2A7MA

1.6 angstrom resolution structure of the quorum-quenching n-acyl homoserine lactone hydrolase of bacillus thuringiensis
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
250
structure length
250
Chain Sequence
MTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIETEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords N-acyl homoserine lactone hydrolase
publication title Three-dimensional structure of the quorum-quenching N-acyl homoserine lactone hydrolase from Bacillus thuringiensis
pubmed doi rcsb
source organism Bacillus thuringiensis serovar kurstaki
total genus 77
structure length 250
sequence length 250
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2005-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2a7mA01
2BFZB 2H6AA 4HL1A 1KR3A 4GCWA 1KO2A 5LSCA 1WUOA 2Y8AA 5B3RA 2XR1A 3S0ZA 1QH5A 1K07A 2FU9A 2Q42A 4C1HA 2YNVA 5ACWA 4EXYA 3SRXA 3FCZA 3RKKA 3MD7A 4C1FA 4RAMA 2P1EA 5EW0A 4RL2A 5EVDA 5HISA 5ACXA 2WHGA 1A7TA 3L6NA 3ESHA 2WRSA 5A87A 5K4NA 3X2XA 4ZNBA 1DD6A 3F9OA 1DDKA 4AX0B 2A7MA 5HIPA 2GCUA 4UWRB 4XUKA 4UWOB 3IOFA 4Z5YA 5HH6A 4KEPA 3IDZA 3IOGA 1ZTCA 2Q0IA 4NQ2A 1BVTA 2P4ZA 5HH5A 1P9EA 3X2ZA 2BTNA 3DHAA 5ACRA 3KL7A 4FSBA 4NQ4A 4ZEJA 1ZNBA 5EVBA 3SW3A 3IEKA 3RKJA 4BZ3A 3SFPA 4Z7RA 2FHXA 1L9YA 1WRAA 2QINA 1X8HA 5A5ZA 1VJNA 4Z67A 1KO3A 5LCFA 4EYBA 2BC2A 3ADRA 4FR7A 4J5HA 4EFZA 2BG8A 5ACPA 2Y8BA 5LMCA 1Y44A 3IE2A 2I7XA 3T9MA 1VMEA 2BFKA 3SBLA 2M5CA 2OHHA 2BMIA 1X8IA 2NZFA 2Q0JA 2OHIA 2ZO4A 2BIBA 1YCGA 3FAIA 4D1TA 1A8TA 4ZO2A 3SPUA 3AF6A 4UA4A 3AF5A 2I7VA 3I15A 4Z60A 2OHJA 4LE6A 3DH8A 1VGNA 4YSBA 2YZ3A 4UWPB 1WW1A 2Q9UA 2DOOA 3BC2A 5B1UA 4C1GA 4C1DA 5FQAA 4EY2A 1BC2A 2M5DA 4B87A 2R2DA 4J5FA 3T3OA 2QDSA 1YCFA 2AIOA 1ZKPA 4EYLA 5ACUA 2VW8A 4C09A 2WYMC 4XWTA 5AYAA 3IE0A 5AHOA 5EHTA 3VPEA 5ACTA 4FEKA 4YSLA 2YNTA 5AXRA 1BMCA 4TZEA 3Q6VA 4PVTA 4RAWA 4RL0A 2UYXA 2I7TA 2YCBA 2XF4A 2GKLA 5LE1A 3DHBA 3I11A 4YSKA 1YCHA 3DHCA 3QH8A 4TYTA 2E7YA 4O98A 4AWYB 2QEDA 2FHXB 4F6HA 2FU8A 2NYPA 2HB9A 2BG7A 1JJTA 5LLDA 3AJ3A 1XM8A 2ZWRA 4D1UA 2P18A 5EH9A 3KNSA 5KILA 2BG8B 4CHLA 2GMNA 5KIKA 4TZFA 3I14A 1X8GA 2ZZIA 2BFLA 3JXPA 4TZBA 4HL2A 5K4MA 1JJEA 5LS3A 3PY6A 5AHRA 1DXKA 2YNVB 4GYUA 2ZNBA 3RPCA 4BP0A 2DKFA 5LCHA 3PY5A 5K4KA 5FQCA 2GFKA 5FQBA 1HLKA 3P2UA 4C1EA 3KNRA 3T3NA 4HKYA 2BFZA 4NQ6A 4C1CA 3TP9A 4F6ZA 3ZWFA 2FU6A 1MQOA 4EYFA 2FU7A 2QJSA 4AWZA 2BG2A 2YNWA 1SMLA 4GYQA 3IELA 2AZ4A 3PG4A 4EXSA 5K0WA 4TZ9A 3WXCA 3ZNBA 2WYMA 2Y87A 5IQKA 2YNTB 5AEBA 2NZEA 3IEMA 4KEQA 2CBNA 4ZO3A 3VQZA 1E5DA 4UWSB 3ZR9A 4DIKA 5EVKA 5EWAA 4D1WA 5ACSA 5ACVA 4UBQA 1XTOA 4NQ5A 3IE1A 3SD9A 2GFJA 1WUPA 3A4YA 5A0VA 5HH4A 1QH3A 4Z5ZA 5LM6A 2BR6A 2QDTA 5EV6A 2P97A 1JT1A 4P62A 5DPXA 4WD6A 5B15A 5EV8A 3BK1A 5HIOA 3I0VA 3G1PA 4Z6XA 3X30A 4TYFA 4D1VA 2YNUA 4D02A 5LCAA 3BK2A 4PVOA 4U4LA 5AXOA 5ACQA 5HIQA 3X2YA 1M2XA 3I13A 4AD9A 3BV6A 4RM5A 2FK6A 2WYLA 4UAMA 4JO0A 2NXAA 5A0TA 4V0HA 4DILA 4AX1B 2BG6A 2BGAA 3R2UA 4XWWA 3H3EA 2FM6A 4H0DA 3ZQ4A 4RBSA 3LVZA
chains in the Genus database with same CATH superfamily
2BFZB 4AXHA 2H6AA 4HL1A 1KR3A 4GCWA 1KO2A 5LSCA 1WUOA 2Y8AA 5B3RA 2XR1A 3S0ZA 1QH5A 1K07A 2FU9A 2Q42A 4C1HA 2YNVA 5ACWA 4EXYA 3SRXA 3FCZA 3RKKA 3MD7A 4C1FA 4RAMA 2P1EA 5EW0A 4RL2A 5EVDA 5HISA 5ACXA 2WHGA 1A7TA 3L6NA 3ESHA 2WRSA 5A87A 5K4NA 3X2XA 4ZNBA 1DD6A 3F9OA 1DDKA 4AX0B 2A7MA 5HIPA 2GCUA 4UWRB 4XUKA 4UWOB 2CG2A 3IOFA 4Z5YA 5HH6A 4KEPA 3IDZA 3IOGA 1ZTCA 2Q0IA 4NQ2A 1BVTA 2P4ZA 5HH5A 1P9EA 3X2ZA 2BTNA 3DHAA 5ACRA 3KL7A 4FSBA 4NQ4A 4ZEJA 1ZNBA 5EVBA 3SW3A 3IEKA 3RKJA 4BZ3A 3SFPA 4Z7RA 2FHXA 1L9YA 1WRAA 2QINA 1X8HA 5A5ZA 1VJNA 4Z67A 1KO3A 5LCFA 4EYBA 4AV7A 2BC2A 3ADRA 4FR7A 4J5HA 4EFZA 2BG8A 5ACPA 2Y8BA 5LMCA 1Y44A 3IE2A 2I7XA 3T9MA 1VMEA 2BFKA 3SBLA 2M5CA 2CFZA 2OHHA 2BMIA 1X8IA 2NZFA 2Q0JA 2OHIA 2ZO4A 2BIBA 1YCGA 3FAIA 4D1TA 1A8TA 4ZO2A 3SPUA 3AF6A 4UA4A 3AF5A 2I7VA 3I15A 4Z60A 2OHJA 4LE6A 3DH8A 1VGNA 4YSBA 2YZ3A 4UWPB 1WW1A 2Q9UA 2DOOA 3BC2A 5B1UA 5AIJA 4C1GA 4C1DA 5FQAA 4EY2A 1BC2A 2M5DA 4B87A 2R2DA 4J5FA 3T3OA 2QDSA 1YCFA 2AIOA 1ZKPA 4EYLA 5ACUA 2VW8A 4C09A 2WYMC 4XWTA 5AYAA 3IE0A 5AHOA 5EHTA 3VPEA 5ACTA 4FEKA 4YSLA 2YNTA 5AXRA 1BMCA 4TZEA 3Q6VA 4PVTA 4RAWA 4RL0A 2UYXA 5AJLA 2I7TA 2YCBA 2XF4A 2GKLA 5LE1A 3DHBA 3I11A 4YSKA 1YCHA 3DHCA 3QH8A 4TYTA 2E7YA 4O98A 4AWYB 2QEDA 2FHXB 4F6HA 2FU8A 2NYPA 2HB9A 2BG7A 1JJTA 5LLDA 3AJ3A 1XM8A 2ZWRA 4D1UA 2P18A 5EH9A 5A23A 3KNSA 5KILA 2BG8B 4CHLA 2GMNA 5KIKA 4TZFA 3I14A 1X8GA 2ZZIA 2BFLA 3JXPA 4TZBA 4PDXA 4HL2A 5K4MA 1JJEA 5LS3A 3PY6A 5AHRA 1DXKA 2YNVB 4GYUA 2ZNBA 3RPCA 4BP0A 2DKFA 5LCHA 3PY5A 5K4KA 5FQCA 2GFKA 5FQBA 1HLKA 2YHEA 3P2UA 4C1EA 3KNRA 3T3NA 4HKYA 2BFZA 4NQ6A 4C1CA 3TP9A 4F6ZA 3ZWFA 2FU6A 1MQOA 4EYFA 2FU7A 2QJSA 4AWZA 2BG2A 2YNWA 1SMLA 4GYQA 3IELA 2AZ4A 3PG4A 4EXSA 5K0WA 4TZ9A 3WXCA 3ZNBA 2WYMA 2Y87A 5IQKA 2YNTB 5AEBA 2NZEA 3IEMA 4KEQA 2CBNA 4ZO3A 3VQZA 1E5DA 4UWSB 2CG3A 3ZR9A 4DIKA 5EVKA 5EWAA 4D1WA 5ACSA 5ACVA 4UBQA 1XTOA 4NQ5A 3IE1A 3SD9A 2GFJA 1WUPA 3A4YA 5A0VA 5HH4A 1QH3A 4Z5ZA 5LM6A 2BR6A 2QDTA 5EV6A 2P97A 1JT1A 4P62A 5DPXA 4WD6A 5B15A 5EV8A 3BK1A 5HIOA 3I0VA 3G1PA 4Z6XA 4NURA 3X30A 4TYFA 4D1VA 2YNUA 4D02A 5LCAA 3BK2A 4PVOA 4U4LA 5AXOA 5ACQA 5HIQA 3X2YA 1M2XA 3I13A 4AD9A 3BV6A 4RM5A 2FK6A 2WYLA 4UAMA 4JO0A 2NXAA 5A0TA 4V0HA 4DILA 4AX1B 2BG6A 2BGAA 3R2UA 2CFUA 4XWWA 3H3EA 2FM6A 4H0DA 3ZQ4A 4RBSA 3LVZA
chains in the Genus database with same CATH topology
2BFZB 2H6AA 4HL1A 1KR3A 4GCWA 1KO2A 5LSCA 1WUOA 2Y8AA 5B3RA 2XR1A 3S0ZA 1QH5A 1K07A 2FU9A 2Q42A 4C1HA 2YNVA 5ACWA 4EXYA 3SRXA 3FCZA 3RKKA 3MD7A 4C1FA 4RAMA 2P1EA 5EW0A 4RL2A 5EVDA 5HISA 5ACXA 2WHGA 1A7TA 3L6NA 3ESHA 2WRSA 5A87A 5K4NA 3X2XA 4ZNBA 1DD6A 3F9OA 1DDKA 4AX0B 2A7MA 5HIPA 2GCUA 4UWRB 4XUKA 4UWOB 3IOFA 4Z5YA 5HH6A 4KEPA 3IDZA 3IOGA 1ZTCA 2Q0IA 4NQ2A 1BVTA 2P4ZA 5HH5A 1P9EA 3X2ZA 2BTNA 3DHAA 5ACRA 3KL7A 4FSBA 4NQ4A 4ZEJA 1ZNBA 5EVBA 3SW3A 3IEKA 3RKJA 4BZ3A 3SFPA 4Z7RA 2FHXA 1L9YA 1WRAA 2QINA 1X8HA 5A5ZA 1VJNA 4Z67A 1KO3A 5LCFA 4EYBA 2BC2A 3ADRA 4FR7A 4J5HA 4EFZA 2BG8A 5ACPA 2Y8BA 5LMCA 1Y44A 3IE2A 2I7XA 3T9MA 1VMEA 2BFKA 3SBLA 2M5CA 2OHHA 2BMIA 1X8IA 2NZFA 2Q0JA 2OHIA 2ZO4A 2BIBA 1YCGA 3FAIA 4D1TA 1A8TA 4ZO2A 3SPUA 3AF6A 4UA4A 3AF5A 2I7VA 3I15A 4Z60A 2OHJA 4LE6A 3DH8A 1VGNA 4YSBA 2YZ3A 4UWPB 1WW1A 2Q9UA 2DOOA 3BC2A 5B1UA 4C1GA 4C1DA 5FQAA 4EY2A 1BC2A 2M5DA 4B87A 2R2DA 4J5FA 3T3OA 2QDSA 1YCFA 2AIOA 1ZKPA 4EYLA 5ACUA 2VW8A 4C09A 2WYMC 4XWTA 5AYAA 3IE0A 5AHOA 5EHTA 3VPEA 5ACTA 4FEKA 4YSLA 2YNTA 5AXRA 1BMCA 4TZEA 3Q6VA 4PVTA 4RAWA 4RL0A 2UYXA 2I7TA 2YCBA 2XF4A 2GKLA 5LE1A 3DHBA 3I11A 4YSKA 1YCHA 3DHCA 3QH8A 4TYTA 2E7YA 4O98A 4AWYB 2QEDA 2FHXB 4F6HA 2FU8A 2NYPA 2HB9A 2BG7A 1JJTA 5LLDA 3AJ3A 1XM8A 2ZWRA 4D1UA 2P18A 5EH9A 3KNSA 5KILA 2BG8B 4CHLA 2GMNA 5KIKA 4TZFA 3I14A 1X8GA 2ZZIA 2BFLA 3JXPA 4TZBA 4HL2A 5K4MA 1JJEA 5LS3A 3PY6A 5AHRA 1DXKA 2YNVB 4GYUA 2ZNBA 3RPCA 4BP0A 2DKFA 5LCHA 3PY5A 5K4KA 5FQCA 2GFKA 5FQBA 1HLKA 3P2UA 4C1EA 3KNRA 3T3NA 4HKYA 2BFZA 4NQ6A 4C1CA 3TP9A 4F6ZA 3ZWFA 2FU6A 1MQOA 4EYFA 2FU7A 2QJSA 4AWZA 2BG2A 2YNWA 1SMLA 4GYQA 3IELA 2AZ4A 3PG4A 4EXSA 5K0WA 4TZ9A 3WXCA 3ZNBA 2WYMA 2Y87A 5IQKA 2YNTB 5AEBA 2NZEA 3IEMA 4KEQA 2CBNA 4ZO3A 3VQZA 1E5DA 4UWSB 3ZR9A 4DIKA 5EVKA 5EWAA 4D1WA 5ACSA 5ACVA 4UBQA 1XTOA 4NQ5A 3IE1A 3SD9A 2GFJA 1WUPA 3A4YA 5A0VA 5HH4A 1QH3A 4Z5ZA 5LM6A 2BR6A 2QDTA 5EV6A 2P97A 1JT1A 4P62A 5DPXA 4WD6A 5B15A 5EV8A 3BK1A 5HIOA 3I0VA 3G1PA 4Z6XA 3X30A 4TYFA 4D1VA 2YNUA 4D02A 5LCAA 3BK2A 4PVOA 4U4LA 5AXOA 5ACQA 5HIQA 3X2YA 1M2XA 3I13A 4AD9A 3BV6A 4RM5A 2FK6A 2WYLA 4UAMA 4JO0A 2NXAA 5A0TA 4V0HA 4DILA 4AX1B 2BG6A 2BGAA 3R2UA 4XWWA 3H3EA 2FM6A 4H0DA 3ZQ4A 4RBSA 3LVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BFZ B;  2H6A A;  4HL1 A;  1KR3 A;  4GCW A;  1KO2 A;  5LSC A;  1WUO A;  2Y8A A;  5B3R A;  2XR1 A;  3S0Z A;  1QH5 A;  1K07 A;  2FU9 A;  2Q42 A;  4C1H A;  2YNV A;  5ACW A;  4EXY A;  3SRX A;  3FCZ A;  3RKK A;  3MD7 A;  4C1F A;  4RAM A;  2P1E A;  5EW0 A;  4RL2 A;  5EVD A;  5HIS A;  5ACX A;  2WHG A;  1A7T A;  3L6N A;  3ESH A;  2WRS A;  5A87 A;  5K4N A;  3X2X A;  4ZNB A;  1DD6 A;  3F9O A;  1DDK A;  4AX0 B;  2A7M A;  5HIP A;  2GCU A;  4UWR B;  4XUK A;  4UWO B;  3IOF A;  4Z5Y A;  5HH6 A;  4KEP A;  3IDZ A;  3IOG A;  1ZTC A;  2Q0I A;  4NQ2 A;  1BVT A;  2P4Z A;  5HH5 A;  1P9E A;  3X2Z A;  2BTN A;  3DHA A;  5ACR A;  3KL7 A;  4FSB A;  4NQ4 A;  4ZEJ A;  1ZNB A;  5EVB A;  3SW3 A;  3IEK A;  3RKJ A;  4BZ3 A;  3SFP A;  4Z7R A;  2FHX A;  1L9Y A;  1WRA A;  2QIN A;  1X8H A;  5A5Z A;  1VJN A;  4Z67 A;  1KO3 A;  5LCF A;  4EYB A;  2BC2 A;  3ADR A;  4FR7 A;  4J5H A;  4EFZ A;  2BG8 A;  5ACP A;  2Y8B A;  5LMC A;  1Y44 A;  3IE2 A;  2I7X A;  3T9M A;  1VME A;  2BFK A;  3SBL A;  2M5C A;  2OHH A;  2BMI A;  1X8I A;  2NZF A;  2Q0J A;  2OHI A;  2ZO4 A;  2BIB A;  1YCG A;  3FAI A;  4D1T A;  1A8T A;  4ZO2 A;  3SPU A;  3AF6 A;  4UA4 A;  3AF5 A;  2I7V A;  3I15 A;  4Z60 A;  2OHJ A;  4LE6 A;  3DH8 A;  1VGN A;  4YSB A;  2YZ3 A;  4UWP B;  1WW1 A;  2Q9U A;  2DOO A;  3BC2 A;  5B1U A;  4C1G A;  4C1D A;  5FQA A;  4EY2 A;  1BC2 A;  2M5D A;  4B87 A;  2R2D A;  4J5F A;  3T3O A;  2QDS A;  1YCF A;  2AIO A;  1ZKP A;  4EYL A;  5ACU A;  2VW8 A;  4C09 A;  2WYM C;  4XWT A;  5AYA A;  3IE0 A;  5AHO A;  5EHT A;  3VPE A;  5ACT A;  4FEK A;  4YSL A;  2YNT A;  5AXR A;  1BMC A;  4TZE A;  3Q6V A;  4PVT A;  4RAW A;  4RL0 A;  2UYX A;  2I7T A;  2YCB A;  2XF4 A;  2GKL A;  5LE1 A;  3DHB A;  3I11 A;  4YSK A;  1YCH A;  3DHC A;  3QH8 A;  4TYT A;  2E7Y A;  4O98 A;  4AWY B;  2QED A;  2FHX B;  4F6H A;  2FU8 A;  2NYP A;  2HB9 A;  2BG7 A;  1JJT A;  5LLD A;  3AJ3 A;  1XM8 A;  2ZWR A;  4D1U A;  2P18 A;  5EH9 A;  3KNS A;  5KIL A;  2BG8 B;  4CHL A;  2GMN A;  5KIK A;  4TZF A;  3I14 A;  1X8G A;  2ZZI A;  2BFL A;  3JXP A;  4TZB A;  4HL2 A;  5K4M A;  1JJE A;  5LS3 A;  3PY6 A;  5AHR A;  1DXK A;  2YNV B;  4GYU A;  2ZNB A;  3RPC A;  4BP0 A;  2DKF A;  5LCH A;  3PY5 A;  5K4K A;  5FQC A;  2GFK A;  5FQB A;  1HLK A;  3P2U A;  4C1E A;  3KNR A;  3T3N A;  4HKY A;  2BFZ A;  4NQ6 A;  4C1C A;  3TP9 A;  4F6Z A;  3ZWF A;  2FU6 A;  1MQO A;  4EYF A;  2FU7 A;  2QJS A;  4AWZ A;  2BG2 A;  2YNW A;  1SML A;  4GYQ A;  3IEL A;  2AZ4 A;  3PG4 A;  4EXS A;  5K0W A;  4TZ9 A;  3WXC A;  3ZNB A;  2WYM A;  2Y87 A;  5IQK A;  2YNT B;  5AEB A;  2NZE A;  3IEM A;  4KEQ A;  2CBN A;  4ZO3 A;  3VQZ A;  1E5D A;  4UWS B;  3ZR9 A;  4DIK A;  5EVK A;  5EWA A;  4D1W A;  5ACS A;  5ACV A;  4UBQ A;  1XTO A;  4NQ5 A;  3IE1 A;  3SD9 A;  2GFJ A;  1WUP A;  3A4Y A;  5A0V A;  5HH4 A;  1QH3 A;  4Z5Z A;  5LM6 A;  2BR6 A;  2QDT A;  5EV6 A;  2P97 A;  1JT1 A;  4P62 A;  5DPX A;  4WD6 A;  5B15 A;  5EV8 A;  3BK1 A;  5HIO A;  3I0V A;  3G1P A;  4Z6X A;  3X30 A;  4TYF A;  4D1V A;  2YNU A;  4D02 A;  5LCA A;  3BK2 A;  4PVO A;  4U4L A;  5AXO A;  5ACQ A;  5HIQ A;  3X2Y A;  1M2X A;  3I13 A;  4AD9 A;  3BV6 A;  4RM5 A;  2FK6 A;  2WYL A;  4UAM A;  4JO0 A;  2NXA A;  5A0T A;  4V0H A;  4DIL A;  4AX1 B;  2BG6 A;  2BGA A;  3R2U A;  4XWW A;  3H3E A;  2FM6 A;  4H0D A;  3ZQ4 A;  4RBS A;  3LVZ A; 
#chains in the Genus database with same CATH topology
 2BFZ B;  4AXH A;  2H6A A;  4HL1 A;  1KR3 A;  4GCW A;  1KO2 A;  5LSC A;  1WUO A;  2Y8A A;  5B3R A;  2XR1 A;  3S0Z A;  1QH5 A;  1K07 A;  2FU9 A;  2Q42 A;  4C1H A;  2YNV A;  5ACW A;  4EXY A;  3SRX A;  3FCZ A;  3RKK A;  3MD7 A;  4C1F A;  4RAM A;  2P1E A;  5EW0 A;  4RL2 A;  5EVD A;  5HIS A;  5ACX A;  2WHG A;  1A7T A;  3L6N A;  3ESH A;  2WRS A;  5A87 A;  5K4N A;  3X2X A;  4ZNB A;  1DD6 A;  3F9O A;  1DDK A;  4AX0 B;  2A7M A;  5HIP A;  2GCU A;  4UWR B;  4XUK A;  4UWO B;  2CG2 A;  3IOF A;  4Z5Y A;  5HH6 A;  4KEP A;  3IDZ A;  3IOG A;  1ZTC A;  2Q0I A;  4NQ2 A;  1BVT A;  2P4Z A;  5HH5 A;  1P9E A;  3X2Z A;  2BTN A;  3DHA A;  5ACR A;  3KL7 A;  4FSB A;  4NQ4 A;  4ZEJ A;  1ZNB A;  5EVB A;  3SW3 A;  3IEK A;  3RKJ A;  4BZ3 A;  3SFP A;  4Z7R A;  2FHX A;  1L9Y A;  1WRA A;  2QIN A;  1X8H A;  5A5Z A;  1VJN A;  4Z67 A;  1KO3 A;  5LCF A;  4EYB A;  4AV7 A;  2BC2 A;  3ADR A;  4FR7 A;  4J5H A;  4EFZ A;  2BG8 A;  5ACP A;  2Y8B A;  5LMC A;  1Y44 A;  3IE2 A;  2I7X A;  3T9M A;  1VME A;  2BFK A;  3SBL A;  2M5C A;  2CFZ A;  2OHH A;  2BMI A;  1X8I A;  2NZF A;  2Q0J A;  2OHI A;  2ZO4 A;  2BIB A;  1YCG A;  3FAI A;  4D1T A;  1A8T A;  4ZO2 A;  3SPU A;  3AF6 A;  4UA4 A;  3AF5 A;  2I7V A;  3I15 A;  4Z60 A;  2OHJ A;  4LE6 A;  3DH8 A;  1VGN A;  4YSB A;  2YZ3 A;  4UWP B;  1WW1 A;  2Q9U A;  2DOO A;  3BC2 A;  5B1U A;  5AIJ A;  4C1G A;  4C1D A;  5FQA A;  4EY2 A;  1BC2 A;  2M5D A;  4B87 A;  2R2D A;  4J5F A;  3T3O A;  2QDS A;  1YCF A;  2AIO A;  1ZKP A;  4EYL A;  5ACU A;  2VW8 A;  4C09 A;  2WYM C;  4XWT A;  5AYA A;  3IE0 A;  5AHO A;  5EHT A;  3VPE A;  5ACT A;  4FEK A;  4YSL A;  2YNT A;  5AXR A;  1BMC A;  4TZE A;  3Q6V A;  4PVT A;  4RAW A;  4RL0 A;  2UYX A;  5AJL A;  2I7T A;  2YCB A;  2XF4 A;  2GKL A;  5LE1 A;  3DHB A;  3I11 A;  4YSK A;  1YCH A;  3DHC A;  3QH8 A;  4TYT A;  2E7Y A;  4O98 A;  4AWY B;  2QED A;  2FHX B;  4F6H A;  2FU8 A;  2NYP A;  2HB9 A;  2BG7 A;  1JJT A;  5LLD A;  3AJ3 A;  1XM8 A;  2ZWR A;  4D1U A;  2P18 A;  5EH9 A;  5A23 A;  3KNS A;  5KIL A;  2BG8 B;  4CHL A;  2GMN A;  5KIK A;  4TZF A;  3I14 A;  1X8G A;  2ZZI A;  2BFL A;  3JXP A;  4TZB A;  4PDX A;  4HL2 A;  5K4M A;  1JJE A;  5LS3 A;  3PY6 A;  5AHR A;  1DXK A;  2YNV B;  4GYU A;  2ZNB A;  3RPC A;  4BP0 A;  2DKF A;  5LCH A;  3PY5 A;  5K4K A;  5FQC A;  2GFK A;  5FQB A;  1HLK A;  2YHE A;  3P2U A;  4C1E A;  3KNR A;  3T3N A;  4HKY A;  2BFZ A;  4NQ6 A;  4C1C A;  3TP9 A;  4F6Z A;  3ZWF A;  2FU6 A;  1MQO A;  4EYF A;  2FU7 A;  2QJS A;  4AWZ A;  2BG2 A;  2YNW A;  1SML A;  4GYQ A;  3IEL A;  2AZ4 A;  3PG4 A;  4EXS A;  5K0W A;  4TZ9 A;  3WXC A;  3ZNB A;  2WYM A;  2Y87 A;  5IQK A;  2YNT B;  5AEB A;  2NZE A;  3IEM A;  4KEQ A;  2CBN A;  4ZO3 A;  3VQZ A;  1E5D A;  4UWS B;  2CG3 A;  3ZR9 A;  4DIK A;  5EVK A;  5EWA A;  4D1W A;  5ACS A;  5ACV A;  4UBQ A;  1XTO A;  4NQ5 A;  3IE1 A;  3SD9 A;  2GFJ A;  1WUP A;  3A4Y A;  5A0V A;  5HH4 A;  1QH3 A;  4Z5Z A;  5LM6 A;  2BR6 A;  2QDT A;  5EV6 A;  2P97 A;  1JT1 A;  4P62 A;  5DPX A;  4WD6 A;  5B15 A;  5EV8 A;  3BK1 A;  5HIO A;  3I0V A;  3G1P A;  4Z6X A;  4NUR A;  3X30 A;  4TYF A;  4D1V A;  2YNU A;  4D02 A;  5LCA A;  3BK2 A;  4PVO A;  4U4L A;  5AXO A;  5ACQ A;  5HIQ A;  3X2Y A;  1M2X A;  3I13 A;  4AD9 A;  3BV6 A;  4RM5 A;  2FK6 A;  2WYL A;  4UAM A;  4JO0 A;  2NXA A;  5A0T A;  4V0H A;  4DIL A;  4AX1 B;  2BG6 A;  2BGA A;  3R2U A;  2CFU A;  4XWW A;  3H3E A;  2FM6 A;  4H0D A;  3ZQ4 A;  4RBS A;  3LVZ A; 
#chains in the Genus database with same CATH homology
 2BFZ B;  2H6A A;  4HL1 A;  1KR3 A;  4GCW A;  1KO2 A;  5LSC A;  1WUO A;  2Y8A A;  5B3R A;  2XR1 A;  3S0Z A;  1QH5 A;  1K07 A;  2FU9 A;  2Q42 A;  4C1H A;  2YNV A;  5ACW A;  4EXY A;  3SRX A;  3FCZ A;  3RKK A;  3MD7 A;  4C1F A;  4RAM A;  2P1E A;  5EW0 A;  4RL2 A;  5EVD A;  5HIS A;  5ACX A;  2WHG A;  1A7T A;  3L6N A;  3ESH A;  2WRS A;  5A87 A;  5K4N A;  3X2X A;  4ZNB A;  1DD6 A;  3F9O A;  1DDK A;  4AX0 B;  2A7M A;  5HIP A;  2GCU A;  4UWR B;  4XUK A;  4UWO B;  3IOF A;  4Z5Y A;  5HH6 A;  4KEP A;  3IDZ A;  3IOG A;  1ZTC A;  2Q0I A;  4NQ2 A;  1BVT A;  2P4Z A;  5HH5 A;  1P9E A;  3X2Z A;  2BTN A;  3DHA A;  5ACR A;  3KL7 A;  4FSB A;  4NQ4 A;  4ZEJ A;  1ZNB A;  5EVB A;  3SW3 A;  3IEK A;  3RKJ A;  4BZ3 A;  3SFP A;  4Z7R A;  2FHX A;  1L9Y A;  1WRA A;  2QIN A;  1X8H A;  5A5Z A;  1VJN A;  4Z67 A;  1KO3 A;  5LCF A;  4EYB A;  2BC2 A;  3ADR A;  4FR7 A;  4J5H A;  4EFZ A;  2BG8 A;  5ACP A;  2Y8B A;  5LMC A;  1Y44 A;  3IE2 A;  2I7X A;  3T9M A;  1VME A;  2BFK A;  3SBL A;  2M5C A;  2OHH A;  2BMI A;  1X8I A;  2NZF A;  2Q0J A;  2OHI A;  2ZO4 A;  2BIB A;  1YCG A;  3FAI A;  4D1T A;  1A8T A;  4ZO2 A;  3SPU A;  3AF6 A;  4UA4 A;  3AF5 A;  2I7V A;  3I15 A;  4Z60 A;  2OHJ A;  4LE6 A;  3DH8 A;  1VGN A;  4YSB A;  2YZ3 A;  4UWP B;  1WW1 A;  2Q9U A;  2DOO A;  3BC2 A;  5B1U A;  4C1G A;  4C1D A;  5FQA A;  4EY2 A;  1BC2 A;  2M5D A;  4B87 A;  2R2D A;  4J5F A;  3T3O A;  2QDS A;  1YCF A;  2AIO A;  1ZKP A;  4EYL A;  5ACU A;  2VW8 A;  4C09 A;  2WYM C;  4XWT A;  5AYA A;  3IE0 A;  5AHO A;  5EHT A;  3VPE A;  5ACT A;  4FEK A;  4YSL A;  2YNT A;  5AXR A;  1BMC A;  4TZE A;  3Q6V A;  4PVT A;  4RAW A;  4RL0 A;  2UYX A;  2I7T A;  2YCB A;  2XF4 A;  2GKL A;  5LE1 A;  3DHB A;  3I11 A;  4YSK A;  1YCH A;  3DHC A;  3QH8 A;  4TYT A;  2E7Y A;  4O98 A;  4AWY B;  2QED A;  2FHX B;  4F6H A;  2FU8 A;  2NYP A;  2HB9 A;  2BG7 A;  1JJT A;  5LLD A;  3AJ3 A;  1XM8 A;  2ZWR A;  4D1U A;  2P18 A;  5EH9 A;  3KNS A;  5KIL A;  2BG8 B;  4CHL A;  2GMN A;  5KIK A;  4TZF A;  3I14 A;  1X8G A;  2ZZI A;  2BFL A;  3JXP A;  4TZB A;  4HL2 A;  5K4M A;  1JJE A;  5LS3 A;  3PY6 A;  5AHR A;  1DXK A;  2YNV B;  4GYU A;  2ZNB A;  3RPC A;  4BP0 A;  2DKF A;  5LCH A;  3PY5 A;  5K4K A;  5FQC A;  2GFK A;  5FQB A;  1HLK A;  3P2U A;  4C1E A;  3KNR A;  3T3N A;  4HKY A;  2BFZ A;  4NQ6 A;  4C1C A;  3TP9 A;  4F6Z A;  3ZWF A;  2FU6 A;  1MQO A;  4EYF A;  2FU7 A;  2QJS A;  4AWZ A;  2BG2 A;  2YNW A;  1SML A;  4GYQ A;  3IEL A;  2AZ4 A;  3PG4 A;  4EXS A;  5K0W A;  4TZ9 A;  3WXC A;  3ZNB A;  2WYM A;  2Y87 A;  5IQK A;  2YNT B;  5AEB A;  2NZE A;  3IEM A;  4KEQ A;  2CBN A;  4ZO3 A;  3VQZ A;  1E5D A;  4UWS B;  3ZR9 A;  4DIK A;  5EVK A;  5EWA A;  4D1W A;  5ACS A;  5ACV A;  4UBQ A;  1XTO A;  4NQ5 A;  3IE1 A;  3SD9 A;  2GFJ A;  1WUP A;  3A4Y A;  5A0V A;  5HH4 A;  1QH3 A;  4Z5Z A;  5LM6 A;  2BR6 A;  2QDT A;  5EV6 A;  2P97 A;  1JT1 A;  4P62 A;  5DPX A;  4WD6 A;  5B15 A;  5EV8 A;  3BK1 A;  5HIO A;  3I0V A;  3G1P A;  4Z6X A;  3X30 A;  4TYF A;  4D1V A;  2YNU A;  4D02 A;  5LCA A;  3BK2 A;  4PVO A;  4U4L A;  5AXO A;  5ACQ A;  5HIQ A;  3X2Y A;  1M2X A;  3I13 A;  4AD9 A;  3BV6 A;  4RM5 A;  2FK6 A;  2WYL A;  4UAM A;  4JO0 A;  2NXA A;  5A0T A;  4V0H A;  4DIL A;  4AX1 B;  2BG6 A;  2BGA A;  3R2U A;  4XWW A;  3H3E A;  2FM6 A;  4H0D A;  3ZQ4 A;  4RBS A;  3LVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...