2A7MA

1.6 angstrom resolution structure of the quorum-quenching n-acyl homoserine lactone hydrolase of bacillus thuringiensis
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
250
structure length
250
Chain Sequence
b'MTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIETEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acyl homoserine lactone hydrolase
molecule tags Hydrolase
source organism Bacillus thuringiensis serovar kurstaki
publication title Three-dimensional structure of the quorum-quenching N-acyl homoserine lactone hydrolase from Bacillus thuringiensis
pubmed doi rcsb
total genus 77
structure length 250
sequence length 250
ec nomenclature ec 3.1.1.81: Quorum-quenching N-acyl-homoserine lactonase.
pdb deposition date 2005-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2a7mA01
4TYTA 4U4LA 2NXAA 5LS3A 2YNVA 3JXPA 5B15A 4WD6A 4ZNBA 2YNWA 5EVBA 4AWYB 2ZZIA 4AX1B 4EXYA 5EV6A 1ZNBA 5AXOA 4EYFA 5K4NA 1WRAA 4D1UA 2BG8A 1DD6A 4HL1A 4J5HA 4TZ9A 3I14A 1JJTA 5K4MA 4J5FA 2NYPA 4GYUA 4UWSB 5EH9A 3Q6VA 3QH8A 4C1HA 5ACRA 5AYAA 4TZEA 3X2ZA 1ZKPA 3A4YA 1BC2A 2FM6A 1A8TA 2FU6A 5ACWA 2BC2A 2DOOA 3FAIA 4UWOB 5LMCA 4BZ3A 5ACTA 2BFKA 1XTOA 2BG7A 5LM6A 4RM5A 2BGAA 4NQ4A 2QDSA 2YCBA 3DHCA 3PY5A 4C1FA 1A7TA 2OHIA 5AHOA 5HIOA 4P62A 1X8GA 2YNVB 3ZNBA 2FHXA 1DDKA 4XUKA 4NQ5A 2BIBA 4AD9A 2QINA 3BK1A 3DHAA 5DPXA 4XWWA 2WRSA 2FU9A 5KIKA 4UWPB 1QH5A 3T9MA 3SRXA 5A5ZA 2GKLA 4ZEJA 3SFPA 2DKFA 3KNSA 3I15A 3PY6A 5ACUA 5LCFA 3RKJA 4XWTA 4YSLA 2FHXB 1KO3A 1YCFA 3ADRA 4FEKA 5HIPA 5K0WA 3F9OA 4Z6XA 2BG6A 2VW8A 4GYQA 2Q0JA 2BFZB 3KNRA 4D1VA 2FU8A 4NQ6A 1WUPA 3I0VA 3R2UA 5HH6A 3S0ZA 4NQ2A 5IQKA 3AJ3A 1XM8A 4KEQA 2H6AA 2BFZA 2OHJA 3AF5A 1VJNA 2P18A 2P97A 4V0HA 5LE1A 4TYFA 5EHTA 3IEMA 5A87A 3IOGA 3SD9A 4PVTA 4KEPA 3ZWFA 2I7VA 4YSKA 1WW1A 4EYBA 5EVDA 5LCAA 4JO0A 2R2DA 2WYMC 5ACQA 3IE2A 3VPEA 2I7TA 4UA4A 5LCHA 2Q42A 2M5CA 1DXKA 4TZFA 2ZWRA 4FSBA 4PVOA 1MQOA 5FQBA 3IE0A 5ACVA 3MD7A 2WYMA 5AHRA 3ESHA 1M2XA 4EXSA 2BG2A 1L9YA 2QJSA 2YNTA 4AX0B 1P9EA 5LLDA 4RAMA 4UBQA 4EFZA 1YCHA 5ACSA 5B1UA 4UWRB 1K07A 4EYLA 5ACXA 2M5DA 1YCGA 4H0DA 3T3NA 4D02A 4EY2A 2GFKA 3ZQ4A 1X8HA 4ZO2A 2GFJA 2GMNA 4Z5YA 2P4ZA 4C1EA 5HIQA 2BFLA 2AIOA 4Z60A 1HLKA 2XF4A 2Y8AA 3DH8A 1E5DA 3T3OA 3FCZA 3VQZA 1JJEA 2Q0IA 4RL0A 4RL2A 2BR6A 5HISA 5B3RA 4Z67A 3IOFA 4Z7RA 2NZEA 2OHHA 3AF6A 3IDZA 2HB9A 5EWAA 4Z5ZA 3IE1A 3X30A 3BV6A 2P1EA 2WYLA 1BMCA 2Y8BA 2Y87A 2BMIA 4RBSA 5ACPA 4F6ZA 5EW0A 5FQAA 2I7XA 3PG4A 1ZTCA 3WXCA 2QDTA 3I11A 5HH5A 4LE6A 4ZO3A 1KO2A 5EVKA 3RKKA 1SMLA 2E7YA 4HKYA 2NZFA 3IELA 4DILA 5A0VA 5AEBA 3BK2A 1VMEA 5K4KA 4RAWA 4UAMA 5LSCA 3SPUA 3SW3A 2YNTB 2UYXA 2WHGA 2XR1A 3I13A 1QH3A 2ZO4A 4C1CA 2AZ4A 2GCUA 3SBLA 3BC2A 3ZR9A 4D1WA 1WUOA 4TZBA 1X8IA 4GCWA 2QEDA 3RPCA 2FU7A 2CBNA 4B87A 3P2UA 5FQCA 4C09A 3IEKA 3TP9A 2YZ3A 4C1DA 4DIKA 3H3EA 2BG8B 3LVZA 4HL2A 2FK6A 2Q9UA 2YNUA 4YSBA 5KILA 5A0TA 5AXRA 3L6NA 1JT1A 5HH4A 3G1PA 4C1GA 4F6HA 4FR7A 4D1TA 4AWZA 2A7MA 4CHLA 1VGNA 2BTNA 1BVTA 3X2XA 4BP0A 2ZNBA 1KR3A 3KL7A 3X2YA 5EV8A 3DHBA 4O98A 1Y44A
chains in the Genus database with same CATH superfamily
4TYTA 4U4LA 2NXAA 5LS3A 2YNVA 3JXPA 5B15A 4WD6A 4ZNBA 2YNWA 5EVBA 4AWYB 2ZZIA 4AX1B 4EXYA 5EV6A 1ZNBA 5AXOA 4EYFA 5K4NA 1WRAA 4D1UA 2BG8A 1DD6A 4HL1A 4J5HA 4TZ9A 3I14A 1JJTA 5K4MA 4J5FA 2NYPA 4GYUA 4UWSB 5EH9A 3Q6VA 3QH8A 4C1HA 5ACRA 5AYAA 4TZEA 3X2ZA 1ZKPA 3A4YA 1BC2A 2FM6A 1A8TA 2FU6A 5ACWA 2BC2A 2DOOA 3FAIA 4UWOB 5LMCA 4BZ3A 5ACTA 2BFKA 1XTOA 2BG7A 5LM6A 4RM5A 2BGAA 4NQ4A 2QDSA 2YCBA 3DHCA 3PY5A 4C1FA 1A7TA 2OHIA 4PDXA 5AHOA 5HIOA 4P62A 1X8GA 2YNVB 3ZNBA 2FHXA 1DDKA 4XUKA 4AXHA 4NQ5A 2BIBA 4AD9A 2QINA 3BK1A 3DHAA 5DPXA 4XWWA 2WRSA 2FU9A 5KIKA 4UWPB 1QH5A 3T9MA 3SRXA 5A5ZA 2GKLA 4ZEJA 3SFPA 5A23A 2DKFA 3KNSA 3I15A 3PY6A 5ACUA 5LCFA 3RKJA 4XWTA 4YSLA 2FHXB 1KO3A 1YCFA 3ADRA 4FEKA 5HIPA 5K0WA 3F9OA 4Z6XA 2BG6A 2VW8A 4GYQA 2Q0JA 2BFZB 3KNRA 4D1VA 2FU8A 4NQ6A 1WUPA 3I0VA 3R2UA 5HH6A 3S0ZA 4NQ2A 5IQKA 3AJ3A 1XM8A 4KEQA 2H6AA 2BFZA 2OHJA 3AF5A 1VJNA 2P18A 2P97A 4V0HA 5LE1A 4TYFA 5EHTA 3IEMA 5A87A 3IOGA 2CG3A 3SD9A 4PVTA 4KEPA 3ZWFA 2I7VA 2CFUA 4YSKA 1WW1A 4EYBA 5EVDA 5LCAA 4JO0A 2R2DA 2WYMC 5ACQA 3IE2A 3VPEA 2I7TA 4UA4A 5LCHA 2Q42A 2M5CA 1DXKA 4TZFA 2ZWRA 4FSBA 4PVOA 1MQOA 5FQBA 3IE0A 5ACVA 3MD7A 2WYMA 5AHRA 3ESHA 1M2XA 4EXSA 2BG2A 1L9YA 2QJSA 2YNTA 4AX0B 1P9EA 5LLDA 4RAMA 4UBQA 4EFZA 1YCHA 5ACSA 5B1UA 4UWRB 1K07A 4EYLA 5ACXA 2M5DA 1YCGA 4H0DA 3T3NA 4D02A 4EY2A 2GFKA 3ZQ4A 1X8HA 4ZO2A 2CG2A 2GFJA 2GMNA 4Z5YA 2P4ZA 4C1EA 5HIQA 2BFLA 2AIOA 4Z60A 2CFZA 1HLKA 2XF4A 2Y8AA 3DH8A 1E5DA 3T3OA 3FCZA 3VQZA 1JJEA 2Q0IA 4RL0A 4RL2A 2BR6A 5B3RA 5HISA 4Z67A 3IOFA 4Z7RA 2NZEA 2OHHA 3AF6A 3IDZA 2HB9A 5EWAA 2YHEA 4Z5ZA 3IE1A 3X30A 3BV6A 2P1EA 2WYLA 5AIJA 1BMCA 2Y8BA 2Y87A 2BMIA 4RBSA 5ACPA 4F6ZA 5EW0A 5FQAA 2I7XA 3PG4A 1ZTCA 3WXCA 2QDTA 3I11A 5HH5A 4LE6A 4ZO3A 1KO2A 5EVKA 3RKKA 1SMLA 2E7YA 4HKYA 2NZFA 3IELA 4DILA 5A0VA 5AEBA 3BK2A 1VMEA 5K4KA 4RAWA 4UAMA 5LSCA 3SPUA 3SW3A 2YNTB 4NURA 2UYXA 2WHGA 2XR1A 3I13A 1QH3A 2ZO4A 4C1CA 2AZ4A 2GCUA 3SBLA 3BC2A 3ZR9A 4D1WA 1WUOA 4TZBA 1X8IA 4GCWA 2QEDA 3RPCA 2FU7A 2CBNA 4B87A 3P2UA 5FQCA 4C09A 3IEKA 3TP9A 2YZ3A 4C1DA 4DIKA 3H3EA 2BG8B 3LVZA 4HL2A 2FK6A 4AV7A 2Q9UA 2YNUA 4YSBA 5KILA 5A0TA 5AXRA 3L6NA 1JT1A 5HH4A 3G1PA 4C1GA 4F6HA 4FR7A 4D1TA 4AWZA 5AJLA 2A7MA 4CHLA 1VGNA 2BTNA 1BVTA 3X2XA 4BP0A 2ZNBA 1KR3A 3KL7A 3X2YA 5EV8A 3DHBA 4O98A 1Y44A
chains in the Genus database with same CATH topology
4TYTA 4U4LA 2NXAA 5LS3A 2YNVA 3JXPA 5B15A 4WD6A 4ZNBA 2YNWA 5EVBA 4AWYB 2ZZIA 4AX1B 4EXYA 5EV6A 1ZNBA 5AXOA 4EYFA 5K4NA 1WRAA 4D1UA 2BG8A 1DD6A 4HL1A 4J5HA 4TZ9A 3I14A 1JJTA 5K4MA 4J5FA 2NYPA 4GYUA 4UWSB 5EH9A 3Q6VA 3QH8A 4C1HA 5ACRA 5AYAA 4TZEA 3X2ZA 1ZKPA 3A4YA 1BC2A 2FM6A 1A8TA 2FU6A 5ACWA 2BC2A 2DOOA 3FAIA 4UWOB 5LMCA 4BZ3A 5ACTA 2BFKA 1XTOA 2BG7A 5LM6A 4RM5A 2BGAA 4NQ4A 2QDSA 2YCBA 3DHCA 3PY5A 4C1FA 1A7TA 2OHIA 5AHOA 5HIOA 4P62A 1X8GA 2YNVB 3ZNBA 2FHXA 1DDKA 4XUKA 4NQ5A 2BIBA 4AD9A 2QINA 3BK1A 3DHAA 5DPXA 4XWWA 2WRSA 2FU9A 5KIKA 4UWPB 1QH5A 3T9MA 3SRXA 5A5ZA 2GKLA 4ZEJA 3SFPA 2DKFA 3KNSA 3I15A 3PY6A 5ACUA 5LCFA 3RKJA 4XWTA 4YSLA 2FHXB 1KO3A 1YCFA 3ADRA 4FEKA 5HIPA 5K0WA 3F9OA 4Z6XA 2BG6A 2VW8A 4GYQA 2Q0JA 2BFZB 3KNRA 4D1VA 2FU8A 4NQ6A 1WUPA 3I0VA 3R2UA 5HH6A 3S0ZA 4NQ2A 5IQKA 3AJ3A 1XM8A 4KEQA 2H6AA 2BFZA 2OHJA 3AF5A 1VJNA 2P18A 2P97A 4V0HA 5LE1A 4TYFA 5EHTA 3IEMA 5A87A 3IOGA 3SD9A 4PVTA 4KEPA 3ZWFA 2I7VA 4YSKA 1WW1A 4EYBA 5EVDA 5LCAA 4JO0A 2R2DA 2WYMC 5ACQA 3IE2A 3VPEA 2I7TA 4UA4A 5LCHA 2Q42A 2M5CA 1DXKA 4TZFA 2ZWRA 4FSBA 4PVOA 1MQOA 5FQBA 3IE0A 5ACVA 3MD7A 2WYMA 5AHRA 3ESHA 1M2XA 4EXSA 2BG2A 1L9YA 2QJSA 2YNTA 4AX0B 1P9EA 5LLDA 4RAMA 4UBQA 4EFZA 1YCHA 5ACSA 5B1UA 4UWRB 1K07A 4EYLA 5ACXA 2M5DA 1YCGA 4H0DA 3T3NA 4D02A 4EY2A 2GFKA 3ZQ4A 1X8HA 4ZO2A 2GFJA 2GMNA 4Z5YA 2P4ZA 4C1EA 5HIQA 2BFLA 2AIOA 4Z60A 1HLKA 2XF4A 2Y8AA 3DH8A 1E5DA 3T3OA 3FCZA 3VQZA 1JJEA 2Q0IA 4RL0A 4RL2A 2BR6A 5HISA 5B3RA 4Z67A 3IOFA 4Z7RA 2NZEA 2OHHA 3AF6A 3IDZA 2HB9A 5EWAA 4Z5ZA 3IE1A 3X30A 3BV6A 2P1EA 2WYLA 1BMCA 2Y8BA 2Y87A 2BMIA 4RBSA 5ACPA 4F6ZA 5EW0A 5FQAA 2I7XA 3PG4A 1ZTCA 3WXCA 2QDTA 3I11A 5HH5A 4LE6A 4ZO3A 1KO2A 5EVKA 3RKKA 1SMLA 2E7YA 4HKYA 2NZFA 3IELA 4DILA 5A0VA 5AEBA 3BK2A 1VMEA 5K4KA 4RAWA 4UAMA 5LSCA 3SPUA 3SW3A 2YNTB 2UYXA 2WHGA 2XR1A 3I13A 1QH3A 2ZO4A 4C1CA 2AZ4A 2GCUA 3SBLA 3BC2A 3ZR9A 4D1WA 1WUOA 4TZBA 1X8IA 4GCWA 2QEDA 3RPCA 2FU7A 2CBNA 4B87A 3P2UA 5FQCA 4C09A 3IEKA 3TP9A 2YZ3A 4C1DA 4DIKA 3H3EA 2BG8B 3LVZA 4HL2A 2FK6A 2Q9UA 2YNUA 4YSBA 5KILA 5A0TA 5AXRA 3L6NA 1JT1A 5HH4A 3G1PA 4C1GA 4F6HA 4FR7A 4D1TA 4AWZA 2A7MA 4CHLA 1VGNA 2BTNA 1BVTA 3X2XA 4BP0A 2ZNBA 1KR3A 3KL7A 3X2YA 5EV8A 3DHBA 4O98A 1Y44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TYT A;  4U4L A;  2NXA A;  5LS3 A;  2YNV A;  3JXP A;  5B15 A;  4WD6 A;  4ZNB A;  2YNW A;  5EVB A;  4AWY B;  2ZZI A;  4AX1 B;  4EXY A;  5EV6 A;  1ZNB A;  5AXO A;  4EYF A;  5K4N A;  1WRA A;  4D1U A;  2BG8 A;  1DD6 A;  4HL1 A;  4J5H A;  4TZ9 A;  3I14 A;  1JJT A;  5K4M A;  4J5F A;  2NYP A;  4GYU A;  4UWS B;  5EH9 A;  3Q6V A;  3QH8 A;  4C1H A;  5ACR A;  5AYA A;  4TZE A;  3X2Z A;  1ZKP A;  3A4Y A;  1BC2 A;  2FM6 A;  1A8T A;  2FU6 A;  5ACW A;  2BC2 A;  2DOO A;  3FAI A;  4UWO B;  5LMC A;  4BZ3 A;  5ACT A;  2BFK A;  1XTO A;  2BG7 A;  5LM6 A;  4RM5 A;  2BGA A;  4NQ4 A;  2QDS A;  2YCB A;  3DHC A;  3PY5 A;  4C1F A;  1A7T A;  2OHI A;  5AHO A;  5HIO A;  4P62 A;  1X8G A;  2YNV B;  3ZNB A;  2FHX A;  1DDK A;  4XUK A;  4NQ5 A;  2BIB A;  4AD9 A;  2QIN A;  3BK1 A;  3DHA A;  5DPX A;  4XWW A;  2WRS A;  2FU9 A;  5KIK A;  4UWP B;  1QH5 A;  3T9M A;  3SRX A;  5A5Z A;  2GKL A;  4ZEJ A;  3SFP A;  2DKF A;  3KNS A;  3I15 A;  3PY6 A;  5ACU A;  5LCF A;  3RKJ A;  4XWT A;  4YSL A;  2FHX B;  1KO3 A;  1YCF A;  3ADR A;  4FEK A;  5HIP A;  5K0W A;  3F9O A;  4Z6X A;  2BG6 A;  2VW8 A;  4GYQ A;  2Q0J A;  2BFZ B;  3KNR A;  4D1V A;  2FU8 A;  4NQ6 A;  1WUP A;  3I0V A;  3R2U A;  5HH6 A;  3S0Z A;  4NQ2 A;  5IQK A;  3AJ3 A;  1XM8 A;  4KEQ A;  2H6A A;  2BFZ A;  2OHJ A;  3AF5 A;  1VJN A;  2P18 A;  2P97 A;  4V0H A;  5LE1 A;  4TYF A;  5EHT A;  3IEM A;  5A87 A;  3IOG A;  3SD9 A;  4PVT A;  4KEP A;  3ZWF A;  2I7V A;  4YSK A;  1WW1 A;  4EYB A;  5EVD A;  5LCA A;  4JO0 A;  2R2D A;  2WYM C;  5ACQ A;  3IE2 A;  3VPE A;  2I7T A;  4UA4 A;  5LCH A;  2Q42 A;  2M5C A;  1DXK A;  4TZF A;  2ZWR A;  4FSB A;  4PVO A;  1MQO A;  5FQB A;  3IE0 A;  5ACV A;  3MD7 A;  2WYM A;  5AHR A;  3ESH A;  1M2X A;  4EXS A;  2BG2 A;  1L9Y A;  2QJS A;  2YNT A;  4AX0 B;  1P9E A;  5LLD A;  4RAM A;  4UBQ A;  4EFZ A;  1YCH A;  5ACS A;  5B1U A;  4UWR B;  1K07 A;  4EYL A;  5ACX A;  2M5D A;  1YCG A;  4H0D A;  3T3N A;  4D02 A;  4EY2 A;  2GFK A;  3ZQ4 A;  1X8H A;  4ZO2 A;  2GFJ A;  2GMN A;  4Z5Y A;  2P4Z A;  4C1E A;  5HIQ A;  2BFL A;  2AIO A;  4Z60 A;  1HLK A;  2XF4 A;  2Y8A A;  3DH8 A;  1E5D A;  3T3O A;  3FCZ A;  3VQZ A;  1JJE A;  2Q0I A;  4RL0 A;  4RL2 A;  2BR6 A;  5HIS A;  5B3R A;  4Z67 A;  3IOF A;  4Z7R A;  2NZE A;  2OHH A;  3AF6 A;  3IDZ A;  2HB9 A;  5EWA A;  4Z5Z A;  3IE1 A;  3X30 A;  3BV6 A;  2P1E A;  2WYL A;  1BMC A;  2Y8B A;  2Y87 A;  2BMI A;  4RBS A;  5ACP A;  4F6Z A;  5EW0 A;  5FQA A;  2I7X A;  3PG4 A;  1ZTC A;  3WXC A;  2QDT A;  3I11 A;  5HH5 A;  4LE6 A;  4ZO3 A;  1KO2 A;  5EVK A;  3RKK A;  1SML A;  2E7Y A;  4HKY A;  2NZF A;  3IEL A;  4DIL A;  5A0V A;  5AEB A;  3BK2 A;  1VME A;  5K4K A;  4RAW A;  4UAM A;  5LSC A;  3SPU A;  3SW3 A;  2YNT B;  2UYX A;  2WHG A;  2XR1 A;  3I13 A;  1QH3 A;  2ZO4 A;  4C1C A;  2AZ4 A;  2GCU A;  3SBL A;  3BC2 A;  3ZR9 A;  4D1W A;  1WUO A;  4TZB A;  1X8I A;  4GCW A;  2QED A;  3RPC A;  2FU7 A;  2CBN A;  4B87 A;  3P2U A;  5FQC A;  4C09 A;  3IEK A;  3TP9 A;  2YZ3 A;  4C1D A;  4DIK A;  3H3E A;  2BG8 B;  3LVZ A;  4HL2 A;  2FK6 A;  2Q9U A;  2YNU A;  4YSB A;  5KIL A;  5A0T A;  5AXR A;  3L6N A;  1JT1 A;  5HH4 A;  3G1P A;  4C1G A;  4F6H A;  4FR7 A;  4D1T A;  4AWZ A;  2A7M A;  4CHL A;  1VGN A;  2BTN A;  1BVT A;  3X2X A;  4BP0 A;  2ZNB A;  1KR3 A;  3KL7 A;  3X2Y A;  5EV8 A;  3DHB A;  4O98 A;  1Y44 A; 
#chains in the Genus database with same CATH topology
 4TYT A;  4U4L A;  2NXA A;  5LS3 A;  2YNV A;  3JXP A;  5B15 A;  4WD6 A;  4ZNB A;  2YNW A;  5EVB A;  4AWY B;  2ZZI A;  4AX1 B;  4EXY A;  5EV6 A;  1ZNB A;  5AXO A;  4EYF A;  5K4N A;  1WRA A;  4D1U A;  2BG8 A;  1DD6 A;  4HL1 A;  4J5H A;  4TZ9 A;  3I14 A;  1JJT A;  5K4M A;  4J5F A;  2NYP A;  4GYU A;  4UWS B;  5EH9 A;  3Q6V A;  3QH8 A;  4C1H A;  5ACR A;  5AYA A;  4TZE A;  3X2Z A;  1ZKP A;  3A4Y A;  1BC2 A;  2FM6 A;  1A8T A;  2FU6 A;  5ACW A;  2BC2 A;  2DOO A;  3FAI A;  4UWO B;  5LMC A;  4BZ3 A;  5ACT A;  2BFK A;  1XTO A;  2BG7 A;  5LM6 A;  4RM5 A;  2BGA A;  4NQ4 A;  2QDS A;  2YCB A;  3DHC A;  3PY5 A;  4C1F A;  1A7T A;  2OHI A;  4PDX A;  5AHO A;  5HIO A;  4P62 A;  1X8G A;  2YNV B;  3ZNB A;  2FHX A;  1DDK A;  4XUK A;  4AXH A;  4NQ5 A;  2BIB A;  4AD9 A;  2QIN A;  3BK1 A;  3DHA A;  5DPX A;  4XWW A;  2WRS A;  2FU9 A;  5KIK A;  4UWP B;  1QH5 A;  3T9M A;  3SRX A;  5A5Z A;  2GKL A;  4ZEJ A;  3SFP A;  5A23 A;  2DKF A;  3KNS A;  3I15 A;  3PY6 A;  5ACU A;  5LCF A;  3RKJ A;  4XWT A;  4YSL A;  2FHX B;  1KO3 A;  1YCF A;  3ADR A;  4FEK A;  5HIP A;  5K0W A;  3F9O A;  4Z6X A;  2BG6 A;  2VW8 A;  4GYQ A;  2Q0J A;  2BFZ B;  3KNR A;  4D1V A;  2FU8 A;  4NQ6 A;  1WUP A;  3I0V A;  3R2U A;  5HH6 A;  3S0Z A;  4NQ2 A;  5IQK A;  3AJ3 A;  1XM8 A;  4KEQ A;  2H6A A;  2BFZ A;  2OHJ A;  3AF5 A;  1VJN A;  2P18 A;  2P97 A;  4V0H A;  5LE1 A;  4TYF A;  5EHT A;  3IEM A;  5A87 A;  3IOG A;  2CG3 A;  3SD9 A;  4PVT A;  4KEP A;  3ZWF A;  2I7V A;  2CFU A;  4YSK A;  1WW1 A;  4EYB A;  5EVD A;  5LCA A;  4JO0 A;  2R2D A;  2WYM C;  5ACQ A;  3IE2 A;  3VPE A;  2I7T A;  4UA4 A;  5LCH A;  2Q42 A;  2M5C A;  1DXK A;  4TZF A;  2ZWR A;  4FSB A;  4PVO A;  1MQO A;  5FQB A;  3IE0 A;  5ACV A;  3MD7 A;  2WYM A;  5AHR A;  3ESH A;  1M2X A;  4EXS A;  2BG2 A;  1L9Y A;  2QJS A;  2YNT A;  4AX0 B;  1P9E A;  5LLD A;  4RAM A;  4UBQ A;  4EFZ A;  1YCH A;  5ACS A;  5B1U A;  4UWR B;  1K07 A;  4EYL A;  5ACX A;  2M5D A;  1YCG A;  4H0D A;  3T3N A;  4D02 A;  4EY2 A;  2GFK A;  3ZQ4 A;  1X8H A;  4ZO2 A;  2CG2 A;  2GFJ A;  2GMN A;  4Z5Y A;  2P4Z A;  4C1E A;  5HIQ A;  2BFL A;  2AIO A;  4Z60 A;  2CFZ A;  1HLK A;  2XF4 A;  2Y8A A;  3DH8 A;  1E5D A;  3T3O A;  3FCZ A;  3VQZ A;  1JJE A;  2Q0I A;  4RL0 A;  4RL2 A;  2BR6 A;  5B3R A;  5HIS A;  4Z67 A;  3IOF A;  4Z7R A;  2NZE A;  2OHH A;  3AF6 A;  3IDZ A;  2HB9 A;  5EWA A;  2YHE A;  4Z5Z A;  3IE1 A;  3X30 A;  3BV6 A;  2P1E A;  2WYL A;  5AIJ A;  1BMC A;  2Y8B A;  2Y87 A;  2BMI A;  4RBS A;  5ACP A;  4F6Z A;  5EW0 A;  5FQA A;  2I7X A;  3PG4 A;  1ZTC A;  3WXC A;  2QDT A;  3I11 A;  5HH5 A;  4LE6 A;  4ZO3 A;  1KO2 A;  5EVK A;  3RKK A;  1SML A;  2E7Y A;  4HKY A;  2NZF A;  3IEL A;  4DIL A;  5A0V A;  5AEB A;  3BK2 A;  1VME A;  5K4K A;  4RAW A;  4UAM A;  5LSC A;  3SPU A;  3SW3 A;  2YNT B;  4NUR A;  2UYX A;  2WHG A;  2XR1 A;  3I13 A;  1QH3 A;  2ZO4 A;  4C1C A;  2AZ4 A;  2GCU A;  3SBL A;  3BC2 A;  3ZR9 A;  4D1W A;  1WUO A;  4TZB A;  1X8I A;  4GCW A;  2QED A;  3RPC A;  2FU7 A;  2CBN A;  4B87 A;  3P2U A;  5FQC A;  4C09 A;  3IEK A;  3TP9 A;  2YZ3 A;  4C1D A;  4DIK A;  3H3E A;  2BG8 B;  3LVZ A;  4HL2 A;  2FK6 A;  4AV7 A;  2Q9U A;  2YNU A;  4YSB A;  5KIL A;  5A0T A;  5AXR A;  3L6N A;  1JT1 A;  5HH4 A;  3G1P A;  4C1G A;  4F6H A;  4FR7 A;  4D1T A;  4AWZ A;  5AJL A;  2A7M A;  4CHL A;  1VGN A;  2BTN A;  1BVT A;  3X2X A;  4BP0 A;  2ZNB A;  1KR3 A;  3KL7 A;  3X2Y A;  5EV8 A;  3DHB A;  4O98 A;  1Y44 A; 
#chains in the Genus database with same CATH homology
 4TYT A;  4U4L A;  2NXA A;  5LS3 A;  2YNV A;  3JXP A;  5B15 A;  4WD6 A;  4ZNB A;  2YNW A;  5EVB A;  4AWY B;  2ZZI A;  4AX1 B;  4EXY A;  5EV6 A;  1ZNB A;  5AXO A;  4EYF A;  5K4N A;  1WRA A;  4D1U A;  2BG8 A;  1DD6 A;  4HL1 A;  4J5H A;  4TZ9 A;  3I14 A;  1JJT A;  5K4M A;  4J5F A;  2NYP A;  4GYU A;  4UWS B;  5EH9 A;  3Q6V A;  3QH8 A;  4C1H A;  5ACR A;  5AYA A;  4TZE A;  3X2Z A;  1ZKP A;  3A4Y A;  1BC2 A;  2FM6 A;  1A8T A;  2FU6 A;  5ACW A;  2BC2 A;  2DOO A;  3FAI A;  4UWO B;  5LMC A;  4BZ3 A;  5ACT A;  2BFK A;  1XTO A;  2BG7 A;  5LM6 A;  4RM5 A;  2BGA A;  4NQ4 A;  2QDS A;  2YCB A;  3DHC A;  3PY5 A;  4C1F A;  1A7T A;  2OHI A;  5AHO A;  5HIO A;  4P62 A;  1X8G A;  2YNV B;  3ZNB A;  2FHX A;  1DDK A;  4XUK A;  4NQ5 A;  2BIB A;  4AD9 A;  2QIN A;  3BK1 A;  3DHA A;  5DPX A;  4XWW A;  2WRS A;  2FU9 A;  5KIK A;  4UWP B;  1QH5 A;  3T9M A;  3SRX A;  5A5Z A;  2GKL A;  4ZEJ A;  3SFP A;  2DKF A;  3KNS A;  3I15 A;  3PY6 A;  5ACU A;  5LCF A;  3RKJ A;  4XWT A;  4YSL A;  2FHX B;  1KO3 A;  1YCF A;  3ADR A;  4FEK A;  5HIP A;  5K0W A;  3F9O A;  4Z6X A;  2BG6 A;  2VW8 A;  4GYQ A;  2Q0J A;  2BFZ B;  3KNR A;  4D1V A;  2FU8 A;  4NQ6 A;  1WUP A;  3I0V A;  3R2U A;  5HH6 A;  3S0Z A;  4NQ2 A;  5IQK A;  3AJ3 A;  1XM8 A;  4KEQ A;  2H6A A;  2BFZ A;  2OHJ A;  3AF5 A;  1VJN A;  2P18 A;  2P97 A;  4V0H A;  5LE1 A;  4TYF A;  5EHT A;  3IEM A;  5A87 A;  3IOG A;  3SD9 A;  4PVT A;  4KEP A;  3ZWF A;  2I7V A;  4YSK A;  1WW1 A;  4EYB A;  5EVD A;  5LCA A;  4JO0 A;  2R2D A;  2WYM C;  5ACQ A;  3IE2 A;  3VPE A;  2I7T A;  4UA4 A;  5LCH A;  2Q42 A;  2M5C A;  1DXK A;  4TZF A;  2ZWR A;  4FSB A;  4PVO A;  1MQO A;  5FQB A;  3IE0 A;  5ACV A;  3MD7 A;  2WYM A;  5AHR A;  3ESH A;  1M2X A;  4EXS A;  2BG2 A;  1L9Y A;  2QJS A;  2YNT A;  4AX0 B;  1P9E A;  5LLD A;  4RAM A;  4UBQ A;  4EFZ A;  1YCH A;  5ACS A;  5B1U A;  4UWR B;  1K07 A;  4EYL A;  5ACX A;  2M5D A;  1YCG A;  4H0D A;  3T3N A;  4D02 A;  4EY2 A;  2GFK A;  3ZQ4 A;  1X8H A;  4ZO2 A;  2GFJ A;  2GMN A;  4Z5Y A;  2P4Z A;  4C1E A;  5HIQ A;  2BFL A;  2AIO A;  4Z60 A;  1HLK A;  2XF4 A;  2Y8A A;  3DH8 A;  1E5D A;  3T3O A;  3FCZ A;  3VQZ A;  1JJE A;  2Q0I A;  4RL0 A;  4RL2 A;  2BR6 A;  5HIS A;  5B3R A;  4Z67 A;  3IOF A;  4Z7R A;  2NZE A;  2OHH A;  3AF6 A;  3IDZ A;  2HB9 A;  5EWA A;  4Z5Z A;  3IE1 A;  3X30 A;  3BV6 A;  2P1E A;  2WYL A;  1BMC A;  2Y8B A;  2Y87 A;  2BMI A;  4RBS A;  5ACP A;  4F6Z A;  5EW0 A;  5FQA A;  2I7X A;  3PG4 A;  1ZTC A;  3WXC A;  2QDT A;  3I11 A;  5HH5 A;  4LE6 A;  4ZO3 A;  1KO2 A;  5EVK A;  3RKK A;  1SML A;  2E7Y A;  4HKY A;  2NZF A;  3IEL A;  4DIL A;  5A0V A;  5AEB A;  3BK2 A;  1VME A;  5K4K A;  4RAW A;  4UAM A;  5LSC A;  3SPU A;  3SW3 A;  2YNT B;  2UYX A;  2WHG A;  2XR1 A;  3I13 A;  1QH3 A;  2ZO4 A;  4C1C A;  2AZ4 A;  2GCU A;  3SBL A;  3BC2 A;  3ZR9 A;  4D1W A;  1WUO A;  4TZB A;  1X8I A;  4GCW A;  2QED A;  3RPC A;  2FU7 A;  2CBN A;  4B87 A;  3P2U A;  5FQC A;  4C09 A;  3IEK A;  3TP9 A;  2YZ3 A;  4C1D A;  4DIK A;  3H3E A;  2BG8 B;  3LVZ A;  4HL2 A;  2FK6 A;  2Q9U A;  2YNU A;  4YSB A;  5KIL A;  5A0T A;  5AXR A;  3L6N A;  1JT1 A;  5HH4 A;  3G1P A;  4C1G A;  4F6H A;  4FR7 A;  4D1T A;  4AWZ A;  2A7M A;  4CHL A;  1VGN A;  2BTN A;  1BVT A;  3X2X A;  4BP0 A;  2ZNB A;  1KR3 A;  3KL7 A;  3X2Y A;  5EV8 A;  3DHB A;  4O98 A;  1Y44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...