HB9 A;  3VQZ A;  3ESH A;  5KIK A;  2BFK A;  5EVB A;  2P4Z A;  4EYF A;  4EYB A;  1DD6 A;  4AX0 B;  1KO2 A;  5KIL A;  2YNV A;  3SPU A;  3A4Y A;  2DKF A;  2ZO4 A;  2BC2 A;  3T3O A;  2BFL A;  3T9M A;  2FHX A;  4NQ5 A;  2AIO A;  1VGN A;  4NQ4 A;  5LLD A;  4UWS B;  4JO0 A;  2NYP A;  4FEK A;  3DHA A;  1X8G A;  4AD9 A;  2BGA A;  2OHJ A;  2WHG A;  2GFK A;  4GCW A;  2I7X A;  3SW3 A;  5LS3 A;  2YZ3 A;  4YSL A;  3IE1 A;  2Y8B A;  4TZ9 A;  3FCZ A;  2OHH A;  1QH5 A;  3X2Y A;  4Z60 A;  4EXY A;  2GKL A;  5LCH A;  4C1G A;  3SFP A;  2A7M A;  3MD7 A;  1JT1 A;  5ACQ A;  1E5D A;  5ACS A;  2ZZI A;  2Y8A A;  2BR6 A;  2WYM A;  2BG6 A;  3PG4 A;  2YCB A;  3IOG A;  1K07 A;  3KNR A;  5LCF A;  4TZB A;  5EVK A;  2XF4 A;  4UWR B;  1WW1 A;  5K0W A;  5AEB A;  4UBQ A;  4UWP B;  1DXK A;  4HKY A;  4TZF A;  5HIS A;  3BC2 A;  4C1E A;  3BK1 A;  2GMN A;  3WXC A;  1KO3 A;  4HL2 A;  4AWZ A;  4BZ3 A;  2CBN A;  3BK2 A;  3I15 A;  4GYU A;  4HL1 A;  3QH8 A;  4P62 A;  4EY2 A;  1MQO A;  3RKJ A;  5EW0 A;  5ACP A;  1SML A;  2QDT A;  4J5H A;  3IEK A;  3S0Z A;  3I14 A;  2P18 A;  3IE2 A;  3F9O A;  3DHB A;  2R2D A;  1BC2 A;  5LCA A;  4XWW A;  4D1T A;  3H3E A;  4NQ6 A;  4D02 A;  5A0T A;  4O98 A;  5B15 A;  2I7V A;  3SD9 A;  4D1W A;  2I7T A;  1KR3 A;  3I11 A;  3ZR9 A;  2M5D A;  4J5F A;  4CHL A;  4AX1 B;  4KEP A;  5LMC A;  2XR1 A;  1BVT A;  2FU6 A;  2BG7 A;  3BV6 A;  4RL2 A;  4Z5Y A;  5EV8 A;  5FQC A;  5ACW A;  4EYL A;  2UYX A;  4WD6 A;  5A0V A;  5EWA A;  3VPE A;  4B87 A;  3G1P A;  2BMI A;  1YCH A;  1ZKP A;  5HH4 A;  5FQA A;  4FSB A;  2FK6 A;  4PVT A;  5HH5 A;  2H6A A;  2WYM C;  5AXR A;  3PY6 A;  4KEQ A;  5HIO A;  4YSB A;  5K4K A;  1A7T A;  4PVO A;  3P2U A;  4Z7R A;  1JJT A;  4RL0 A;  2OHI A;  5HIQ A;  5IQK A;  4C1F A;  3RPC A;  1YCF A;  2YNU A;  4LE6 A;  4Z67 A;  1X8I A;  2NZE A;  2BG8 B;  4Z6X A;  4RBS A;  1P9E A;  3AF6 A;  2ZWR A;  3DH8 A;  2E7Y A;  2Q42 A;  2FU9 A;  5ACU A;  4DIL A;  4H0D A;  2BG8 A;  5K4N A;  3AJ3 A;  2P97 A;  3FAI A;  5HIP A;  2WYL A;  2VW8 A;  4YSK A;  3R2U A;  3RKK A;  2BTN A;  1VME A;  3KNS A;  2QDS A;  5EV6 A;  5DPX A;  2M5C A;  2GCU A;  1JJE A;  2DOO A;  4ZO3 A;  2YNT B;  4UAM A;  2BIB A;  3JXP A;  1BMC A;  1WUO A;  2BFZ B;  2NXA A;  4TZE A;  1ZTC A;  3IE0 A;  4EXS A;  4F6Z A;  4RAM A;  5A87 A;  3I0V A;  3IDZ A;  5FQB A;  4FR7 A;  5AHR A;  1HLK A;  3AF5 A;  5A5Z A;  4XWT A;  4ZNB A;  4V0H A;  2YNV B;  4RAW A;  2FM6 A;  5AHO A;  1X8H A;  2BFZ A;  4D1U A;  3SRX A;  1YCG A;  4RM5 A;  5LM6 A;  2FHX B;  3ZWF A;  2GFJ A;  4UA4 A;  2YNW A;  3PY5 A;  3I13 A;  5ACV A;  1L9Y A;  5EH9 A;  1XM8 A;  2QJS A;  3IEL A;  3IOF A;  1WUP A;  3X2X A;  3X30 A;  5LE1 A;  1ZNB A;  4C1H A;  3Q6V A;  3X2Z A;  2Y87 A;  4ZO2 A;  5B3R A;  3L6N A;  2AZ4 A;  4C1D A;  2NZF A;  2Q9U A;  1XTO A;  2WRS A;  3ZQ4 A;  3ZNB A;  4UWO B;  3LVZ A;  5LSC A;  2FU7 A;  5EVD A;  2P1E A;  4DIK A;  4AWY B;  4GYQ A;  5EHT A;  5AXO A;  1Y44 A;  3SBL A;  5AYA A;  1A8T A;  4TYF A;  4ZEJ A;  4XUK A;  2BG2 A;  5K4M A;  1WRA A;  3IEM A;  3DHC A;  3ADR A;  3T3N A;  4F6H A;  5ACX A;  4Z5Z A;  2QED A;  2QIN A;  4NQ2 A;  2Q0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...