1E5DA

Rubredoxin oxygen:oxidoreductase (roo) from anaerobe desulfovibrio gigas
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
401
structure length
401
Chain Sequence
QATKIIDGFHLVGAIDWNSRDFHGYTLSPMGTTYNAYLVEDEKTTLFDTVKAEYKGELLCGIASVIDPKKIDYLVIQHLELDHAGALPALIEACQPEKIFTSSLGQKAMESHFHYKDWPVQVVKHGETLSLGKRTVTFYETRMLHWPDSMVSWFADEKVLISNDIFGQNIAASERFSDQIPVHTLERAMREYYANIVNPYAPQTLKAIETLVGAGVAPEFICPDHGVIFRGADQCTFAVQKYVEYAEQKPTNKVVIFYDSMWHSTEKMARVLAESFRDEGCTVKLMWCKACHHSQIMSEISDAGAVIVGSPTHNNGILPYVAGTLQYIKGLRPQNKIGGAFGSFGWSGESTKVLAEWLTGMGFDMPATPVKVKNVPTHADYEQLKTMAQTIARALKAKLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords RUBREDOXIN\:OXYGEN OXIDOREDUCTASE
publication title Structure of a Dioxygen Reduction Enzyme from Desulfovibrio Gigas
pubmed doi rcsb
total genus 145
structure length 401
sequence length 401
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1e5dA01
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1e5dA02
3S2YA 1SQSA 2GFJA 2VW8A 3IE0A 4ZO3A 4LTMA 3G1PA 4LA4A 2QWXA 3O73A 4TYFA 3H3EA 4QOEA 4TZBA 2WHGA 5ACQA 3P2UA 2BGAA 3NHRA 4XDHA 5HH5A 1AKTA 5LCHA 2P18A 4S24A 4YSLA 5F51A 5BUCA 5IQKA 2BFZA 3NLLA 3PY5A 1AG9A 4QODA 1T5BA 1J9EA 2BFZB 2BR6A 4EY2A 2NZFA 1JT1A 3WXCA 2QMYA 4BMOB 3BK1A 1WSWA 4GYUA 5LS3A 1QR2A 5K4MA 4PTZA 4LAFA 5HIOA 5B15A 4YAFA 3BK2A 5F4BA 4FGLA 1FLAA 3VPEA 3UXEA 4QOJA 2BFKA 4DILA 4GCWA 3ESHA 4PTYA 3TE7A 1YOBA 1X77A 5EMNA 4KEQA 5EA2A 4C1FA 4ZNBA 5HH6A 1B1CA 3HR4A 4NQ4A 4H2DA 2XOEA 1FLNA 4CETA 2OHJA 1DXOA 3HLYA 5B3LA 5KILA 2BIBA 2YNUA 5EV6A 2BG6A 3ES9A 2WYLA 4AX0B 3AF5A 5DPXA 2Z9DA 2WYMA 4C1DA 4Z7RA 3W79A 2FM6A 3LCMA 3N3BC 2Q9UA 3FAIA 3OWHA 3IE1A 1CZNA 4YAOA 3EYWA 4B87A 3A4YA 1JJEA 1QH3A 5FX2A 5ACRA 3LT5A 2I7XA 4F8YA 1D04A 4GYQA 2HPVA 1ZKPA 3ESZA 4RL0A 3NHPA 5AEBA 3P0RA 1AZLA 4J8PA 1XYYA 2GSWA 2Q62A 3I11A 3ZQ4A 3ESYA 1AKVA 3T9MA 3F6SA 5NLLA 2Q0JA 2V9CA 4J5HA 3RKJA 5A4KA 2BC2A 2MWMA 3KEGA 3NHUA 2F1OA 3KAPA 5ACWA 3KNSA 1WUOA 3AF6A 5AXRA 4LTDA 4UWPB 4QOIA 4EFZA 2QDSA 2ARKA 4DIKA 2M6RA 5HIQA 4PVOA 3QE2A 4TZ9A 1TLLA 1V4BA 4HL1A 3IDZA 1SMLA 1XM8A 1GG5A 2R2DA 2BF4A 5HH4A 4ICIA 1RTTA 1P9EA 1VJNA 4Y9RA 2OYSA 2QX8A 5LLDA 4ZVNA 1BVYF 4FR7A 3MD7A 5EHTA 5LMCA 1X8HA 2FU7A 2MOKA 4YSBA 2GFKA 2AIOA 2A5LA 4YALA 2FHXA 3LVZA 1C7EA 2QEDA 4UWOB 3B6MA 4HEQA 1AKWA 1RLJA 4J5FA 3IEMA 2FHXB 1H69A 4UA4A 4CF6A 3NHWA 5K0WA 1KR3A 3D7NA 1J9ZA 6NULA 4F6ZA 4HS4A 4C1CA 5HIPA 3NHYA 4U7FA 1SG0A 2I7VA 2HNBA 2Z9CA 2GKLA 3I13A 3B6JA 4PVTA 5K4KA 4AWYB 1FTGA 3JSXA 1H66A 3X2YA 5FQAA 4U4LA 3FX2A 2ZNBA 2OHIA 2FLVA 4V0HA 3JXPA 1KO2A 2OHHA 5FQCA 2DOOA 3SRXA 4FEKA 4GR9A 4D1UA 2XF4A 1RCFA 4NQ5A 2P97A 2BG7A 1AMOA 2ZZIA 2FU8A 2YZ3A 2AMJA 5LCAA 1E5DA 1CZKA 5LE1A 2BFLA 1I1OA 2R96A 3B6KA 1HLKA 4C0XA 2H6AA 4UBQA 3X2ZA 2WYMC 3FJOA 4RAMA 1DXQA 4EYLA 1CZHA 4AWZA 3F6RA 1CZUA 5ACXA 4C0WA 5EW0A 4YQEA 5A0VA 4O98A 3DHCA 5B1UA 2P4ZA 4N82A 4C09A 3OX2A 2W5UA 4FSBA 3GFQA 3T3NA 3W7AA 4AD9A 3HA2A 2YNVA 2CBNA 3PY6A 5EVDA 3BV6A 2ZKIA 4YAWA 2QDTA 2MTBA 3RPCA 1BC2A 1WUPA 4LE6A 4ZO2A 2ZWRA 4FGJA 3SW3A 3SD9A 3KLBA 3QFCA 1YCHA 5ACSA 3L9XA 4DY4A 2FAXA 4D1WA 4XWTA 1RLIA 2Y8BA 5FA6A 2I7TA 5NULA 4HL2A 1J8QA 1KO3A 3SBLA 2DKFA 5A5ZA 1FLDA 4AX1B 3SVLA 1ZWLA 3W78A 3TEMA 5FUQA 2FZ5A 4RM5A 3U7RA 3ESXA 1D4AA 5LBUA 4D1VA 3I0VA 1KBOA 5FQBA 1XYVA 4RL2A 2YNTA 5LM6A 2NYPA 4Z5YA 4TYTA 1X8IA 2Y87A 2YNTB 5LJIA 1A8TA 3DHAA 4Y7CA 5AHRA 2D5IA 4EYBA 2V5VA 3ZR9A 2WC1A 4EYFA 1DXKA 1OBOA 3TP9A 3L9WA 1QH5A 5B3KA 4TZEA 4NULA 2Z98A 4QOGA 5A0TA 3AJ3A 3OX1A 4NQ6A 5LCFA 3T3OA 5ACVA 4M0CA 2BG8A 4BMPB 5JROA 3QH8A 3R2UA 3VQZA 3DH8A 1OBVA 4NLLA 4BZ3A 4Z5ZA 3TZBA 5LVAA 3X30A 1FVXA 4ZVMA 4XUKA 2NXAA 2FCRA 2KLBA 5EAIA 2ZO4A 3N3AC 2FZVA 3I15A 5EWAA 5TGZA 5ULLA 2MT9A 4H6PA 2UYXA 1AKUA 1ZWKA 3IEKA 4H0DA 3KL7A 4WD6A 1AKRA 4QOHA 2QMZA 4NQ2A 4UWSB 1VGNA 4UWRB 3EDOA 3KAQA 3R6WA 5EV8A 3OVMA 2B3DA 4XDGA 4C1HA 1F4PA 4R81A 4FGKA 3G5MA 3ZWFA 1T0IA 2FVXA 4OXXA 2FU9A 1OFVA 2R97A 3NHLA 1JJTA 2BG2A 2A7MA 1K07A 1DX9A 2QX9A 4HKYA 2X2OA 4QOFA 2XODA 1J9GA 3FW1A 3GFRA 5ACPA 3PG4A 3F90A 4BP0A 3ZNBA 3K1YA 2M5DA 4TZFA 4FX2A 2BPOA 1MQOA 2AZ4A 2FU6A 2FX2A 1JA0A 3FVWA 4GQIA 2FOXA 5AHOA 3OJWA 4C1GA 2WRSA 1NNI1 3I14A 2N1MA 1DD6A 2HNAA 4U7GA 1YDGA 2E7YA 4EXYA 2YNVB 5ACTA 3GAMA 1X8GA 4YSKA 4XWWA 3B6IA 2BTNA 3BC2A 5AYAA 3ZHOA 2BMVA 1CZRA 2QX6A 4C1EA 2YNWA 1WRAA 4PU0A 3DHBA 1ZX1A 5K4NA 2FK6A 3NFRA 4Z6XA 4Y9UA 2KQUA 3RKKA 3S0ZA 5AXOA 4Z60A 3NHJA 2BN4A 3RPEA 1BMCA 3SPUA 2RG1A 4RAWA 3OX3A 1WSBA 1AKQA 2BMIA 3Q6VA 5EH9A 1YRHA 4N65A 1L9YA 4D1TA 1FUEA 3W77A 5B3RA 2XR1A 5EVKA 3QFRA 4D02A 4YAUA 1ZTCA 4GI5A 5LJLA 3U7IA 4C14A 3N39C 4P62A 1VMEA 5ACUA 1QRDA 3O2NA 3NHSA 4LTNA 3F9OA 1ZNBA 4UAMA 1XT6A 5A87A 1QBGA 4C76A 3FCZA 4RBSA 4Z67A 1YCGA 1KBQA 2P1EA 1FX1A 3UXHA 4ZVKA 2YCBA 1QHEA 5KIKA 4ZVLA 2Q42A 3ADRA 2Y8AA 3IE2A 1FLVA 2X2PA 2GMNA 2GCUA 5EVBA 5F12A 3OWXA 1XI2A 2NZEA 3NHKA 3L6NA 4JO0A 5LBTA 5HISA 2HB9A 4CHLA 3OJXA 4U7HA 1CZOA 2QR2A 5LSCA 2QX4A 2V5UA 1M2XA 2QINA 1A7TA 2BG8B 1YCFA 2QJSA 1WW1A 1DDKA 3IELA 4ESEA 2M5CA 3GFSA 2Q0IA 1AHNA 2FDXA 4ZEJA 1D03A 3KNRA 3FNIA 3NHFA 2BZSA 1BVTA 1BU5A 1C7FA 1XTOA 3F2VA 3IOGA 3K20A 1TIKA 2M6SA 1Y44A 4EXSA 1JA1A 1CZLA 1YKGA 4F6HA 4KEPA 4N9QA 2Z9BA 3IOFA 3X2XA 3SFPA
chains in the Genus database with same CATH superfamily
1VIVA 5DPMA 5FHQA 2Q6LA 5J2TA 1BU8A 5EE1A 5A1TA 1Q0SA 3I9OA 3KZKA 1U63A 1G20E 2XUKA 1K63A 1XMPA 3ENZA 4F5ZA 1H3NA 2H08A 1GG9A 5GAJA 5C4MA 5COBA 2KI5A 4MUHA 2QTNA 1M2HA 1NVEA 3GJSA 3IUBA 3PQ4A 4HLUC 4IR7A 2X3YA 4JNKA 3HUEA 2WB2A 5BUCA 2OD2A 4O4LF 4Q4JB 3OE5A 1DIBA 1Z2DA 4HN9A 3TTXA 3PY5A 3DZHA 3T1HB 4YJDA 2E4WA 1MA3A 1CC1S 1XZGA 3BWDD 1HDCA 4UVIA 3LH5A 3AF2A 3QPAA 5J63A 3VH1A 5A02A 5BORA 1KI9A 3KP1A 4IZIA 1MOPA 4PGHA 4AZ3A 5IHPA 3UB4A 1X39A 1SUCA 5DGIA 3Q8XB 4EEXA 4X41A 3I53A 3KTFA 2YHSA 3DE2X 5IM4A 3CUWA 2CJXA 1NN1A 1SXJD 1UXGA 4P93A 3DE1X 2FPGA 2W2VA 3WIBA 4ZICA 1LJUA 3D3NA 2NU6A 5CLFA 3D2AA 1Y1PA 3OLZA 2NVOA 4A16A 1LQ2A 1AN0A 2XOKD 3AL0C 2YRFA 4LBWA 1J2JA 2NNLD 4LC9A 5FR2A 4CLXA 3SYTA 1EX1A 2B21A 4GYJA 4E21A 1FCJA 1RKXA 5HM8A 2NVUA 2ZDGA 5LQJA 3WHIA 3WWOA 2I6GA 3PDIB 4YT8A 1TQ2A 4JLBA 2ZBGA 5BNTA 1WTAA 2O14A 1HG1A 4PIVA 2XXAB 5ALUA 2JFFA 2IZ0A 3W5BA 4K7JA 4DB4A 5EV6A 3N2ZB 4MR8A 3CLKA 3WGYA 5KO2A 1JDSA 3X2SA 1MC5A 3BXEA 3SEQA 2WE7A 3OTHA 2XJ9A 2Z43A 3B3FA 4L28A 2C0QA 2Q07A 2H06A 3OWHA 1TA4A 1W9MA 4JELA 2V4MA 2X1HA 4YAOA 5GPBA 1HNWB 4B87A 1EBUA 5C80A 4MWSA 4MS4B 4R6XA 1J97A 1UJNA 1NWHA 1HDYA 1QTRA 1LW7A 3P4UA 4PQRA 5ACRA 2C84A 3ONWA 5TQ0A 5KTRA 1IEXA 2ZRPA 3V8NA 4GWGA 4GMDA 1NHGA 1TEHA 2GD2A 4G85A 5JS8A 3H3FA 1XTBA 4N76A 3MCVA 4M3NA 1BA2A 1X7ZA 1U99A 2Z1MA 4LZZA 3RBVA 4LRUA 3MJEA 4TLBA 5EWJA 1XYYA 2VL7A 2HLDA 1P72A 2XDWA 5C46F 1Z6XA 4F04A 1E6UA 3ZDBA 1YBFA 1VCNA 4PO8A 3I11A 1OLOA 2X19A 3MK31 2C7VA 3VC2A 1P2VA 1P2GA 3B38A 5KPDA 2SNIE 5KCZA 4IDNA 4CLHA 4B2YA 1EA5A 4BVBA 1L6IA 3HU5A 2H18A 5AJHA 3HDJA 1JQJC 3GLHE 1NR7A 4KQEA 4TL9A 2DECA 3L0IB 3AP2A 2ZBDA 3D4OA 5JW6A 5TXGA 2QDSA 4DIKA 4HEHA 1RI5A 1R1DA 1SD5A 2A9RA 2H0AA 3U4CA 2II6A 3L7NA 3UAXA 3VNAA 4WACA 1M8KA 5JNTA 3GXOA 2IPLA 1Y4SA 3L8FA 1ISPA 3LCRA 2R1TA 1OAAA 4ZT3A 3VDMA 3QX8A 4UTVA 4C7OB 3QU2A 2G1PA 4MA4A 2Y2UA 2ISSD 4IIYA 1ZAYA 4FLEA 5AIJA 3V8PA 5EHTA 2QNBA 1A7JA 3DDUA 4D4LA 3IVAA 2VQ6A 4KJXA 4K9KA 4O5AA 2OA0A 1UMBA 3WJAA 3WLHA 2H31A 3CVVA 3N07A 1JG2A 2R7KA 4BNMA 2IYPA 3M1LA 1C7EA 2EWWA 4R69A 5F1YA 1YJAA 2PFGA 5KAMA 3I92A 1XNGA 5LPNA 3AXSA 3TINA 1WO8A 4FE4A 2LCFA 1KR3A 4PO9A 4CL3A 1GV0A 1Q12A 2QLFA 2XMZA 3GJ7A 3QUAA 4QG7A 2V6MA 3AHIA 4ILEA 3K31A 3ZDXB 1XVVA 2RHLA 2ZJ6A 3L8GA 2D00A 2HO5A 2Z9CA 5DH9A 5HUQA 2DTDA 4WNYA 5A3JA 5JNVA 5JYCA 2HA3A 2F1IA 1W29A 2P11A 2BFFB 4B9AA 2P91A 3TN7A 2INGX 4CQLA 3JWEA 4R0MA 4E6EA 4J1NA 1ZI9A 2VJCA 2Q3JA 3MS2A 5DW3A 3OZXA 3SIPA 2AR0A 2A30A 1V6CA 4HLQB 5EOVA 3UMMA 1KO2A 4EENA 5JDIA 3I9LA 4AW9A 4CKEB 4R05A 4A2QA 2F8SA 4D1UA 1THTA 1YCDA 3UUFA 4DV6B 2I7DA 1X1RA 2AQHA 2VYFA 2A9OA 3M5PA 4Y2RA 1O0BA 3LMKA 2PX0A 4JBXA 5ETJA 3GRRA 5EHQA 2ETVA 3KRTA 4E4TA 3DHEA 7YASA 3BBLA 5IAEA 5KWEA 2OL4A 2WWRA 1NRWA 3DTTA 4FI3C 3REQB 3NWPA 1XKXA 5C5DA 2EJVA 2B8JA 2I6SA 2MYTA 2RGXA 3BXXA 4IMJB 2GM9A 3A3KA 1NJ6A 4JXKA 1Q0HA 3V4SA 2ECKA 4HNGA 4PC7A 2MYUA 2D1QA 4DADA 1HR0B 4W5NA 5KNCA 4CTMA 1MB3A 1TTPB 1TUBA 4K05A 2IXBA 2VHUA 3RVLA 3DNMA 2BWJA 4YIHA 1L5SA 5DYWA 2IHJA 4MKGA 1L4BA 1ZU4A 4PLVA 4UE2A 4TTSA 4DUGD 2UYYA 4AVYA 4R2IA 5EZQA 5F2EA 2EOAA 2P4ZA 1K6XA 2GAFA 3GWGA 4L0QA 4MEBA 1HE1C 1TJNA 2O2XA 4RQAA 3VKGA 1B8PA 5DASA 1PVOA 4ZVRA 4Q66C 3GRYA 4NESA 3TVTA 4OAQA 5AM2A 1UZLA 3QLJA 4ZC1A 5H80A 1K86A 1FIUA 1ZUHA 4BO8A 3HA3A 4RORA 4PPNA 4K0RA 3DXYA 1MQ8B 3OT1A 4LDZA 4OSOA 3WMEA 3F73A 2JG3A 2PIDA 3URMA 2ACWA 4BAZA 4I5IA 4EW1A 1PQYA 3OPQA 2O8CB 3IAAA 1STOA 2QDTA 5BQFA 2QR5A 1NW9B 3UF0A 4W7SA 3U48A 3FHOA 3VVCA 1BD3A 1JYFA 3BKWA 4LYEA 3H0CA 3AL3A 1GGHA 3N2YA 4M87A 1N6PA 2YV3A 4FS3A 1R8QA 1R74A 4NE2A 3T5MA 3WNCA 4L9AA 1KDZA 4D1WA 2JB9A 2WIDA 2ZVPX 3N86A 1E3IA 4F4FA 4D0RA 5K1ZA 2J0SA 1A4IA 2BLNA 1N0IA 2GZAA 4J4TA 1KDTA 2AN1A 3NIWA 1ONSA 4IOKA 4PPQA 5GONF 3V2IA 3W3ZB 3KQNA 1ATZA 1A9TA 1AT1A 1NW7A 5JAHA 2RGWA 4ZEVA 3NDPA 3CLTC 1N2HA 3CLUC 3Q6MA 4KN8A 3TL6A 3W9BA 4B6FA 7ADHA 4KR6A 3DBLB 4LWZA 4UREA 4Y6RA 1OB2A 1Y63A 221PA 1E0AA 3BIWA 4QPZA 3COJA 4HH4A 1ZMOA 3ILXA 4J0IA 4KIWA 1KQNA 3ZXUB 4ALMA 1BRMA 4D1VA 3MJRA 4ONEA 4FYYA 1THMA 1XYVA 4B47A 1JB1A 1A5ZA 1D09A 1YH3A 2V6FA 4AWAA 3KJEA 1X8JA 4HR7A 3E8SA 3EY9A 5B7GA 2C59A 2QMHA 5C1DA 3I6BA 3IJRA 3OD5A 2YNTB 3LFUA 4PINA 3TUZC 2LUOA 3RRYA 3C74A 2IYSA 1XXHE 1BEZA 1GQ2A 1ZSNA 1YB7A 1RVV1 3DCNA 5BWOA 4U8HA 3TRDA 4ENQA 1A04A 2D2VA 4UUBA 3VGPA 5JYBA 3UMFA 4FJ0A 2ZSIA 1V11B 3H2HA 1V8OA 4L6AA 1QF7A 4PR3A 2Q28A 3VJLA 4HNSA 2EW1A 1EESA 1LS1A 4G0ZA 3NJRA 1XG5A 4HDKA 4BX0A 1VLJA 1EGQA 1O95C 2G06A 4OP1A 5JARA 1CS0A 1LJ8A 3LFHA 1E9CA 4BVGA 1SUDA 3LBYA 5EXTA 3B5IA 1XD9A 4EHLA 4MGYR 2JFGA 2BG8A 3FYSA 3M89A 3TR0A 1O7JA 2YVUA 3VH3A 3WRYC 3I76A 1ISFA 4FMDB 3CF6R 4X3PA 5EE5B 5FL7A 4G1EB 3ZH9B 1XZPA 3DV9A 3MWFA 5JLJA 3CTMA 2ACVA 2KLBA 2XTJA 3HGMA 3GVIA 2JBHA 1W85A 2OD9A 2P3SA 3G8YA 2W7TA 4V1CA 3LUGA 1F51E 2Y1DA 3G8AA 4TWZA 4FD3A 1FRZA 1DAOA 2VRNA 4V38A 1JQLB 5ALZA 1PFGA 1GO2A 1UEJA 3R5HA 1AGXA 2I8AA 4TN5A 1Z2EA 4FR2A 3ZWOA 1DC3A 2AJBA 4Y7DA 1SKYE 1GAXA 3AUKA 2ZI9A 4KNWA 3BJZA 3MYRA 4GMFA 2W70A 3WBKA 1YRWA 1NBMD 2G9ZA 1QANA 1U0OC 2KX7A 3IAM1 3VPAA 1QGAA 4DCJA 1HTTA 1N6LA 1HRDA 1NFQA 3ITNA 3K9CA 3QE0A 3R20A 4D4GA 5BV2P 1PJLA 3E7XA 3ZWFA 4TLDA 1KEWA 2CWWA 2RBEA 4GX5A 4BFCA 2G9VA 3QYFA 4RLQA 1K2VN 3A2MA 3TGWA 1Q0PA 3VKFA 1YB4A 2E4YA 1ZIXA 2R8RA 5IX8A 2QD3A 4M1ZA 2Q7DA 5FBVB 8ATCA 1PL6A 5L4NA 5E2BA 3UOGA 1VZ2A 1IQPA 5CIYA 1BXGA 2AMLA 3QWAA 3A32A 1U0RA 2CJYA 3R6LA 4RNCA 5E95A 1E6CA 5A7FA 3NM4A 5J4LA 4RL4A 4PZLA 3SAJA 5F1OA 3HCCA 5BNIA 2XIJA 2Y0CA 4YFYA 4E70A 5FPTA 4DHWA 4E2FA 2D62A 2OCPA 3PNSA 1N9GA 2TYSB 2J7KA 4GQIA 1X1SA 2FOXA 4FKZA 2GD1O 4X8OA 5FI1B 3RIXA 5EP4A 1WUTA 1YQTA 4RHXA 2XA1A 4NJEB 3ZNOA 3SOZA 4LZPA 1DWQA 3U3XA 4CRWB 4DCGA 2I71A 1XTQA 2BELA 1A7KA 1NUSA 4BLUA 1N0UA 2OBYA 3R5XA 4Q3KA 4C1EA 3DD1A 4TKMA 3LY5A 1DUVG 2BFPA 1Q0ZA 3EDRA 5EQTA 2ZBQA 3EPKA 2R79A 2OCAA 1SXHA 1KI2A 4NPCA 1JILA 3AHFA 3B9BA 1EAYA 3RFVA 3QKRA 1KK0A 4O2AF 4M1TA 3M4XA 1SBHA 1YNSA 2PWBA 4QWWA 4L22A 1P0FA 1X19A 2D8MA 3OX3A 3I5XA 1RM0A 5TJHA 3K70D 4M83A 5A6SA 1ENOA 4M1OA 2A9FA 1JXAA 3IQZA 4RVFA 4XE5A 3TNYA 1GQQA 1Y3CE 1L9YA 1WW3A 4FYWA 3QPBA 1FMTA 1E2FA 2VAPA 4QARA 4ND2A 1GA6A 3OIVA 4RHCA 4LY0A 4GI5A 1I1HA 4AMYA 4B43A 3S55A 1EU1A 2NZUG 4EFKA 4LMPA 5GWXA 2H4XA 2I66A 2Y9MB 2AN9A 2GYWA 1KSFX 1DV1A 4MI9A 1OLSA 1N5MA 3HR8A 1XHEA 3BJMA 3KKKA 3O2JA 4NH4A 4PLZA 1VPEA 5IJZA 4WK4B 3D02A 1NHWA 4EMBA 2LIVA 4PZAA 1OPRA 1YS4A 1QAOA 1ZP6A 2A58A 2GBFA 4DIOA 3O4GA 4OP3A 5REQB 5IAAA 1JSLA 2DWQA 2FSVA 2O2YA 2HO4A 2VQDA 3GJYA 3QX9A 2EBHX 4JA2A 1T4CA 3QUSA 1KQPA 1XZJA 2IU3A 2COUA 2RAPA 1D2CA 1U94A 1NMZA 3BQNB 1QZTA 1RABA 3JQQA 4NYMQ 4TGLA 3ZWCA 4Y3UA 5FTWA 2QTZA 3FLEA 4CDRA 1VPVA 1UJ6A 2ZJFA 5FPPA 3K9BA 5BWCA 3VX3A 2FFBA 1PSWA 2OESA 1ZISA 4FFVA 3WLKX 2JLYA 1NPDA 2XVAA 5HISA 4RCVA 2UUPA 1PUIA 4KO3S 4ZHQF 4YMUA 2RD2A 5DTMA 2C77A 2FX5A 4B8YA 1V1JA 4J6FA 4AWBA 4TMKA 3LPDA 5CB4B 1NP7A 2FZWA 4RHFA 3FOEC 4ENSA 5B30A 5DO9A 1E79A 1XZLA 5BVHB 3FGOA 4FZ3A 5DGXA 2ODEA 3WADA 3GCWA 1MAUA 4BB0A 2X23A 1RS0A 4IMRA 4M6WB 3UJBA 2IEBA 4LRYA 3RYIA 3VSCA 1GJRA 1T29A 5GQSA 3TFQA 4G1BA 3NVKI 4MR7B 1ZZGA 2QUJA 4Q3NA 3WKDA 4DQKA 5IJ9B 5HNKA 2PJRA 4RWEA 1UKEA 1RJFA 2XMQA 1G8SA 3Q6NA 4HZUB 1Q21A 2JFQA 4BMDA 3FUXA 1G7TA 1QZ3A 3P9NA 1N6OA 3ENNA 3ZZ0A 2QXTA 5ALIA 3PEWA 1T8PA 3M9LA 2AZXA 3I9KA 5SYNA 4CN8A 1TIKA 4X71A 2I29A 5I7VA 2O2SA 3IRVA 3NOXA 2GXSA 4G65A 3RSQA 3AK4A 2ZIXB 1P60A 2XWPA 4EATA 1V2GA 5KNBD 1H0RA 4JI0B 1UFVA 2D8AA 1DXHA 2X1LA 3EULA 4CUKA 4Q4CA 2PUGA 1L4GA 2WT9A 3HFGA 1I3MA 5IZCC 5JD6A 4DLRA 3DFZA 1ZFNA 2DFNA 4M7WA 1P9RA 1SQSA 3ESQA 3GEGA 3I0NA 3K6JA 4H1UA 4LTMA 5DMHA 4LA4A 3TEJA 3O73A 4OUDB 1H1DA 3AU9A 5SZIA 1UFOA 5DISB 3LUPA 2D74A 3LLCA 3O7WA 3Q7RA 5DM2A 1MX9A 3ZKWA 5HILA 5IBCA 4OJMX 5JRDS 5GOZA 5KDDA 1CG6A 4XDHA 3OQPA 4EELA 4JYBA 2BTEA 1AKTA 3CBQA 4WZZA 1N2SA 5AW1A 5IULC 4CBVA 3DLAA 1FTQA 4KAFA 1PWXA 3TW8B 3NLLA 4ER6A 4TV9A 3NNSA 4HXFB 4JP5A 4ZZ2A 3TQFA 5TDHA 2CY0A 2O1EA 1W47A 1JE0A 2YHUA 3PGMA 3H5TA 1T43A 1U0FA 3K09A 1YZVA 3EZ6A 1SB9A 1A7AA 1JE1A 2QTGA 2V6IA 3P27A 2O1WA 4G07A 4LUCA 2Z5GA 2WNHA 3KSBC 1RWKA 1Z6QA 3G0IA 1KS9A 1JKJB 4EARA 2D2XA 3BN3A 3ZJ5A 3L0ZA 3QE4A 4KGZA 3ZHTA 1SM4A 4KQ2A 1BXZA 1DQNA 2Z8YM 3BF7A 3EJWA 4NNPA 3UANA 3O8LA 4XGIA 1TYAE 4FDAA 3MD9A 3RQSA 1ZC3A 1Q44A 1X1EA 1DOZA 3LP5A 4DXAA 4G24A 1ES9A 1CY7A 2P6NA 4O29A 4YCJA 4KEQA 5FA8A 3DEZA 3LDGA 1ULZA 2HA6A 1GT6A 3H3XA 4GHWA 4COOA 1IN8A 1DEHA 5I7HA 3AFHA 3HV2A 4EPVA 1YE3A 3IH5A 1TE2A 4D9NA 1PR4A 1YSCA 2RGNA 1KMHA 3V1TC 3HLYA 2BIBA 1W5AA 4HTFB 2YNUA 1NVGA 3SF0A 3ICVA 2BG6A 3H8SA 2MJLA 1MQSA 3DZIA 2EF1A 3MJFA 1B15A 4GLLA 4G0YA 5A5EA 3AEZA 3UBTA 4QJBA 2QP3A 2BOVA 1AUOA 2V98A 2G0TA 2ZI7A 1B2RA 1B6GA 4KWHA 2BFDB 3AV3A 4DMHA 4JLOA 1B14A 1IHUA 5B55A 2LZ0A 3ELYA 1GA1A 4KDEA 4ENWA 5EP2A 2ZQZA 1JALA 5FX2A 1Q14A 2HDHA 2YZ2A 4HX2A 3EUWA 3V8MA 4BFSA 1D04A 1RC1A 1P7CA 1ECJA 1GUAA 1UZMA 3A7DA 3BE5A 4OD0A 4DJ5X 4XA8A 2EP5A 2WR8A 2W2KB 3ZGVA 2QAIA 3NHPA 1FEZA 3VU3A 2DPYA 3VR6H 2R8OA 3KPVA 4ED9A 3LNTA 3EXAA 3P2MA 2QRJA 1KPGA 3S3TA 3EE6A 3DULA 3T9AA 3VMFA 4A2WA 2NTNA 2V6GA 4CF5A 4ER0A 4W9MC 1FNCA 1MDBA 1T5OA 2KMLA 3RKJA 2A8YA 2BDEA 5CHEA 2GN2A 4YP9A 1AHIA 5AYVA 1B0ZA 3W8FA 3F9RA 3SU8A 2GTIA 2IS1A 4K03A 3ZU5A 1YKFA 3GZJA 4GUAA 1AKEA 1XPRA 2XAAA 1MX3A 1ZKDA 1QG4A 1TW3A 1Z17A 2ZRNA 5AKHA 3NTUA 1QS0A 2B98A 1Z15A 4QDOA 5DK6A 1N9ZA 1OFUA 1VL2A 1ZCFA 4DJDC 2AVDA 5DCYA 1GG5A 4GI2A 5I9MA 1KS2A 5A1JA 3D2BA 1NN5A 1PLLA 4XQCA 4YJKA 2FQWA 3NBMA 4F6RB 5CFMA 5HQTA 1HKUA 2ASEA 4FR7A 1N8SA 2EX1A 2OHVA 3QK7A 2AR7A 2XYRA 6LDHA 4YSBA 3A8TA 4HDNB 3HJGA 1AQYA 1GQOA 1DAPA 2G1UA 4JU9A 1N36B 3MINA 2YMQA 1SOAA 1Q83A 3KC2A 5G02A 4XJVA 1AKWA 1RLJA 2CBZA 1MT0A 3BWBA 4NCXA 3RT7A 4UA4A 3JQCA 2G1AA 2H5EA 5HKKD 4NG5A 3D7NA 4JBIA 3IEVA 1QYCA 3CZPA 2GZ1A 3IHLA 3KOXA 4RDIA 4F6ZA 3UT6A 3AY7A 3NHYA 1IM8A 4KR3A 4HQ0A 1I80A 3QBDA 3LUBA 4P3PA 4PG7A 1GZ6A 3IJPA 1TCCA 3EOBI 4JSTA 1FDUA 4TKLA 2I6QA 4GQAA 4ZU6X 5B3JA 1OZFA 3CV3A 4ZT2A 3KOOA 2VYND 3OLWA 1LNSA 2D1RA 3WTCA 3ZD8A 1ESMA 4JJ7A 1E1CB 2BFWA 3M3DA 4NYJR 4MMZB 4ZCTA 3LHKA 4P3XA 2XF4A 1M6WA 3L7CA 1GY8A 2I2WA 2FHSA 2GPBA 3KE8A 4QU0A 5L4LA 3TQHA 1OSNA 4DQVA 2NUPB 1EAMA 1GYQA 1XZIA 2B25A 3G0BA 3K6SB 3A4MA 3HI4A 1XRPA 2ZYTX 3LF2A 3GF4A 2X1VA 3R5JA 3TB4A 2R96A 1HPLA 4TZKA 4GDFA 3N70A 2FRDA 2WTXA 3F71A 2XCQA 3J7TA 1GPWB 4FYMA 2D2EA 4J29A 5DHTA 2IDJA 1CLEA 3X1JA 3OUUA 4J6EA 5HRCA 3EZYA 4KAXA 1O96B 1N2EA 2B0CA 5EHZA 3O8CA 1QVAA 2CJWB 4J7XA 3B1WA 2BY4A 4ETIA 5A3QA 3A2KA 3BGVA 4EJ2A 1V8PA 5BQOA 3DMPA 4XTCS 5E6RA 5A0VA 4OJNA 2ZXEA 1KEZA 2AW3A 1H93A 1UBLS 1LSUA 2HD4A 1HH4A 3M70A 5CYOA 5K3AA 5IEBA 1K68A 1JZQA 4OHUA 3AG5A 5ILQA 4FHFA 4QA9A 4J7CA 4RD2A 4XWYA 5EP1A 5EXDA 4F9EA 2JLXA 1DIOB 4DCNA 2OXFA 1LDNA 2BC9A 3IMCA 5JCZA 1NMYA 1D8TA 4X54A 2ZKIA 4KMRA 1BFDA 1SUFA 3CY6A 3QEJA 1P80A 4ZO8A 1GAJA 2DBYA 3VUFA 4C7JA 4Q3AA 2VKTA 2ZSJA 4BMVA 1E58A 3ANTA 1KQGA 3E48A 1ZKMA 3EVBA 1K3UB 3SY8A 1N34B 3DSRA 1C41A 1FPMA 2WOJA 4OHWA 4MUJA 1UAYA 3FCEA 3FYUB 3JQDA 3M3PA 1MG5A 4M1WA 4P5EA 2AH5A 4YJ3B 2JIDA 2FUG6 2PV7A 1TEVA 4FFLA 1J6UA 1E8NA 4OQ4A 4Q9JA 5J1SB 1MHTA 2GF0A 3QHPA 4KO4S 4AFNA 4HRAA 1UKBA 1G98A 1U0LA 1ZU5A 3CLSC 4IP0A 5H83A 1ENPA 3CJTA 1KE2A 4HL2A 4CIXA 3LHDA 3NBXX 1FXWA 3MRXA 4YT2A 2IYXA 4JJEA 1ZWLA 4Q4DA 1AMUA 5BSVA 3SYRA 1P9OA 4GBMA 3V8EA 4ECEA 1IZ0A 1UC8A 3ESXA 2IPAB 4FYPA 5C18A 5HQ3A 1ZCAA 1GFIA 1RQNA 3D31A 3HUTA 2Y2VA 4KL8S 4P4TA 3TRJA 4DDVA 3LXMA 3HB1A 3VR4H 1MCZA 5IJAA 4ZVLA 1XO1A 4QDXA 2I2XB 4LNUA 2WOOA 5TQJA 4DDMA 3OCZA 2RJOA 5CITA 1H2WA 2EXXA 1PJ8A 2P65A 2YXLA 4EBBA 5LJIA 1E8MA 5ILGA 3DHAA 3RW9A 3C41J 3VKUA 3WRXA 1VIAA 1EQUA 2V5VA 3D0RA 3I2FA 3L1JA 4X90A 4CL8A 2O4UX 4NYIR 3E0XA 4GOJA 3R7LA 3TIFA 2G8NA 4D8UA 4EYFA 2F3TA 2ZQ5A 1BEUB 3NTOA 2HW8A 2RI1A 1Z5WA 3AI2A 1KKLA 1V1MA 2K7ZA 3QKSA 1L4FA 1Q95A 5T6BA 3ER6A 1CXZA 5FO1A 2CLHB 2JEZA 3ND9A 3ZE2B 3RVJA 2PWYA 1SHKA 3AJ3A 3GJRA 3GMIA 4TTIA 3UO8B 1WDMA 2VKQA 4MVXA 1QNFA 3U4HA 1QGYA 4ZI5A 1H4QA 4FLMA 1X74A 2YN0A 3QGMA 2P6UA 3OHSX 4L4UA 4MW7A 3RUFA 5C8XA 4PYMA 5I48A 1UBHS 4CGYA 5JROA 4Y1RB 3F8TA 1JTVA 4IRXA 4NBVA 3I1FA 3LA8A 1QHGA 1PJRA 2V45A 3DE4X 5FF9A 1IBRA 4JJGA 3L18A 5HHTA 1D7OA 2NACA 3JRNA 3W3AH 1MLDA 3VAZA 3VYTB 4DLZA 1W19A 1GPLA 1U98A 3P0FA 1G9TA 2YOHA 4JLVA 3RE1A 3ESCA 3FSGD 1T3SA 4BP8A 1ZQ9A 1PL0A 4RMIA 2BMJA 5CYPA 2MT9A 4DEXA 5L3QA 5EWMA 1G4AE 2CVOA 3GLHB 1NC3A 2KBFA 3KCNA 2FR8C 4ND1A 4NQ2A 4UEQA 3OO0A 4LGMA 5C8ZA 3ZHCA 4AN0A 2ZRQA 1YTUA 3BTSA 5AW8A 3COPA 3KAQA 3LCJA 5HF8A 4JR0A 4EX6A 2J85A 3OLYA 4QELA 1HEYA 4XDGA 4E13A 1MQAA 2QGFA 4LECA 2ZU0C 2XQFA 2JIZA 1O8CA 1JQEA 3T7EA 1U2SA 4MZXA 2R8BA 3G2QA 1BX1A 3USCS 1UT6A 1FUUA 3EZ2A 1EUYA 2FU9A 1PYGA 1D2NA 2AN3A 3NHLA 1P0PA 4PGMA 5CLQA 1K7YA 3OPVA 2QENA 1U8FO 3WL7A 7REQA 1PFQA 4IIXA 1G9XA 1U6KA 1R0WA 2D0DA 2WTNA 1IIRA 3OPYB 1L4KA 3UOWA 3ZWAA 3ZX4A 1TUEA 1LDYA 2PUHA 8OHMA 4BX8A 1U1EA 5KU7A 1ZH8A 3D7MA 3KEMA 1B23P 1U28C 5ACPA 1RJEA 1U5BA 4EKNB 1AK1A 4YGXB 3MCUA 5C4GB 2FMIA 3T7JA 5I3ZA 1J23A 2BT4A 5L9AA 1GPMA 2A2ZA 3A25A 4C29A 5FYDA 1KFBB 3KAJA 3U17A 2W90A 3MJHA 4WESA 1D2RA 4J4HA 3I14A 2QN6A 1RKUA 5CA0A 3SEFA 4R1SA 5E9JA 1E9AA 4RJLA 3UK1A 1ZRSA 3HP1A 3PQ5A 5LLSA 5I01A 3RVRA 2BYTA 2YNVB 1NULA 3TECE 5DNWA 5DI9A 1GEEA 1DCMA 1JI3A 1MAWA 1XQ6A 2ZZMA 4MQUA 2DHEA 3ZDCA 5FWYA 1UXOA 2WSBA 2YNWA 1OKKA 4RENA 2XNCA 2CHUA 2VHZA 1SC1A 3WS7A 2JATA 3EFOB 1LBQA 3OU6A 1C3EA 5EERA 2ZSEA 2FR1A 4XUCA 5FTMA 2I8CA 2J67A 2QNIA 1CEXA 1SCUA 2CYBA 2RG1A 1M2WA 1WY7A 2R4TA 5DRYA 4H77A 5C31A 2W2LD 2BMIA 1U7HA 3U4MA 2PD4A 1ZOIA 3UJHA 3OLCX 4R9VA 3UUGA 3QEKA 3QFRA 3T3EA 2NU9B 3THOA 1ZTCA 3K1ZA 1OXUA 4J03A 3WAJA 1C30B 4IYJA 2VUTA 1WSAA 1EFHA 1JR4A 2GI4A 3Q2KA 4N40A 1K5HA 3PKIA 5EGSA 5F5NA 3D0QA 5DGHA 1Z0JA 1IDOA 1NMSA 2XE7A 1DJLA 2WUEA 4JDPA 3OA0A 1RR6A 3TXAA 1JHZA 5CB6A 1SOWA 3N2GB 4IGFA 621PA 1KL7A 5KOJA 3AQ4A 1YS1X 2VTEA 1YCGA 4RSGA 4TL6A 1EIZA 1HWYA 3IAHA 3P9RA 2PFKA 2X15A 4QGFA 4X8MA 3O8QB 2WFLA 4QNMA 3TW6A 3S81A 3ZCXA 1OBFO 2R3SA 2X3FA 5F52A 3OLVA 3UICA 4EJFA 4CG0A 1XAIA 2A1UA 4C01A 3RAGA 5KHLB 3IURA 1D8AA 1YI1A 3EPRA 1CCWA 3F6BX 4YCCA 1C1XA 2YR0A 5LD2B 1WMSA 2XRYA 3ZX5A 1T3LA 4N8EA 2O8VA 4C87A 1Z16A 1HT3A 4E5UA 2H2IA 1P4SA 4ZJPA 2VXBA 3F6EX 3ZHUA 4CHLA 3H04A 2A4MA 2Z0MA 4HNUA 2JLUA 1CRQA 1W73A 2Q2OA 2XTMA 2ZAOA 3I34X 2VNIA 2HAEA 1VCHA 2OM6A 2ZIFA 3DOIA 1E3LA 2A0KA 1ECCA 1ABBA 3TDMA 5TT0A 2JIMA 2WM2A 1RFGE 3OECA 2F3UA 4FIDA 3AF1A 2FNAA 3GT4A 2VRCD 4ZKDA 1DSSG 3T95A 1BHJA 1GAEO 1E4VA 1XZKA 3LE8A 4HGQA 2D59A 2E2WA 4LQCA 3SQXA 4WOCA 1LTKA 4UBIA 2Q2VA 4I7EA 5KOIA 3DDZX 4TVKA 5IF3A 3MJDA 1U9ZA 5EZYF 5E0KB 1SCAA 3GFBA 1N5DA 1BCSA 1O9BA 1VLMA 1RIFA 2WD7B 1DG9A 1CK4A 1CNMA 1S89A 5IYZA 2CDBA 4U02A 1CQXA 1T8YA 3KQMA 3STTA 2QLLA 3V6LA 1G1AA 1Y80A 3NALA 1GUFA 1JA1A 1E1RA 3HL4A 4HB0A 1KVRA 1UM9B 1PZNA 4EDFA 1G4UR 1O94C 2BGLA 3SXUA 2EFHB 4IL5A 4K1LA 3R7AA 3IUSA 5LQRA 1TD9A 2IEDA 5FO0A 4KR2A 2EFGA 1K3FA 3M7IA 4O2AA 3SHFA 3LOQA 1CR2A 5JH7A 5G4KA 3EF0A 5A4FS 4PZZA 1E1DA 2IXGA 3OZIA 4CF7A 2XQIA 2W4QA 4AKSA 1NVMB 1SQ0A 4KBFA 3TAXA 3FSRA 4DDWA 4FGZA 2J5BA 5FBQB 1KYXA 3UJAA 3SDBA 5JI2E 1DJQA 4PAWA 1O6GA 5CHYA 2ILVA 3ORSA 4WKNA 1JJIA 1NRJB 3KKQA 3C5VA 4UPVA 3JQRA 1ZUWA 1IEQA 1ODLA 3BFKA 3NO4A 2RH8A 4M9CA 4TLAA 1TRHA 3A04A 4PCAA 1TT5A 2BFZB 4JEHA 3W7VA 3VA7A 2NPOA 2XVZA 3EXEA 3EOZA 3O0DA 4EQ6B 4HN2A 4DEYA 2GSDA 2WPDA 3CLHA 5KWJA 2QMYA 1WSWA 4HSGA 3BGOS 2YJ5A 1AMNA 1OUMA 3DO8A 4LAFA 4PX3A 1Y89A 3ZVLA 1I2MA 1A4XA 1BHQ1 1DBPA 3NWBA 4YAFA 3C7CB 3CLTD 1JR2A 2PL1A 3RUAA 1DOHA 3R77A 1YB5A 2NU7A 1PP4A 3B2EA 1R0ZA 4FMDF 1S8FA 3WO0A 1J25A 2LV8A 1BEEA 1LPSA 4KH0A 3TX2A 4CM5A 4MWOA 1NF8A 3EZFA 2L2QA 3HR4A 3WJ1A 4IO0A 4LJAA 5F78A 5EQJB 2SCUA 5E6SA 4U6SA 1SKYB 2RHJA 1GWNA 3IQHX 3RYCB 1POWA 5AH0A 3IIEA 3L6EA 1QYWA 3LGSA 1X7GA 1XTPA 3GLTA 4R2LA 1T3ZA 4KDRA 5DK4A 4F46A 3PX2A 2F62A 3D6FA 3I39X 1YR9A 2WYLA 1E9SA 2NUAB 3B5JA 4ASUA 4AZ0B 3VC3A 5LYJF 3MT0A 2OV2A 3K8QA 4EYKA 3N3BC 1ESEA 2QRQA 2ZI4A 1P9NA 4ITVA 4X24A 3H5VA 2JGRA 3AHJA 2KPOA 2DBQA 3LCVB 3CLRD 4H27A 4MB6A 3V48A 2L69A 3VPGA 2PS3A 4HAZA 5JATA 1ITZA 5AJUA 2UZ1A 2C7PA 3LLMA 4ATNA 1QH3A 5K4NA 1YZNA 2O2HA 3IQIX 1RBZA 2JBWA 3K9HA 3LT5A 2XUGA 1O95D 2IF0A 2VCEA 2C9DA 4YP0A 3K4QA 5SZHB 3I04M 4KIFA 1M1XB 3FVTA 1ODKA 1A50B 2E82A 5HDBB 5TF4A 2ET6A 3RGWS 3TNLA 1NDUA 3P9KA 3WP0A 4D2IA 5BN4A 2YW2A 1CRLA 1W4CA 3DBVO 5CB0A 1BE8A 4Q34A 2L18A 2BEWB 3WWYA 2AD1A 1T9GS 1GNLA 5C5CA 1XCBA 4JEMA 4E2ZA 2B8EA 1PHPA 1XSEA 2FVYA 3ZJ4A 1O77A 1C3LA 1JU3A 1T5LA 1P4RA 3KKOA 1P3Y1 3KAPA 2FDCA 1IC6A 4QWMA 3PPVA 5AQEA 2GXQA 1HORA 1P19A 3KVNA 2IUEA 3LGAA 4LI3X 4MUXA 3RIHA 1DLJA 4D6PA 3W6ZA 2C5EA 5F33A 1B0PA 3EUAA 4EJSC 1TOAA 2UDPA 1R6XA 4PVOA 1SGWA 4KVZA 2VAVA 4I4NA 3X1KA 4UBJA 2DPGA 1K8XB 3DLTA 5FNZA 2CVPA 2F8LA 1EFCA 3PD1A 1I6WA 3ISVA 4BKQA 1QGUA 3BL8A 5JNLA 1NLUA 1XLTA 3CT6A 5P21A 2AW5A 1JHAA 4Y2VA 4X0EA 4DIMA 1IXSB 1SNYA 2Z1NA 3HJUA 3VVBA 3O93A 2C8KA 4N0DA 9ATCA 1KO5A 5LMCA 1UK6A 3BX1A 2WHRA 1DKQA 2BE9A 1P8JA 5EMKA 1RCTE 2PJZA 3SN6A 5C1PA 2EYQA 4DV2B 4R2WA 5E2AA 1YMUA 4I55B 4RGYA 4JVMA 1AS0A 3D1JA 1E99A 2RARA 2R1UA 2OD7A 1E2MA 2I76A 2OFWA 3KPJA 4OVKA 5IBQA 4ADSG 3NBYC 3KB1A 1CLUA 3EVCA 1FSZA 3BEOA 4ZIRA 1J9ZA 2PZFA 1JJ7A 5DTQA 5MN6A 5HZHA 1C3XA 1RBQA 2X4GA 4G5HA 1Y1RA 2PMCA 4BVFA 1I14A 5IM4F 3KPYA 4KQHA 5EIOA 3I4LA 4PS1A 3VHLB 3TZLA 1RYBA 4RFSA 5LZ7A 1JHQA 1XK6A 1UEXC 4OTZA 4JT2A 1FTGA 3WYGA 1U7WA 3R3VA 4F7WA 1MKYA 2GH1A 1JHOA 1HYBA 3F98A 1FP4A 2B4YA 3KT6A 4IDGA 2AKAB 3ZWPA 4B71A 2G80A 2VH1A 1U1FA 1A3CA 1DKRA 1EFPA 5ICEA 2XSZD 3NM6B 3ZW8A 4WW0A 1NVAA 1XP5A 4RF2A 3OTGA 5FV4A 2GKOA 4OG2A 5LL6P 4ECAA 2QT9A 2V7QA 4QYIA 2DOOA 1IB0A 3EVZA 3MWEA 1CY2A 3QJ5A 2KYRA 2ZIZA 2AA3A 5CT4A 1DDOA 1ZMBA 1SOMA 2X5OA 2XKJE 2AHRA 3GLQA 5AVOA 2FUG1 3S28A 1KAOA 4C0SA 5IASA 1AMOA 1PQPA 1KI1A 1KJ9A 3QLTA 3CKKA 4F3KA 2CG2A 2XVMA 1FU4A 3AYXB 2H29A 1CQIB 2ZSHA 4YV0A 1RI1A 3B9PA 1WSDA 4ZZ1A 4OXQA 4Z7QB 1GUZA 3QIAA 1H23A 2ID8A 4I1UA 2RHMA 3HFRA 4CKCB 3NUGA 3N2KA 4UBQA 4IJWA 5T3UA 3SYNA 2X1MA 3EEOA 1G6HA 1LLUA 4DGQA 1KP3A 1J39A 4LE2A 1XAGA 4B6QA 2WYOA 4B2PA 3GN1A 5CB4F 1CZUA 1D9XA 2UAGA 1GZHB 4PQEA 1XD2B 3G88A 3RS5A 2VPPA 3TB6A 3DHCA 3UN1A 3AUJB 3FWZA 2VZ0A 3MTAA 1YGYA 3WQRA 5JZMA 1N2JA 3STYA 2ODQA 3BERA 3LLSA 1ZJYA 4OBEA 1JWLA 3KR2A 1WULS 4UHJA 3R4VA 5AVZA 2OQRA 4EKEA 3BMOA 4AD9A 3WB0A 2PUAA 4BECA 1B26A 1IDN1 2XQKA 5AI6A 4CT5A 2RK3A 2A78A 4ZI7B 2FYTA 4KFRA 2G9UA 1H1LA 2AYXA 2EKDA 3FM9A 4QHYA 2EIXA 2ATXA 4RZHA 1LU9A 3PUZA 1R4MB 4OJKA 3SC2B 1QYVA 2WZCA 2J0UB 3BRCA 3C6QA 3IERA 3EZNA 1YV9A 2C4UA 1NC1A 3JQ7B 4JL6A 4Y0NA 2OAQ1 1J8DA 2HADA 4MMXB 3QYJA 4Q1DA 4IV0A 4LYAA 4RCYA 4FLFA 3NPAA 1Z6PA 4EGFA 3TAHA 4LMAA 3W7BA 4MKFA 1I5RA 5JJLA 2WIJA 1FU7A 1JFFB 1O6CA 1FDRA 4QTTB 1TADA 4A6XA 3AVWA 3GYGA 5C5IA 1YA4A 3ZEIA 4HNVA 4JP8A 4B7UA 3ESHA 4JY7A 4DAEA 1TZKA 2HSDA 1XCJA 1U9IC 4D3YA 3L4SO 4Q37A 1KO3A 3VR6D 1LBHA 2D3TA 2AF3C 3EVAA 1P7ZA 4ZV9A 4AX1B 1GZ3A 2B94A 3P9QA 3DFFA 2PMEA 3WWPA 1HK7A 3TYXA 4G5GA 4RM5A 1CJTC 4UARA 3SVZA 5CU7A 3VOSA 4WVLA 4YUAA 1THZA 1OBCA 4FILA 3UV3A 1L5KA 4OYRA 3VI3B 3BVPA 4KLZA 4IXMA 3JR3A 3PHGA 1KOJA 1FNBA 2VT6A 2VBIA 5BW4A 1XCOA 4HX5A 1NI3A 2MIIA 3FDFA 1Q1AA 2R1VB 3QSYA 1A8TA 1C4KA 3SX2A 2GPAA 4LRTB 3E5HA 1W581 4GD3Q 1IVYA 1KO8A 4BS9A 5DM70 1DO8A 1LFDB 2P5UA 4FW9A 5DIFA 2BV3A 2R66A 3OFVA 3E23A 4GI3A 4C21A 2ZT8A 3H84A 4L2IB 5LIRA 1HKHA 1ZNQO 2J5XA 1FTWA 3MUOA 1SU7A 4I9UA 2C5GA 3HHEA 4OHXA 5KTNA 4P4SB 1KC3A 3OOHA 5B3KA 4Y1FA 1C9DB 1HMYA 4X93A 4DQLA 1RYMA 3VJMA 2UZ4A 2A0XA 1MNQA 1ZBQA 5AUOB 1B6RA 1M0SA 1E61A 1GNTA 4RJJA 5CNMA 2C58A 2CLEB 1EHIA 4K9MA 3U7JA 2V3CC 2GKGA 4BMPB 3GJ0A 3Q1LA 4BNUA 1WEHA 5JFTA 3QH8A 4I4TB 3OJ0A 3VQZA 4Y2YA 1PDVA 4PYLA 1H2ZA 3RB8A 3C48A 1ECGA 2QTVA 1NKVA 4KNYA 3L49A 2HFJA 1YIOA 2PSSA 4AT1A 1VHDA 5D00A 2QLMA 1SEPA 3PZBA 3WIEA 1AQ6A 2NV2B 1I4OA 3MAGA 4OJTA 3LRTA 2P9CA 1JMVA 1P6QA 3LG2A 3NJ8A 4NEGA 2DFVA 1F8UA 1Q0RA 2C82A 3MMPA 1QIMA 1V9LA 1Z73A 2WU0A 2Q3FA 1JLLB 2QORA 2VCYA 3D5EA 3KB8A 4EI7A 2BGGA 2BCGY 5EUBA 4WK6A 1I4TD 2OV6A 2G3YA 4RHYA 1YVRA 4NFYA 4NABA 1Z7GA 4D26A 1GCOA 4NHEA 5BQ3A 3D81A 1PEDA 3BYZA 1F4PA 2FXIA 4JROA 3QBVA 1M1NB 2Q9BA 3QU9A 3UXMA 4F1JA 3OP1A 1RXVA 2F3PA 5HJEA 4MUKA 3N8NA 3C16C 1YC5A 3MNFA 2QK4A 4OIMA 7AT1A 2BE7A 2Z4SA 2OMEA 2GXAA 2JGNA 4FNAA 4ML3A 2YVAA 1QFJA 2FXVA 2JCBA 3K2BA 3O4RA 1L5LA 4F97A 5IT0A 1Z4IA 5A23A 3CZMA 4YRAA 1RPZA 1UKCA 2FZCA 3KALA 2J46A 3B1YA 4FDLA 3S1AB 3VU8A 3TO5A 2UUOA 4QFMA 3E2IA 4MW2A 1CIVA 3PD0A 5JXJA 4QOFA 1SC6A 5CVUA 5BV0A 4RESA 1KK2A 3K71B 4Y2HA 1FMJA 4UJ5A 2C04A 2QG6A 3IHWA 4W6QA 4XFKA 5DYTA 2VDWA 3THSA 2BPOA 4UOZA 1P0MA 3TKYA 4XUGB 1PR2A 1ZGJA 2IVZA 3H9UA 1LV8A 2FF7A 3ZGXA 1QH8A 4MQ4A 3ICEA 3PT9A 4DCCA 5KJ1A 1RXYA 1RQPA 3DDWA 3FNQA 1VQ1A 4DG9A 2HIHA 4MIYA 4TRJA 1UUFA 4M8LA 3SDZA 3B3QA 3UJCA 1GPYA 2X0KA 3R9KA 3R7WB 1U4SA 1R18A 5TRTA 1PN3A 2GZHA 2J45A 2VXYA 5KINB 3CRVA 1QPZA 5AFSA 16PKA 3NFRA 1L5HA 3FFBA 4D80A 3O7MA 4ERXA 4HDCA 2OCXA 2VNJA 4Z9BA 4J0KA 1Q3HA 3F1LA 3WFZA 3O8OB 1EYZA 2B1GA 4GGPA 1XZNA 2PT9A 4QXAA 3UJ3X 1NRXA 4CIWA 3FTNA 4MS4A 3WOVA 2NVWA 2VNHA 3A3OA 4OH1A 4RQTA 3E3NA 1J21A 1F38A 2P0EA 3L4BA 5EJAA 4Z6KA 4PANA 5JWHA 3EEBA 1XGKA 4WT7A 3HB9A 3IPRA 2WKQA 2ZYIA 1TVKA 1QK3A 1L5FA 1XWFA 4P62A 4NR0A 2GBCA 4BQFA 2ZB4A 1QRDA 4FYIA 4A03A 1U8YA 3HCFA 4F85A 5ICGA 3OJFA 2EJTA 1H3EA 1NW4A 1B7GO 3I37X 3BWCA 4GBED 3RCBA 3IEUA 2FWRA 3FN4A 1OFIA 3PXDA 2BZ0A 2WJ6A 3VR4D 1XT6A 3OZDA 2ZRIA 3OJLA 1KBQA 3ZLBA 2X6QA 3QYPA 1HV8A 4BDSA 1BH6A 5IHXA 1K75A 2ADMA 1QNLA 5IDXA 3DH0A 4R9SA 5DLPA 2VH2A 4J43A 3NAZA 2B8NA 1FRFS 4XYEA 5FUYA 1NMXA 2CNWD 4FCCA 3EHEA 2C29D 3C5EA 1I51A 1T1SA 3KT0A 3L4EA 3EOAI 3HFJA 3M6VA 4MTCA 3L6NA 2Q0XA 5BSHA 4NL4H 5HTOA 1SA0B 4FI3F 4A8JB 4CUZA 3IT3A 1NQWA 4A10A 1YFLA 4R51A 1Z36A 1V8BA 5EHIA 2IPXA 5BRNA 1OZHA 4H59A 5C81A 2J3HA 1UIRA 1VA5A 2PKRA 3VR3D 4X7RA 1O6BA 3WLMA 4NXMB 3W5VA 4PDXA 5LSCA 6Q21A 5ANRB 4AJHA 1YASA 3IELA 5ALXA 1ZG3A 4HAOA 2YHIB 3TNDA 4UZSA 4AF8A 4IZ6A 4YJ3F 1ZICA 3S5UA 3T7IA 3W3AD 1AKYA 4CKWA 1VMAA 3OPXA 4A1OA 3H1FA 4WUTA 2G6BA 3VNVA 3G2HA 3RFTA 4B0PA 5H9VA 2JEOA 1H8EA 5IKXA 1XTOA 3V7WA 4LZJA 3PXXA 1FMFA 1XCGB 1N57A 3R8FA 2QN9A 1MOQA 1YUMA 4IJMA 1ADJA 3UMVA 3BJEA 2ZGVA 1HLFA 2W48A 4NWIA 4DA0A 2Q5LA 3OOJA 1T26A 4JVSB 4NARA 2NU8B 3I9FA 1XTKA 1EZ1A 1UWCA 4KQFA 1VIMA 4KWEA 1J90A 4REMA 3MELA 4G63A 4CL2A 1V48A 4BNIA 1BOFA 4C08A 1HDXA 1EG2A 2WE8A 3LY9A 5J9FA 3P2YA 2DLCX 1OA0A 3O8RA 3DZKA 3AFIA 5TLSA 1W5BA 2GLTA 2OXEA 3ADKA 5C8VA 5HCUA 1TM1E 4F6LA 1I7DA 3UYKA 2PXHA 3T7SA 1W44A 1ZNWA 4OLAA 2Q5OA 5F3DA 3CNQS 3HGQA 4OJYA 3UMSA 5F51A 1A1VA 3EBLA 1MU0A 5DTEA 4ESVA 5HBGA 1N5JA 4HO1X 1E4EB 4BJ6A 4PM4A 3E3MA 4ZT4A 3V42A 4C6HA 3CCBA 4JV5B 1CUCA 3DAHA 4RBNA 3IHTA 3FZGA 3TJZA 3CEAA 4AUKA 4EY2A 4G4IA 4IBOA 1G6OA 1HOTA 1H0SA 1KIFA 2CBXA 1G66A 3E8MA 3OC6A 1AH2A 3FDXA 1DQPA 1QR2A 3CLSD 3VTZA 4ZVVA 4BDTA 2XE6A 2V8OA 3I05A 3U37A 4B3MB 1ZI6A 1VL5A 4LJ7A 3A1TA 4MQMA 1P5RA 1GPJA 2VK4A 4UUQA 1QIFA 3KU1A 1BHO1 4BAUA 6CHYA 1QHIA 5I47A 4DLVA 1RADA 1YR8A 1DDIA 3A2NA 2XLCA 1HT2E 4L8FA 4KAAA 2HBYA 5FBRB 1E59A 4YR7A 3L93A 4E32A 4LPSA 3UG7A 4BKUA 3CPHA 1RHKA 3C6ZA 1RZVA 4OYHA 4U2BA 5B53A 4I6JA 2DC1A 3CISA 3IEXA 4RGQA 2X4DA 4ZV7A 2DJ5A 3TLBA 3V46A 2VHYA 2Y68A 2I34A 4S2EA 3UJDA 4L6IA 4RV5A 4PG5A 1PQWA 3LY7A 4PCVA 3FCXA 1T5SA 2V74B 5AI8A 4C2BA 1E5XA 2ZJ2A 2QAGA 5D7NA 3P9YA 2O8CA 2X86A 4A6PA 1DKOA 1I7QB 3GZNA 3WMWA 4CV3A 3G0GA 5ALVA 4C1DA 1LC3A 3HUFA 2DR3A 3V9PA 2ATIA 1IOVA 2ZRCA 1F0PA 1D2HA 3D64A 4RF4A 4RPIA 2OORC 1TVCA 2VP5A 1FDWA 4YRNA 3RRMA 5DCUA 2B35A 3UTCA 3FSEA 2AFIA 1Z26A 1V3TA 2BI7A 3E5NA 3PLNA 4N6OA 5T3YA 1J99A 1U8ZA 1G2PA 4CM9A 4B6SA 5EZYA 1BYIA 5J23A 4F71A 4XH9B 2WVJA 4QZVA 3U6KA 2BFOA 1N3BA 2FEMA 5BSFA 3BQ9A 4EB8A 2DP4E 2E85A 1N2GA 3VTKA 4A6EA 1O4VA 3CURA 1TM3E 3MCWA 1FFBA 1SELA 5A62A 3MGCA 3NHAA 3GEBA 3JXEA 3V6MA 2BHTA 3W4JA 1O3YA 3H11A 1OLUB 4NEHB 5BR7A 5BSWA 2JLZA 2FJ0A 3HXPA 1KMIY 1P6XA 4RVGA 3SZRA 1J0BA 4M7PA 4DCSA 2PLNA 4MWCA 4IDQA 3X43A 1P5HA 3PEEA 3AVOA 4FQ8A 2BF7A 4CNQA 2GAJA 3PC7A 2Q21A 1WMDA 3UK6A 5CA1B 4E51A 1VL8A 3S2SA 5JJBA 1WB9A 1PR9A 3KR9A 3PU6A 2MYNA 5DBFA 3WNZA 4RDXA 5A9SB 3L07A 1I6KA 3IR7A 3F8SA 3P0JA 2LCIA 4HL1A 1CNFA 4ALIA 1A7UA 4PNEA 5KVAA 1FBNA 2R2DA 4LV5B 3AERA 2P27A 1N3LA 3EGDB 4PFSA 5DLQC 4WPGA 1L0BA 3BZBA 3GFVA 1SUBA 2IW3A 1V11A 3FHLA 4G26A 4TKUB 2ZETA 4WGFA 2F1RA 4CF3A 3MD7A 1F2UA 3GDFA 5JXHA 3WK8A 4IFBA 1TK2A 3B1ZA 3N6RA 1X42A 2C54A 4E5KA 2PSFA 2G8LA 1X7WA 2A5YB 3NHMA 2NN3C 1IH8A 4BGUA 3A6FA 3HJRA 4K28A 5DNUA 3B6MA 4HEQA 1MJGA 3AILA 1I5EA 3L6UA 5IFKA 3HPRA 1GKIA 5AD1A 2NZ2A 3F67A 3G17A 1UCFA 4M9SA 4UDXX 1OLXB 5FL3A 1TJ5A 4AP5A 1SOVA 5LP1A 4MS3B 2BFCB 4HS4A 4C1CA 2YJ4A 1BD4A 1QHHA 1P31A 3PT5A 3O9ZA 1DJMA 3IBFA 3KUCA 4ND3A 4DLKA 1G8JA 1TCUA 4QM7A 4GKAA 3UY4A 5IBPA 4DUYB 2C61A 4N1AA 5FLEX 3U1TA 2DQSA 4DTIA 1XL1A 2D5CA 3JSXA 4D3DA 1W8DA 3AYZB 3DT6A 1LZLA 3IUNA 4H08A 5HRAA 2JHCA 3RABA 5KTYA 1BZYA 4Q3CA 3NUQA 4D81A 5C51B 2P1ZA 5LYJA 4J9UE 3VU9B 4BWGA 3JTEA 3U81A 3UK0A 3LHIA 1DFHA 1KH2A 3IIJA 4GOND 1HDGO 4ZAFA 2Q5EA 4UULA 1VOTA 4WQMA 3ZVNA 1KEUA 4RYLA 4RVSA 3QUTA 2ZZIA 3OEHD 1LKZA 3I8SA 4PPGA 1J7KA 4O1HA 1INLA 2JGDA 2AMJA 2LW7A 2EW8A 2HMYB 2JBAA 1JDZA 2C3YA 2Y66A 2JI4A 3DFKA 3H75A 4GEGA 5TS3A 3RIYA 4P31A 1RM4A 2HB6A 2QYTA 3KVVA 3G82C 1IY9A 1C4OA 1EBFA 3LKZA 4JP2A 2HV8A 1FRNA 1S4MA 5KPJA 1K8YB 1O57A 1XVUA 5K0LA 1I0LA 5AVJA 2FG6C 3N0VA 1KAEA 2FX3A 4Q12A 1PW7A 4NAUA 4RW0A 1Z62A 2ACEA 9LDBA 2V1UA 2RHOA 3DCYA 2JZCA 2W00A 4RGVA 4DNPA 1ZZEA 2YBDA 3LZCA 4Q1EA 4QFDA 3CZ5A 3V9AA 3KZXA 3WLIA 1CQPA 3T35A 1EHCA 1UR5A 4HLDA 4AJIA 2BISA 4CEIB 1T1EA 1JNXX 2EQBA 2RCYA 2WWFA 4PQGA 1QM5A 4GPD1 5AM4A 2FPPA 1KEEB 1C0IA 1NSFA 3ZHXA 4L6CA 5CLGA 5JTUA 1LVGA 1B8VA 4J75A 2A9KA 2FSSA 2I4NA 4XXHA 4LFCB 4D6YA 4KSYA 5EWLA 4YCDA 3RS4A 2EG9A 3DBHA 1G16A 4WV3A 5CG2A 4Q9HA 5IC6A 3HKDB 4OHKA 4C4TA 1L5QA 5KMGB 3K1TA 2FWJA 1DIRA 1WB5A 3WLLA 3ZDQA 1H4VB 5B5SA 2J9FB 4CF4A 3I8XA 4HH1A 5JVDF 1TZBA 3KR0A 5K0BA 5I9BA 1TMOA 2FQQA 3JS5A 4EY6A 1BJKA 1M8FA 1LW6E 2F8MA 1G2IA 3GC6A 3JD4A 3FTEA 4M38A 2V3VA 2FAXA 1T9HA 3UTDA 1T6XA 5ESWA 1XTIA 3C3JA 1Z8FA 2XB8A 3HN7A 3AM1A 5EIWA 5FJJA 3AJDA 2CC2A 3RM3A 2XT0A 1NYLA 3QUBA 3UNXA 1DBWA 5NULA 1PGPA 4NZPA 1J5EB 2UXCB 4L16A 2MR5A 3LIIA 4MIEA 3UFXB 2G5PA 2R4QA 5GTDA 4LJ8A 1GGMA 4URZR 3SEZA 3Q7QA 3ZIAD 3TEMA 3GUVA 1TAUA 1GPH1 4Y2SA 2NZVG 2Q5HA 1RM3A 2HMVA 3EW9A 2ODWA 4U7PB 1YJ8A 5TVKA 4ZCSA 1JLMA 2XNDA 3G9TA 3WIOA 1ZW1A 3WMXA 1L1FA 3MUEA 3X1XA 3HBFA 4KAJA 2ECQA 2DCUA 1G42A 2GBIA 2GZSA 3ZW7A 4G0NA 4KW7A 5T67A 5BOSB 1IRXA 5JR3A 1QFMA 1XWIA 4MKHA 4S1VA 1GRCA 1JSRA 2FB9A 4ME6A 1DCTA 2DQYA 2GCIA 1FF9A 3PJDA 4FN4A 4V3BA 2QTLA 4B83A 2EBUA 1OIXA 3B3JA 4L08A 1O94D 2QY9A 4OKIA 1GXSB 4RIEA 3AIMA 2I87A 3HCRA 4N9WA 4BO0A 1IL0A 2POQX 1NDQA 1H2FA 3OMWA 4YXFA 1BXKA 2J4CA 3FYHA 4K9SA 3PQ2A 3I1JA 4FC6A 4M0KA 3X1YA 1U4OA 1Q77A 3QOWA 4JX8A 1CJMA 4JXJA 1AA9A 1PV4A 4QBGB 2I3DA 2MSWA 2QPLA 2VLBA 1PD1A 3PRYA 1NI5A 3DMYA 1V1RA 4KC0A 2P69A 4LW8A 4QOGA 3MTEA 5CFZA 2VTVA 2YJ3A 3GP5A 4JODA 2FETA 4JVNA 4G8BA 3I2JA 4O4HA 5CB4A 2RGEA 3M4YA 4PICA 4H9GA 4DSAA 2DHQA 3D1LA 1MW9X 4N3BA 4EGJA 2CXPA 2H9IA 4V3CA 4KR0A 3WIUA 5MHTA 1CF2O 4CLRA 1N5KA 1MQ9A 2I4IA 2XECA 3BZUA 4J0QA 4NBTA 3AJRA 3STHA 4O8ZA 4BO1A 4GOOD 5BPFA 4Q7EA 2Z1DA 3F9IA 3D3JA 2WHPB 3UCFA 3MW8A 1R0KA 4OQPA 3RS7A 2IYFA 4G41A 4BO4A 3RANA 1CFZA 3ADOA 4HQLA 1IY1A 4M88A 3WZMA 2ZVQX 5DXJA 4GKBA 2GEDA 4J1TA 4JN6B 3JASB 4LWQA 1GPNA 4DZTA 2C2BA 4G5QA 2OZEA 1G21A 3AG6A 4RIFA 4ZJYA 5BP7A 1KZYC 2QBYB 3EMVA 3TTUA 2A67A 4U6QA 4ACBA 1XFAA 3KL7A 1C50A 1VJRA 4OHYA 1BGVA 3AETB 2Q99A 3DLPX 4UWRB 1ZH0A 4MH0R 5CX4A 5HWSA 1WS6A 1GU7A 3DDCA 1I8TA 4X63A 1THGA 1XEWY 1KXZA 3M9WA 3OVMA 1X1DA 3BSYA 4TZ0A 2G67A 2G25A 2HDWA 3G2LA 1RD4A 3PC2A 4HFMA 1JG1A 4MWBA 4OUDA 4E1VA 5IJWA 5FCDA 1TEXA 2RK4A 2GTHA 2XITA 3QVGA 1NE7A 1S8OA 4BC1A 3INNA 4O25A 4IVPA 2BG2A 3E3AA 4YRGA 2NO0A 4EJ6A 3H1AA 4TXHA 3KZ1E 1QIEA 5JDCC 1CERA 1UWVA 1QVZA 3Q9LA 1LK7A 4I3FA 4N39A 3TW8A 3LFTA 4KPEC 1KKMA 3NAQA 3AIKA 3FTCA 4TT8A 3HK2A 4HKYA 1B76A 4UVEA 4NV3A 2LXNA 3ECCA 1GOTA 5ISMA 1B93A 2C0CA 4ZMSA 3SHOA 2IBMA 2O50A 4JKIA 3SX4A 5E9WA 1JDBB 1HYQA 1EUZA 1GYPA 3KBBA 5H59A 2GN6A 2VNKA 3FBGA 3I0ZA 5K3FB 3OPYI 2M5DA 2AEEA 3BE8A 4I55F 2A84A 4XVUA 1WUYA 2EF0A 1F7VA 2PXAA 2JK0A 4IIHA 4TV8B 7REQB 2CKMA 1X9HA 1DDGA 2QIPA 2Q3HA 2YFHA 3H8VA 4KH1A 4DWVA 3CRQA 4G9BA 3WKEA 1PEAA 2CDAA 1QGZA 5I6DA 5LSAA 1QRTA 4AYXA 4HFJA 4L0DA 3GAMA 4WKPA 5TJ9A 4DLYA 4XWWA 4JBNA 2BTNA 4EPTA 1UDCA 5CXXA 1OIVA 2RDMA 4HLUA 4IF6A 1W0KD 1J1UA 3PE4A 2QX6A 4LRXA 3R41A 1PR5A 2OP0A 3ABZA 4GWLA 2LE0A 1H9AA 1GZSA 5AXAA 4L73A 3U2QA 2HU8A 2I62A 2Z57A 2HIAA 4CIDA 2M2IA 2QDKA 3I4FA 3KOMA 4HTFA 1DXYA 1X0XA 4AIIA 3RPEA 4I66A 1EGVB 1KO1A 2OFFA 2PS0A 1R4ZA 1E0JA 1MVOA 5JS7A 5LNK6 1FDOA 4I1OA 3WE7A 4BVJA 4V03A 2GEFA 4L8GA 4QT0A 4RK6A 2B5OA 4YO8A 3NIDB 4XWAA 3VC7A 2DUNA 2V96A 1CQJB 1FP6A 1UJ5A 2O0HA 4B4DA 3KJZA 1JVBA 4JJIA 4RM3A 2P9GA 4CIYA 2WM9B 1V5IA 1E2DA 2DLDA 1O87A 3UV7A 1GG2A 3N8IA 4W5RA 3EXHC 3RC2A 3KLOA 3RJ5A 5I51A 4BJ3A 1YWGO 3H2BA 4PG8A 1KI7A 1CIJA 3MT8A 2WDZA 4R84A 1U2ZA 5LU9A 2BUBA 3JWGA 3WB9A 3MGAA 1ATIA 5HF6A 2ZANA 3I45A 2J8ZA 5CIQA 2XUJA 2XWJI 4FPXA 3E22B 4WCVA 3TR5A 2ONJA 1DRJA 1SIWA 1MB9A 2I99A 4CZ2A 4D0SA 3V1YA 3K7EA 1K8QA 1Z4QA 4Y67A 2ZB3A 3L7KA 2H2HA 4QREA 3TSZA 2CUKA 3DOOA 3NC1C 4KPGA 2PX2A 4XWOA 2H1WA 3OZTA 4LC0A 4BV3A 1K6IA 1KK1A 2ZAGA 4GLBA 4H7HA 3K6KA 3EB9A 5CPBA 3Q8MA 1DTWB 3QFFA 4KVFA 2FQYA 5KKCA 3M1YA 4XB1A 2EJWA 3HADA 5K20A 2QE7D 4HG2A 3EBOA 4AP9A 3OWXA 1FSGA 4R68A 4MQ5A 3SLKA 4B73A 1B1AA 4OK3A 1XKTA 2MCFA 1I1NA 3OJXA 4EVRA 4FWIB 4KFCA 1S2DA 1MDFA 3NPMA 2IITA 4HH3C 1QFXA 2N3ZA 1XLWA 4CM7A 3QBTA 5FR1A 3QG1A 2NADA 2RI0A 1AVTA 3EXFB 4WLNA 4LC1A 5JZBA 2QI9C 2GPJA 4HDNA 4PO1A 4ZV4A 2PUTA 5K01A 1UBEA 3QY9A 1EWTA 1QORA 5J2UB 1X7DA 2WSSA 5A9RA 1CJSA 5DMXA 5LDDC 1KTVA 3RARA 3PR2B 4JGIA 1MC8A 2G09A 3TI9A 4N41A 4YECA 1SIBE 3SGLA 3U26A 5DWQA 3VSBA 1KSHA 3FNIA 3KNRA 1FMCA 1M33A 2WJ3A 3NIFB 1U31A 1FFDA 1QP4A 1AHHA 4DA7A 4NK4A 3F2VA 3KHKA 4MCHA 3RTGA 3TZEA 1U8UA 2VJYA 2W2LA 3J81k 4FZJA 4BQEA 4M36A 1A9YA 3QZUA 1W1WA 3ZNPA 2PGJA 2JLAA 5GM2A 2Z9BA 3OOWA 4HDMA 1LUAA 1OQAA 3C8DA 5GM1A 1AN9A 3OT5A 2P2GA 5IWAB 2J0EA 1JQDA 2VSXA 1UODA 2TMDA 3CE9A 3FWKA 4FT2A 3IE0A 3NKLA 3G1PA 4OGKA 4QTXA 1CJUC 1XNQB 4YQFA 2GWHA 1BHSA 3DWEX 3H3EA 2ZI6A 2ZM6B 5J2TB 3PNQA 4UQOA 3CG4A 4HB2A 3NV9A 5CW1A 2AG5A 2FSFA 4HGOA 4EY5A 3E1KA 2A59A 3C14C 3SHVA 4PCLA 1W7AA 4UM7A 2XRMA 1O97D 2QXYA 3BG5A 4JLDA 5DXFA 4R8SA 1J9EA 2VZEA 2ZI5A 3BMQA 3PGLA 4RY2A 4EYGA 4MLCA 3QOXA 4IWYA 3BHIA 4BASA 1IN1A 4W5TA 5A87A 2QTBA 1YFZA 4DDTA 2CJWA 3PNKA 4CM6A 4KQCA 2JI9A 3ABSB 2WU4A 3DVQX 1C8VB 2EKPA 2ENUA 3X1MA 3ADBA 3W04A 4R2MA 4UXJA 4EJ0A 1CIPA 3PTLA 2BONA 3GA5A 3BXPA 4I4TF 1H2YA 2F6RA 1JDUA 1VJTA 4ZQGA 1M2NA 2FPGB 3ZV5A 2O1SA 3MQ2A 1QYRA 2ZSAA 4OO3A 4UBOA 1A98A 1GFWA 2H7XA 2NU6B 3D9QX 1MVNA 3HV0A 2IELA 4RY0A 2PYIA 3UAOA 2CL5A 5HH6A 4FBGA 1B1CA 5CT9A 2RMKA 3MRSA 3UWOA 5HXAA 3GDWA 4ZREA 1YKSA 5FXMA 2VRCA 2XOEA 2NVUB 3GLRA 1QLJA 1X1AA 3DBRA 1PK8A 4XWGA 2ZPUA 1X9GA 4D57A 4CLEA 4C3ZA 4CV1A 1JH8A 3IPLA 1Q1BA 4TPKA 4NZZA 1SU6A 3LTEA 3ML1A 1OFUX 1DFGA 3ELBA 5DPXA 2JDID 2Q4TA 2Z9DA 3QXHA 2AB0A 1WCWA 2OLEA 4NONA 2WSIA 3QVXA 2GEBA 3L06A 4RO0A 4CM4B 3PFHA 5TV2A 2PKCA 4H3KB 3N2EA 4PY2A 4YJ3A 3CO5A 1WOMA 1Y9ZA 3NGXA 2YXBA 4L8LA 4H3HB 4L4XA 3GAAA 5JCXA 1N6IA 2DUWA 2FW9A 2IBSA 3GEMA 2WTMA 2F17A 1QK5A 2NZWA 2PFSA 4IMPA 2XUFA 2VK1A 2GEKA 2V1XA 1ZL0A 4RL0A 4EF5A 1FW6A 4S1TA 3SOPA 2Y1GA 1TQDA 3QH4A 2WM8A 3FTDA 5EJEA 1TYEB 4Q3BA 3RU2A 2J3LA 4URWR 2J7PD 1Y37A 3AB8A 4JJFA 1VHTA 2UZAA 2YN2A 1QO9A 1Q2UA 1X7ZB 3EEQA 3R3ZA 3T12A 2QN2A 3OA2A 3CGWA 3H9JA 3I3SR 1P7VA 5EWJB 4BJ5A 3JAMA 5ECDA 1QCDA 4CODB 1T5HX 4ZPXA 1B16A 1T9BA 2Z8YA 6ABPA 2HJGA 1IHXA 2YKGA 1EUCB 3UV6A 4KQXA 4EUSA 2R8ZA 2ORVA 2QSZA 4RC9A 3TQOA 5ICMA 4FOOA 4K6HA 1UJBA 5JS6A 3NANA 1ZITA 2ARKA 1FP1D 3HBLA 1OHHD 5HIQA 1P33A 1SVIA 3LY8A 4BE4A 1NRIA 3TF5A 2GVDC 3FNHA 3WLNA 1PJTA 3KNZA 2I9KA 1EFLA 3GUCA 2R7NA 1TLLA 4DC9A 3K0SA 4TZ9A 1L7XA 1X80A 4BO5A 1WX1A 3EZ7A 2CK3D 2AZDA 3LL4A 4ZALA 4EKIA 4C2UA 3JQGB 1RTTA 3P1JA 2HA4A 3SLGA 1O5IA 1EQ2A 2Q6VA 5ALPA 4ZDWA 2R1TB 1ACMA 2W6QA 3RKUA 1NQTA 4BO2A 4F3YA 3LWDA 3G6WA 3W06A 5DCWA 2JAPA 1ZA1A 5SICE 2WSYB 2FU7A 4UTZA 1ST2A 2HRRA 1Z37A 2PMWB 2QD4A 3LWNA 3WHPA 5LZ2A 3OTOB 4I99A 5EGNA 1QCCA 4XLLA 4YJFB 2BCJQ 4YALA 3U19A 3F8WA 3JVIA 3OSUA 3KQWA 4UWOB 4BYGA 1X70A 2Q5IA 3U4DA 1UMBB 4DUZB 2VJMA 1JJBA 3SEAA 5G1PA 3H2GA 2JL1A 1W36C 4DCVA 5T4HA 5KYUA 1M9NA 3FAZA 4PNZA 3G0HA 1UZAA 2ODTX 6NULA 3R5SA 1IN5A 4FFMA 1XMSA 4MUIA 5DHRA 5JZVA 3GIWA 4MTLA 1SG0A 4YQYA 1WZUA 1A5AB 5G41A 4DBLE 3ZLJA 2PPVA 5CVDA 1I2CA 1RYZA 2AEMA 3F0TA 3VDXA 3NYWA 2OFOA 1L5YA 2E0IA 3LZ6A 1SURA 3PIRA 4QHSA 3ZE7A 1ML3A 1L5VA 1BA3A 1H8HD 1W0JA 3NTLA 5BMVA 5K3BA 5E38A 1ULUA 4PQFA 1QGOA 4NBLA 1O95A 4CQLB 1PJBA 3H9CA 1OV4A 1G8HA 4I81A 1DKNA 2YFYA 4BNJA 4FQ5A 3EZ9A 2XDYA 5EEGA 1WCV1 4C7XA 4BNZA 1OU4A 2R4UA 3OQIB 2NAFA 3EC2A 2XKBA 2YY6A 3EUFA 5JO9A 3O4FA 4XIYA 3Q8LA 5EUMA 3NC0C 3ZBPA 5JSFA 4E94A 1HRKA 4K6KA 3WRYA 1ZM3A 1HE2A 1M7HA 3EVFA 4YJ2B 4I0WB 4XLZA 3QXGA 4G6ZA 5CH3A 4NCIA 1Z7BA 2JGFA 2OZVA 1JJEA 4MUEA 2VXCA 3IMKA 5G2OA 4CDNA 1VHJA 1QWOA 3CE6A 4S2UA 1E4OA 5AR1A 1DKUA 3FFWA 1IY8A 5DNCA 1DEOA 4PXYA 3GT3A 3IT2A 1FX0A 2ZIAA 3N76A 4ZYZA 4MRNA 3HNPA 3L6CA 1EBBA 3TG2A 2IIVA 3RIEA 2K7FA 1T9AA 1JXOA 2HIGA 5B3AA 3TSWA 5EKDA 1TF5A 4LRQA 5LWHA 3EK2A 3DMNA 4MWEA 4ZZ3A 1ZJ4A 4I4LA 2V5AA 4C0WA 3GEEA 1JA9A 1M0TA 1O5TA 1TUBB 4UCQA 3ABRB 1LJLA 3WWZA 5B6IA 2J5QA 2IH2A 3MMXA 5AP9A 3OMXA 2GDZA 5EIAA 4D46A 2CLKB 4EF6A 2OCDA 4EKYA 2FZGA 2EQAA 3SQLA 2CUZA 4H7IA 3ZS8A 1SBIA 3FOWA 2O0KA 4BVEA 1P74A 3R0IA 1IYZA 3JQ8B 4QRIA 5EN4A 3RC8A 1D0SA 1EZZA 1WW2A 2QG4A 2ZYWX 1V41E 4XZ3A 1NJ1A 3GMSA 1U7ZA 3WYFA 3RIMA 3ZUPA 2G72A 1RPJA 3OT1B 4U1RA 3AW9A 1ORRA 4TROA 3NM5A 1TMGE 2DT5A 5GJCA 3EFOA 3VUEA 1CHNA 1WUPA 1EMDA 3ROFA 4QJIA 3RWMB 4MSUA 2O0LA 3JZIA 2QX7A 4ARCA 3TTVA 1C14A 3NAGA 5AK0A 3KETA 5A2QA 2EFCB 4IZHA 4B6EA 4BEJA 3NOVA 1OXTA 1LD3A 5ILOA 2REOA 5BR4A 1ZXLA 3H65A 1YA6A 1SHUX 5F4ZA 1JWAB 1V71A 1XPUA 4LOLA 5K5EA 1Q6ZA 4Y2GA 4ANFA 4Q18A 4M46A 1DIGA 3JX9A 3NOQA 4LZOA 3EQ9A 4ARZB 5CX1A 3PSAA 2I8LA 2R7LA 1C30A 1I4WA 2G5CA 1VMDA 2A4KA 1PI3A 5KKAA 3T4UA 3UAWA 3PL5A 3ZBQA 4BVAA 4WBNB 1V5WA 2GKSA 2YTZA 2CMDA 4NMHA 2FV8A 2X6RA 2Y1WA 5KVQA 4CR7A 2PIAA 3BTVA 3BRWA 5B4UA 3K0CC 3C85A 1C7ZA 1H9BA 5FH9A 5TC4A 1P2UA 4JI2B 2W6PA 5G4LA 1RWPA 3PGXA 4P2BA 3VYRB 2Y1EA 4TS3A 4ZK6A 2ZUVA 3D2LA 4QHTA 1PTJC 1FE8A 4KN5A 4WLVA 1VBKA 3RHSA 1E94E 2CVFA 4MW0A 2WWGA 3FI0A 4II3A 4A5OA 3O8QA 4LJRA 1LPAB 3BFPA 3HDTA 3KQSA 2QUIA 4IRMA 5F2KA 4DDKA 5F2NA 2O2DA 4X1YA 2QPAA 3DPIA 3ZC3A 5AHRA 5A0FA 5FPHA 4EYBA 1ECLA 3SZMA 3PWSA 4O63O 3BH7A 5CDGA 3EASA 2ORYA 1RVDA 2CLIB 3INGA 3OEWA 5DBIA 1NR1A 1SIOA 3L0BA 4IF4A 4G1VA 1YMVA 3KPUA 5AW0A 5KSYA 1R0XA 1HM5A 3HKBB 4K9RA 1YULA 4D3FA 1GZ4A 3RTBA 1CT9A 2P2LA 3C3YA 3NEAA 1U2GC 3OX1A 4KX3A 4KFSA 1Q11A 3AP1A 1I13A 2ZYSA 5IKMA 2ZR9A 4EUNA 4ZYYA 2GFHA 2IU0A 4L4YA 4DJEC 1CS0B 2G40A 3E3LA 2F3RA 2PWAA 3U7QB 3COWA 3ZK9A 2UYCA 4BNWA 1DIHA 1GP2A 1IXRC 4HKTA 5KTMA 4Z5ZA 3EAGA 3HYNA 1NXSA 1S2NA 1MGPA 4TT3A 1XA4A 1NJ5A 3Q9NA 3HM9A 2J3MA 3R3WA 5AI4A 2FCRA 3D4PA 2NPIA 2P7HA 4O2BA 1MT3A 5AXBA 3WJ2A 2J6CA 3JR7A 3EMDA 4QVKA 1W85B 4EY8A 3O6VA 1TLTA 1U81A 3K0HA 4JB3A 4V1CB 4YPFA 2I33A 3FKSA 2WJAA 2EFEB 4WZAE 3RBAA 4QOHA 4J3FA 2ZUCA 1UZUA 2BEUA 2HPZA 4TRNA 5ALLA 1M0EA 1Y5LA 4BP9A 1EWQA 2W6IA 3II6X 2P2CA 3FPBA 4GPIB 5U1PA 4Q0MA 5JVDA 3GJTA 2Z83A 5L8VA 4R0VA 3RSCA 1YZTA 1WQ1R 3V7FA 1C9KA 4FFSA 3KJXA 3QPCA 2ZAMA 4MAAA 1F8YA 5D85A 5LNK1 1D2MA 4KKXB 1B6TA 1X7XB 4U0JA 1XALA 2VZLA 4II7A 1UXHA 2DTEA 2W6JD 3IPAA 5CA1F 3RK0A 1VCOA 4C20A 3W6PA 2IA5A 1J0DA 2IVFA 3MLBA 4AC9A 3WLFA 4TOIA 4EO4A 1L7NA 1FFEA 2UYOA 3AINA 2HHCA 4LDQA 4YCSA 4HUTA 4IUBS 3I3OA 4YV1A 3C3AA