1E5DA

Rubredoxin oxygen:oxidoreductase (roo) from anaerobe desulfovibrio gigas
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
401
structure length
401
Chain Sequence
b'QATKIIDGFHLVGAIDWNSRDFHGYTLSPMGTTYNAYLVEDEKTTLFDTVKAEYKGELLCGIASVIDPKKIDYLVIQHLELDHAGALPALIEACQPEKIFTSSLGQKAMESHFHYKDWPVQVVKHGETLSLGKRTVTFYETRMLHWPDSMVSWFADEKVLISNDIFGQNIAASERFSDQIPVHTLERAMREYYANIVNPYAPQTLKAIETLVGAGVAPEFICPDHGVIFRGADQCTFAVQKYVEYAEQKPTNKVVIFYDSMWHSTEKMARVLAESFRDEGCTVKLMWCKACHHSQIMSEISDAGAVIVGSPTHNNGILPYVAGTLQYIKGLRPQNKIGGAFGSFGWSGESTKVLAEWLTGMGFDMPATPVKVKNVPTHADYEQLKTMAQTIARALKAKLAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUBREDOXIN\:OXYGEN OXIDOREDUCTASE
publication title Structure of a Dioxygen Reduction Enzyme from Desulfovibrio Gigas
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 145
structure length 401
sequence length 401
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1e5dA01
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1e5dA02
4YAOA 3K1YA 3ZQ4A 1ZWKA 2ARKA 4PTYA 3NLLA 2BG8B 3OWXA 1XI2A 3IOGA 4HL2A 5K0WA 5EV8A 2BFZB 4U4LA 2FM6A 5LE1A 2Y8AA 2BN4A 2M6SA 4N82A 1JJEA 4XUKA 2FCRA 2FVXA 1OBVA 3ESXA 3A4YA 1CZLA 2BG2A 4JO0A 1FUEA 3KLBA 4FGKA 3K20A 3IE0A 2BG7A 5AYAA 3EDOA 2BFKA 4J5FA 4DIKA 2FZ5A 3O2NA 2WYMA 1AKVA 2YNTB 4F6ZA 3S2YA 1CZHA 1KR3A 4D1TA 1H69A 3F9OA 5LS3A 3BC2A 1AG9A 2DOOA 3IE2A 2P1EA 3PY6A 4J8PA 4ZVNA 2NYPA 5ACSA 4C14A 2QX4A 3HR4A 4EXSA 4ZEJA 3O73A 2F1OA 5EVBA 2OHIA 3F90A 1ZNBA 3R2UA 4XWTA 1JJTA 1C7FA 3F6RA 1FLAA 3DHBA 4KEPA 5HH4A 2WHGA 2QMYA 4D1VA 3I0VA 3JXPA 5JROA 1WUOA 5NULA 1VGNA 5LBUA 2Q0IA 4RL0A 4H6PA 3AF5A 4S24A 4U7FA 2OYSA 3ES9A 5B3RA 4Z5ZA 1DDKA 3LVZA 3U7IA 1NNI1 2BR6A 3WXCA 3T9MA 4FGLA 4NQ5A 5EV6A 2FHXB 5KIKA 2QX6A 3H3EA 5FX2A 1DXKA 2GKLA 4TYTA 1YKGA 2NZEA 2R97A 3KAQA 2HPVA 5B15A 2Q62A 5EAIA 1DXOA 4FX2A 2YNUA 5ACPA 2HNAA 2HB9A 5LJLA 4U7HA 3AF6A 4FGJA 1OFVA 1TLLA 3B6IA 2MT9A 2BPOA 4C0WA 1CZKA 4P62A 3GFRA 4Z6XA 4NLLA 2N1MA 3N3AC 1A7TA 1BMCA 1XT6A 3OJWA 2M6RA 4XWWA 3IOFA 2FK6A 3N39C 4ESEA 5B3LA 2M5DA 4C1DA 2QJSA 2H6AA 1F4PA 3OX3A 3TZBA 2Z9BA 3PY5A 3SD9A 5EWAA 1V4BA 1ZX1A 3QFRA 1KO2A 2Q42A 4UWPB 3QFCA 2WYLA 2KLBA 3TEMA 5A0VA 1J9GA 4QOIA 4XDGA 4FSBA 2XODA 3D7NA 2P4ZA 1FVXA 2BIBA 2V5VA 2V5UA 5ULLA 1MQOA 5LCFA 4HEQA 5B3KA 5A5ZA 1QH5A 1JA1A 1J9EA 3ZR9A 5HIQA 3NHLA 4YAFA 1TIKA 4V0HA 4LA4A 5LJIA 3ESYA 5K4KA 3GAMA 4QOHA 2OHJA 5B1UA 4HL1A 3W7AA 2HNBA 1ZWLA 4LTMA 3KNRA 1BVYF 2ZWRA 3NHYA 5LVAA 3KNSA 3DHCA 2FU7A 5HH5A 1CZUA 3BK1A 2GSWA 3ESHA 4RAWA 1L9YA 1H66A 2AZ4A 3B6JA 4AWZA 4LTNA 5LMCA 2A7MA 5EW0A 4ZNBA 3T3OA 2QX9A 4EFZA 3NHUA 3DHAA 3UXHA 5A87A 2Y87A 3DH8A 4M0CA 5DPXA 3SBLA 4GYQA 2XOEA 4FR7A 5F4BA 1SMLA 4RAMA 5AEBA 4PU0A 4YSKA 5ACTA 1X77A 4HS4A 4YALA 3X30A 5FA6A 4ZVLA 1I1OA 4ICIA 2BG6A 2BG8A 3G1PA 2QR2A 2BFZA 4QOJA 5A4KA 2FU9A 3OWHA 4F6HA 4U7GA 1DXQA 4QOGA 2YNVB 5FQCA 2YCBA 2Q9UA 2GFKA 2ZZIA 3ADRA 3OX2A 4O98A 2DKFA 3VQZA 2UYXA 1SQSA 1KBOA 4GQIA 1QHEA 3IEMA 2BMVA 2FAXA 2YNTA 4PVOA 5AHOA 4FEKA 1D03A 2BGAA 3BV6A 3P0RA 1B1CA 1AKRA 2WC1A 3SW3A 3ZWFA 1QRDA 1AZLA 5EVDA 3FJOA 3T3NA 4TZ9A 1FLDA 1VJNA 4ZVKA 5LCAA 4HKYA 1M2XA 4TYFA 1XYYA 3RPCA 1WUPA 3UXEA 4YQEA 4UBQA 4CETA 5TGZA 1WSWA 1GG5A 1P9EA 1XYVA 1X8GA 1D04A 4EYFA 5EHTA 4LTDA 3L9WA 3LCMA 4BZ3A 1YCGA 2QWXA 3F2VA 4GR9A 2V9CA 1X8HA 5IQKA 4C1EA 1YOBA 4EY2A 3NFRA 5FQBA 5FQAA 4H2DA 1OBOA 2X2PA 3W79A 4YAUA 1DD6A 5LBTA 4RM5A 3X2ZA 2ZO4A 5A0TA 3AJ3A 1FLVA 2E7YA 2FHXA 4OXXA 5F12A 1K07A 4EYBA 2ZKIA 4C76A 4RL2A 5LCHA 2FU8A 5BUCA 3NHWA 1QH3A 4C1HA 2M5CA 3R6WA 2I7VA 2MOKA 2QEDA 5K4NA 3W77A 4Z67A 1QR2A 3NHRA 1YCFA 4H0DA 3HA2A 2Z9DA 2BMIA 4ZO3A 4UAMA 3BK2A 5ACXA 4LAFA 4TZEA 4GI5A 2MWMA 2FU6A 2R96A 1CZNA 1BC2A 4NULA 3OJXA 1E5DA 4EXYA 2BZSA 1T5BA 4DY4A 2I7XA 3I11A 3L9XA 4UWRB 4F8YA 1YCHA 3FCZA 2Y8BA 3EYWA 3S0ZA 3IEKA 5EVKA 5AXOA 1AKWA 1FLNA 1WRAA 4PVTA 2QINA 4Y9RA 4AWYB 3FVWA 4NQ6A 4C1FA 5LM6A 4BMOB 3SVLA 2OHHA 2WYMC 4Z60A 1RTTA 4AX0B 3L6NA 1AHNA 1WSBA 4B87A 5ACVA 3GFSA 3U7RA 2GFJA 3OX1A 4NQ4A 4UWOB 2NZFA 1ZKPA 3OVMA 1JT1A 1FTGA 4LE6A 4YSBA 1RLJA 3NHFA 3NHSA 4D02A 3ESZA 2YNWA 3I13A 4BMPB 1WW1A 4ZO2A 1XTOA 4QOEA 3VPEA 2YZ3A 2W5UA 2I7TA 2XF4A 1KBQA 1RLIA 2A5LA 3FAIA 4YSLA 4Y9UA 3FNIA 1ZTCA 2RG1A 3ZNBA 2ZNBA 5ACWA 1J9ZA 4J5HA 5F51A 3QE2A 1BU5A 4Z5YA 5HISA 2BC2A 3HLYA 2BTNA 4R81A 4Z7RA 4QODA 5ACRA 5HIPA 2Z98A 3SRXA 3NHJA 2GCUA 3TP9A 4N9QA 1A8TA 3NHPA 2QDTA 4TZBA 2FDXA 2FZVA 4PTZA 5K4MA 3X2XA 2P18A 3B6KA 2P97A 4DILA 4C1GA 4C09A 3RKKA 3IDZA 3Q6VA 2YNVA 4C1CA 3P2UA 4C0XA 3G5MA 3JSXA 1XM8A 5HH6A 4AX1B 1YRHA 1HLKA 4GCWA 2QX8A 2KQUA 2WRSA 2B3DA 4CHLA 1CZRA 2Z9CA 3B6MA 2BFLA 3SPUA 2BF4A 2FX2A 2GMNA 5HIOA 3IELA 1JA0A 2D5IA 3RKJA 4D1UA 2FOXA 2QMZA 1C7EA 4UWSB 1AKTA 1DX9A 2X2OA 1YDGA 2MTBA 5ACQA 1VMEA 5LSCA 3QH8A 5AHRA 5FUQA 1SG0A 2QDSA 3GFQA 2AIOA 5ACUA 1D4AA 5LLDA 1RCFA 3FW1A 4YAWA 3I14A 4GYUA 1KO3A 3ZHOA 1T0IA 3TE7A 4N65A 2AMJA 2FLVA 3FX2A 4Y7CA 5EA2A 2NXAA 1J8QA 4QOFA 1FX1A 5EH9A 3KL7A 3W78A 3MD7A 3PG4A 4EYLA 4XDHA 5NLLA 3X2YA 4WD6A 1AKUA 5AXRA 6NULA 2VW8A 4CF6A 4AD9A 3KAPA 1Y44A 1CZOA 3LT5A 3N3BC 4NQ2A 1X8IA 2R2DA 4ZVMA 4D1WA 4UA4A 4BP0A 4TZFA 2XR1A 3F6SA 4KEQA 3IE1A 1BVTA 5EMNA 1AKQA 1QBGA 2CBNA 3I15A 3RPEA 3SFPA 5KILA 3KEGA 4RBSA 1AMOA 3NHKA 2Q0JA
chains in the Genus database with same CATH superfamily
1SBCA 4U1RA 1QYXA 1K5DA 1I7QB 1JJVA 3KTAB 5K8LA 2JCXA 3ITNA 3MS2A 4I50F 4RTLA 2ST1A 2YHSA 2XD4A 1O4WA 3KM0A 4EH1A 4MR9B 3RJZA 1FSGA 2C5LA 1OX4A 2ORVA 4IVRA 3LO5A 1RYMA 1I6MA 2PG3A 3ODGA 1K7CA 3QHQA 4PBRA 2YW2A 3L84A 1J99A 1RAGA 3H5IA 5A4AA 4AY5A 2WJGA 2A78A 3GZTB 4FIZA 1SAYA 4TYPA 2IXFA 1FRNA 4B45A 1NW3A 3DE7X 4YRTA 2X58A 3HBFA 3WI7A 4BC1A 3D3WA 4L4YA 1QYWA 1E3MA 1OZFA 3QJYA 4B84A 5AVXA 1XALA 3FRHA 3HY3A 3CYFA 1JBEA 4DIKA 5BV8A 2WYMA 4M1EA 1Z08A 2VWGA 5IBQA 1L5GB 2DHRA 3ILHA 2VS1A 3L1HA 1ZK2A 5IN4A 3BIFA 1C7ZA 1RKVA 2PUDA 5IXYA 1L5YA 5K5EA 3K32A 3VFDA 1A9XB 2EFCB 1P4JA 1AUQA 1BC5A 2JJ1D 1MMFB 2O20A 3HNRA 2DSNA 4L28A 3DV0A 2DOKA 2NYUA 1I9GA 2AV6A 4PW0A 3KSBC 4U4LA 4FC6A 5E8RA 3I9V1 3F71A 3GG9A 3H1FA 4MKXA 2GPYA 4NS4A 3KQHA 4R05A 2GJ8A 3O8LA 3KJQA 3DDZX 2WP8J 1PP4A 2J6CA 4FFLA 1II0A 1L4MA 2XNDA 4NZPA 4OI4A 5IVIA 4AF8A 4AP6A 4C3VA 1T4BA 2CCGA 2CCKA 3PC2A 5TT0A 1ORRA 1PZHA 1RZUA 3QXSA 2ANBA 2IZOA 3RC8A 1Z3IX 2EERA 3C3BA 1G20A 3PFKA 4HDQB 3VDXA 5EYPA 4XJXA 4ZYXA 3ZIDA 3AUXA 2HMVA 3F6YA 4UAJA 5EVJA 1DKNA 2X7HA 2X9VA 3D02A 4RIIA 5JYBA 5LQDA 5HH4A 1JQJC 5JTUA 1QMPA 1GL3A 1ZD8A 2QMYA 2H63A 4JD5A 5DM2A 2I3DA 4YHBA 4M21A 1QF9A 2V7TA 2VEOA 3EXG1 3ABIA 4KWIA 3GAZA 4BO5A 3UTDA 2UYGA 1U2PA 4CLXA 4P7KA 2UYYA 4NHEA 2QUIA 3BRWA 1A1SA 2ZDHA 3ES9A 3EZ2A 3HCRA 3O3MB 4DXHA 3M6IA 4EQZA 1RBYA 2IKSA 4R9SA 3U6BA 1G9SA 7AT1A 1A76A 4FYIA 3TXXA 2ONCA 3JZDA 4JQYA 4XARA 4BZWA 2AEJA 1IUKA 2DHQA 2EBHX 2K4MA 1DP4A 2ORIA 4FEYA 3KZOA 4QNMA 2CUTA 1G3QA 3D5QA 1KEEA 5K0LA 5FQNA 2XCSB 2H1WA 3HU2A 1P9RA 3LLCA 3PIIA 5A9SB 2I54A 1FZQA 4KO1S 4ZAGA 3P2JA 5ITZA 2Q99A 4NE9A 1W49A 4Q9HA 4EW1A 2ZYHA 2F8LA 1E9FA 3BMCA 4YT2A 5ACPA 2K5UA 5HZMA 2IELA 4UOZA 1C0KA 4X93A 4DMUB 3KV1A 3SS7X 2O0JA 1PDOA 4ND1A 2QL9A 4UBLA 4URFA 4Y1RB 3TI7A 4NVRA 3ZI4A 4BNIA 5HSGA 3L4JA 1QNLA 4QO8A 3DF7A 2ZVPX 3IR6A 3NX4A 1E6CA 4ZDWA 4F60A 3EDQA 3CLSC 3PICA 1GVHA 1V3TA 4AU1A 4CIWA 3NKFA 1A7TA 1YB5A 2NXNA 2PXXA 2R6HA 5DWQA 4ZOLF 3CE9A 2FWJA 5KOJA 2M5DA 1Z4LA 5D8DA 1NN0A 2QJSA 2C20A 4KI7A 1X1RA 1G55A 2M9MA 3H2SA 1JDZA 2QD5A 1K97A 2FWBA 2OLJA 1CQXA 4B31A 3D3JA 3ICQB 2PHZA 1QTRA 1KSFX 3IGFA 3G23A 4DIOA 1BU8A 1K7YA 4BL5A 1A2BA 3L41A 4DZZA 4A8JC 5ANRB 1F48A 4Q5IA 1YR7A 2I7CA 4CCYA 5LQRA 3H5OA 4F2HA 4UZSA 1F6WA 5BW6B 1RWBA 3LW7A 4OG2A 1IJFA 2P4ZA 1XZDA 3F1LA 3TZKA 4DCCA 2FW6A 5DRYA 1YE3A 1OFGA 2B8TA 2ZI6A 1JDPA 4LK2A 3HG7A 3AM1A 1FDIA 2HV9A 3EIHA 5LWQA 1OXMA 5EQDA 1OV4A 1IMJA 4QPCA 3O2SB 4RESA 4A6PA 3GLSA 4PAMA 9LDBA 5JDIC 1TIKA 4O8CA 1TJ4A 1HDYA 3BE8A 5FBRB 1IZ0A 1LBTA 2NXWA 2R11A 2XXJA 2ZSKA 4ZQBA 3KUUA 3LUJA 3OETA 4GXQA 2X40A 3HVHA 1SHZA 4JK3A 2VPPA 1P7WA 1GT91 5FWAA 4BNZA 3T1YB 3BIOA 4KRGA 3DE1X 1AZWA 2PKWA 1OFTA 4PYQA 5SZJA 2F8TA 2AFHA 2ZWVA 4CIDA 4RF5A 1Y1RA 3SJBA 4RQTA 1T3LA 2RE8A 1KZ7B 2Y1KA 2GCPA 1XA0A 3FPHA 4I5IA 4DMMA 5CFLA 1E79A 2AG5A 4G5YA 4WZBE 10MHA 1ORTA 4JVNA 4MWTA 4Q7EA 4RJKA 5DFAA 3EOBI 4RLQA 4UUNA 2C94A 3TUIC 4C0AC 5CDUA 4EVRA 4EFZA 2QA5A 4ZVUA 3DHAA 5BR4A 1CY4A 4IZ6A 5HK8A 5B4VA 3K0SA 1T9DA 2RSLA 3K3PA 3LKDA 3MJEA 2F8SA 1A2QA 2G80A 4NZOA 5DE3A 3Q5GA 3NDBB 2VQ6A 2FV8A 2XWQA 4RBNA 3THWA 1SUDA 1X7YA 2EIHA 1TPYA 4GUDA 1FY2A 5AKKA 3W5JA 3HYNA 1OF1A 4A6XA 3MT9A 6Q21A 1I1OA 3LA6A 1QIJA 1DG1G 2Y76A 3CPEA 1XZKA 3K73O 1IJKA 5AUOB 3AVTA 3G1PA 3P2OA 4D9IA 1ZJWA 2Z6UA 4V24A 2BFZA 2IP1A 3GNLA 2XKJE 4FC7A 3QF4B 1IXYA 3L0DA 1WQ1R 4I1OA 2AQKA 3ROQA 3CUKA 4IYJA 4N01A 5C7IO 4HMQA 1MJFA 2AJ8A 2JA1A 4IUBS 4UM5A 1MVNA 1GY8A 1PV2A 1XCPA 5JCOC 4OLJA 1H22A 3VQZA 3F97A 3U1TA 1LVGA 3LQ1A 1PBNA 2FSGA 3LX6A 3VJRA 1KZ6A 2LE0A 2GD1O 2O50A 1W36B 3A3PA 3BICA 3O4JA 4DZRA 3BYZA 4JENA 1ZI9A 3TWOA 4W99A 3JRWA 4EHJA 5AI0A 1BEEA 2VK4A 3GP5A 3IR5A 3ELYA 1U9YA 3HDJA 1LDGA 2A6PA 2G08A 1KAHA 1M2GA 3BXPA 3OQMA 1IBLB 1LH0A 2JW5A 3PUVA 5AVUA 4NE7A 1CDDA 1W2HA 4IIDA 4KDFA 2IH4A 1FS4A 3L8HA 4OF4A 5AR1A 4H4CA 1KY5A 1CE8A 2C9ZA 3PPVA 1RRFA 1ZHFA 2QT1A 3EF1A 4LHEA 3NJRA 4R2WA 3VTZA 4D98A 2FYTA 1ZJYA 5JWHA 1TO6A 3LS2A 5D1NA 2A59A 3N6VA 3EIXA 1XU4A 3TSYA 2HU8A 4EHLA 3GN1A 4YQEA 4UBQA 2PKQP 4LJ7A 1VIVA 3L4SO 3KSDO 4CTMA 1QIMA 1VBFA 3UY4A 2PT5A 1WZNA 4JR2A 1HK7A 3PXBA 4N5NA 1Q14A 4LOJA 2E4WA 3KT8A 1ABFA 3U39A 4PN7A 3OFJA 2I3AA 4IZHA 3GEDA 5CA1A 1WUIS 3GJYA 4I99A 1TL7C 1JR3D 3MLAA 4BNHA 3PC3A 1YOBA 3UMGA 1FP4A 3GVHA 4EKNB 1YR1A 2FZ4A 4EECA 4UQLA 1NMEA 1C41A 5DI3A 4LWQA 2B2NA 5GGYA 3V1YA 4YJ2B 3CA8A 3RE1A 1JFFA 2ZYTX 5B6IA 3WK5A 3TOCA 1KP9A 3DWEX 1OLUA 4NZMA 5DOVA 2W43A 4OXXA 3HWWA 1EM8A 2RHRA 3PGVA 1I33A 4DLPA 4ZZ3A 1DOZA 3K8ZA 3JAWA 3LBHA 4C6TA 5BUQA 3LXMA 4GXRA 4NTZA 1KYWA 1AA6A 1EK2A 3GEMA 5C31A 3GLIA 1DMSA 3PX3A 2R1TA 4NK5A 4J0GA 1OLXA 1HT1E 1ZNYA 2MOKA 4G1MB 4D5GA 1XPRA 1VLQA 2I71A 1JEYA 2ZWAA 2J48A 1L4BA 4ZC8A 1HXHA 3CUTA 3G6WA 1OX4B 1IRIA 1A9RA 2Z9DA 2IYTA 2GPBA 2Y1OA 3HKDA 3OCWA 4MQLA 1GNTA 1I10A 4JJ8A 4OK3A 5LP6C 2P62A 1P5ZB 1WVMA 3C5EA 4XUGB 2P5SA 4ARCA 3CJTA 2KW5A 2KWIA 4LYYA 1QIHA 4YRDA 1JG1A 1SBHA 2VYNA 1NVKA 1XTQA 1HOTA 3WIBA 3D3WB 5HNKA 2JFPA 2O0LA 3MQFA 3VYVA 1HH4A 2BZSA 3FZGA 4J9VA 5KVSA 5DHQA 1QQ6A 4DV2B 1BXRA 3K15A 4L3WA 2QRNA 3FWHA 4F1WA 1BVRA 4F8YA 1T9GR 2RGEA 4IX1A 3AMVA 2QIPA 3RVJA 3ZCSA 1AGNA 5C0OE 3NTQA 2FCAA 3ZWYA 3NUZA 2X5XA 4E2ZA 5MF6A 3DC2A 3DV0B 4NJMA 3C7DB 5EJ8A 3GLTA 5AXOA 1VRCA 2P2NA 3EGWA 4AJPA 5EXDA 3LUDA 3KCNA 2Q3JA 4YT5A 1R88A 2LKCA 5FKJA 2TMYA 3U3OA 1HYQA 1EGHA 2CXQA 5A7HA 1XLTC 2QE7A 3L6UA 3E58A 4F71A 1G20B 2Z08A 3CJRA 4NYMQ 4WWHA 5EYPB 2A0YA 4PXSA 1KOFA 4AIRA 5T7BA 3FHTA 5CXUA 3R6DA 1IU9A 5LLTA 1CR1A 1MB4A 2OD2A 4Q1AA 5IASA 5BPFA 1E7RA 2P27A 2HKIA 4RIHA 5F1YA 3BJIC 1UXHA 3W2HA 2DHEA 3ESZA 1PGOA 2MR5A 5JJKA 4DKXA 2O7VA 4ZAWA 1PT5A 2O0KA 2X5NA 2CFIA 4B3SB 2FHSA 1K08A 4CEHA 1FFXA 4G9BA 1DI0A 1SXJC 3F7OA 2G4LA 2WVJA 1R2QA 4UTRA 2YJ5A 4PZAA 4RVGA 4F5DA 2ZM5A 2YZ3A 2W5UA 3MCWA 4DR6B 1BG6A 4HD8A 5L6MB 4CGYA 4E46A 4LECA 4Y9UA 4PFKA 4ZT7A 4BVGA 2O05A 4YONB 1EZ4A 2HQOA 3L93A 1BN6A 1E64A 1KEEB 4PGFA 3S8YA 4I9FA 3GWGA 2HK8A 5DGCA 3V8PA 1GNSA 4E3WA 5ITZB 4LJYA 1IZ7A 4IV5A 2Q8QA 1TO1E 4GSYA 3HLYA 2OOKA 1IY2A 3BMCB 1A2KC 4WXHA 4OJNA 5G2OA 4BNYA 5J2UF 2R7AA 1TRKA 1V8ZA 2GBIA 2IYNA 2H0AA 2Q1SA 2P9EA 1Z3CA 3P45A 4KE8A 1Y3IA 3I9JA 3SAJA 3WB9A 4BB6A 1U63A 2C4NA 4CLEA 1CUVA 2PMFA 3AM5A 5FR2A 4GRAA 1Z4JA 3EB9A 3DOIA 3M5DA 4JVLA 1GFWA 3PGA1 4HK4A 1XYGA 2JHGA 3AEZA 4HH1A 3NBUA 5EE3A 3RUEA 3S4YA 4GWLA 5IFKA 5FPSA 2IQIA 3O3NB 4QYWA 4JDPA 4COOA 1JHXA 1ENPA 4ZCTA 1K8RA 3T5PA 2X8AA 5TMPA 1R0WA 1Y42X 2ZRGA 2NMVA 2QTFA 2CLHB 3P8ZA 5KOJB 3QG5A 2KYRA 4TLMB 5I9IA 1A5BB 2ZB4A 5COBA 5JCJD 3FZEA 1XM8A 1TCUA 5JBQA 4A1FA 4E03A 3FLBA 2CZQA 3OHSX 1NY6A 3B38A 3IUPA 4LE1A 4HNUA 2NNWB 3GGPA 5DYYA 1E96A 1M34E 4PXYA 4X45A 4WBNF 4GL2A 5DEIA 3OQIA 3HB7A 2VPZA 3MTAA 1LEHA 1E60A 1JPNA 1K68A 1V7ZA 2OOSA 3OZAA 5ILQA 3T52A 1WM1A 2QMZA 2SBTA 2H17A 2JAQA 3CX4A 2X2OA 4MUNA 2XQFA 2J3QA 4BAUA 3HM9A 2J6HA 1PRYA 1XQXA 5J9FA 2X1HA 2X19A 4B75A 4C1BA 4PHCA 1Z18A 4D5EA 3KUKA 3OKPA 2IZZA 2RHOA 2WK1A 4Z86A 4C7BA 5FUQA 1SG0A 4H08A 1JDTA 1R16A 5MN4A 4KE6A 3U09A 5JNSA 4C0QC 2AIOA 3MZ0A 4ZCQA 2RGDA 2V7QD 1JU3A 4FWIB 3FE2A 3KZ1E 4GYUA 5CEEA 3FX2A 2G5TA 2VYCA 2Y71A 4QOFA 5EH9A 4BKQA 1DB3A 2FRDA 3FRIA 3RBZA 3KCQA 1SEVA 3I01M 3ND9A 4FW9A 1E9AA 1DO2A 4WD6A 3NWBA 4HWTA 5CHYA 4YNBA 4DSAA 1D3AA 1KZ4A 4O5OA 1X87A 4RV5A 3KSAC 1UEXC 2VRNA 4GXNA 4W8HA 5K3CA 3FUXA 5JJLA 2QB5A 2BP7A 4G89A 2ACEA 3LT5A 1G59A 1H8ED 5AJUA 4ALKA 3HJHA 2AFHB 1KK0A 3FIJA 5C5CA 4GT1A 3T7AA 1C3EA 4P3KA 4YRCA 1RKXA 1QV6A 3PFBA 3A9SA 4ZC1A 3M6AA 2J87A 1CJTC 5EUBA 3CW8X 4HAXA 4UNPA 2JG3A 2QTRA 1DCTA 2VN8A 2JIZA 5JU6A 3QI2A 3ZDYB 2Z43A 3THSA 2Q4EA 4CF3A 3KWMA 1UPXA 2PBLA 3THWB 4CDMA 4C4RA 1X7YB 2WPDA 4L5BA 5C4IA 2LDXA 4BWFB 2AD5A 1NXSA 1GILA 1G7SA 2QM3A 3IOYA 1SUFA 4M0UA 4PN3A 3K1YA 5GTDA 4Q9KA 3D7SA 2R6JA 1XXHA 2ARKA 3B13B 4PTYA 4DYHA 3QYFA 1DC8A 1KI6A 1W5BA 5K0WA 1PJRA 1TVEA 5HX7A 2BFZB 4D96A 4E7OA 1VHWA 3A7EA 1B1AA 3TLJA 4BLQA 4C87A 1XTJA 1Q5PA 1LX7A 4QGHA 1V16A 4QL3A 1OXTA 2JASA 4H18A 1U0RA 2O14A 3GLFA 5GINE 1BYIA 1YI1A 3ENZA 2L2QA 1UKAA 2B82A 2R6R1 4LC1A 1O9BA 1FNCA 3SYNA 1NLZA 4EG6A 1H4VB 3V7UA 3HUFA 2HA0A 3GRPA 1U8ZA 1YJ5A 4B3DA 4E5YA 1OYYA 3TSZA 5BQFA 3GEGA 4LQDA 3X2SA 2W37A 1HQDA 4NOKA 4RK4A 3DCNA 1YXMA 1AKVA 4E1BA 2C2WA 4B4WA 1CZHA 4KSBA 1U7OA 4D1TA 4EPYA 3B9PA 3L6CA 4B0PA 1Q22A 2I9PA 5FUBA 3WGMA 3F9OA 1Z88A 2CLDX 2V4UA 5ALPA 5TPZA 3BC2A 2B9VA 2G17A 1ULBA 1O0BA 1JR6A 3MD9A 1MX5A 2NYPA 1ZD4A 2POCA 2OBNA 1WCYA 1X7WA 2HTEA 3PI6A 1RFGE 4GMKA 4ZI5A 2EGHA 1SXQA 1CE8B 3G9XA 3RKSA 4RF3A 4V38A 5U1PA 5FIUA 4BJ5A 5FAKA 4FPXA 1PSDA 4OKSA 1X74A 1DU4A 4QPZA 5K8IA 2OE2A 2QZZA 1TCAA 1ZNBA 1G66A 3QHAA 1ACLA 1C7FA 4TXHA 2IYSA 4AKHA 3IA7A 4NPAA 4I14A 4NYIQ 4KAAA 1KQNA 2APJA 1U3VA 1R6TA 4G1BA 4RVCA 1Y5NA 2ZJBA 4KEPA 4DMRA 3LC1O 4TLBA 2NT4A 9LDTA 3P0FA 1GYPA 2J31A 2XGJA 3FHLA 4FBLA 4KFSA 5CNKA 3EXFB 4EI2A 5CA1B 1GSOA 2VATA 2ZIVB 3AETA 4OMDA 2OECA 4RMIA 5J2TF 3UEOA 5JEDA 1WUOA 1SPBS 2WZBA 1FP4B 1AKNA 2X2FA 3UICA 3I2HA 4KVGA 4M1QA 5D86A 4P4LA 5BV1A 1DDKA 2IOFA 1K5HA 5DI3B 2GAIA 5H68A 4ZEMA 1Z5PA 3MBOA 1KL7A 1LSOA 1JFFB 1LGYA 4Z49A 2G1AA 1Z7YA 1OLUB 3EDCA 4JMLA 1NF2A 5EL0A 3STVA 4RM3A 1RFLA 1SIUA 1ZH4A 1EM8B 5JQGF 2BGWA 5KIKA 2Y1CA 3SHFA 1XDGA 4U02A 3JAWB 4C6TB 4BV9A 1GT6A 1YDEA 4RPGA 4JU8A 2AZMA 4HQLA 1UDCA 2NAFA 1DXOA 4K26A 1E2UA 1RQRA 3WLJA 5KYTA 1E6EA 2R1TB 3FY4A 3GLIB 3DW3X 4EG3A 1OLXB 3N05A 1O95D 4I46A 3PUJA 1TMKA 1JEYB 4KXWA 4TL6A 3AF6A 1L1QA 1TLLA 3PHLA 4FR0A 1A27A 2XVMA 2ZSJA 3HKDB 3UJ7A 4EA6A 3E9YA 1U1GA 3ME5A 2J3JA 3Q12A 4HHEA 1VGQA 2SHKA 3D5TA 1GN9A 2WJVA 3N86A 4GZ6A 1ZU4A 4N0EA 4QPPA 4QQRA 3DB1A 1ZN9A 3AT1A 1JNYA 2GZDA 1QQBA 2LTAA 1PR0A 1RYZA 2FZGA 3DDUA 1W46A 3K0FA 1GCAA 2W8BA 2XIJA 1C81A 1MFZA 2EBFX 3PL5A 1JYFA 3W2FA 1SK9A 4YP5A 4X8MA 1VMIA 4YECA 4ZRDA 1BXRB 2Q45A 4LJLA 1N92A 3AQ4A 4Y3UA 3LC2O 1JIJA 1UOPA 3RRZA 4MJXA 4MOWA 1WKCA 4WXYB 2I6QA 3GELA 5DX8A 2I2CA 3LP8A 1PKXA 3BWDD 4NZNA 1CY0A 3HXMA 1YS1X 4DZTA 5TR9A 1P77A 1X3SA 4RKRA 3AB7A 1IY1A 4NJMB 4UUQA 4CU2A 4F85A 4KHPB 3OA2A 1M8JA 1DOAA 3JTEA 2XYQA 3TQRA 3ZE1B 2KX7A 2E55A 4LJ5A 1Y9ZA 1GRQA 3OE4A 3I9OA 4B74A 1S1MA 1GOTA 3KD2A 3ZG6A 4OUDA 3IT2A 4D79A 3TEMA 2VF4X 1HYGA 1JE1A 1U2EA 2M6KA 4ZN6A 3TZ6A 1GU0A 2VDOB 4PAWA 2D8MA 1N2XA 2FJPA 5CTJA 4G0VA 1GA6A 2XQVA 4PWYA 2SICE 4WZAE 2XTJA 4X6YA 1KP2A 1A8HA 4BX2A 3ZPXA 1OA0A 4DDTA 3ESYA 4CR7A 1IDOA 1NOJA 1N6NA 2QD4A 3WK8A 3OMLA 3EVFA 1EFRA 1TQ8A 3G0BA 3WGKA 3H83A 5LP6F 5C81A 3GNSA 4CEHB 3U4GA 1LJUA 2FSHA 2R7LA 4FTWA 1FFXB 2G7ZA 1M0WA 3GVPA 3NRJA 3WV5A 2I91A 2EBUA 1I51A 2LDBA 2Z09A 3KE8A 4P8RA 4ZXPA 3JRNA 4G09A 2COEA 4DRXA 3VKHA 2DCUA 1MJGM 1E4VA 1BXZA 4GRDA 4IDHA 4OGGA 5FHRA 4RAWA 2NSHA 1MOZA 2VDJA 2PEZA 3RUIA 2QN6A 4O4IA 1FNMA 3FSEA 3TYXA 1DC7A 3PNOA 2OK8A 4L1KA 3TH5A 1MPTA 1HY3A 1R00A 1OY1A 4FSDA 4IILA 3VZBA 1AURA 2G1UA 4IH9A 2BGJA 5FTLA 4K9QA 2C00A 1ENZA 5AUNB 1UKBA 1P2VA 3QW4B 3VZCA 2F43A 1V37A 5K4GA 5GWXA 4TWZA 4HDRA 5I7FA 1SUEA 3ORQA 1BFKA 2GKSA 3UAZA 2Q5HA 3CIFA 2F3SA 4JODA 2W6PA 3R7NA 3EGCA 3ZCPA 3DDWA 5M29A 1KVSA 3QU4A 5TQ2A 1LW7A 4ZA2A 1OMOA 1BS1A 3OFVA 4LI0A 5HIIA 1HLPA 4U7GA 2E0IA 4QOGA 1FP7A 1SB8A 2GEFA 4AT1A 1RJ9A 4AMYA 5FQCA 5K3OA 1EUCA 2GFKA 4FYMA 3W3AH 2RAVA 3EVCA 3PFGA 1ZOSA 1CERA 2IFTA 4G8BA 4BJHB 5LU9A 1YI0A 4G5XA 1XVLA 1IY8A 4GMGA 3FUCA 4W5HA 1PDVA 1N0UA 2NZJA 5EXSA 3A6LA 3R7LA 2COUA 2XF2A 1SO8A 1NW8A 4Q1CA 2O8BA 3OQIB 4Q7LA 4K9PA 1FMFA 4PVOA 5BSKA 1D03A 1SHUX 3GDFA 3ZKWB 4KRXA 1EB9A 3KKLA 4Z1MD 2FPPA 2WUWE 1N9KA 3ZZ0A 2EKQA 3R8FA 3VNQA 3CNBA 3JD2A 3RUHA 1N2JA 4EHKA 2B69A 2BZ0A 4OHVA 5KJEA 2IF0A 2IA5A 2V97A 1MPXA 5ERXA 3FSGA 3LQ4A 4TROA 4HXGA 4WKBA 3LLMA 2JAUA 2J09A 4X8HA 1GPUA 3ZZUA 3LXUX 2MMGA 1DDIA 3GLRA 5ALGA 5ELXA 3ZDDA 1UFRA 3QWBA 1Z4IA 2ZYAA 3NAQA 1RRCA 4DR7B 3KR0A 5GJVC 1AE1A 2CFUA 3ZU5A 3BJEA 3L1IA 3NTOA 1SQ0A 4RHCA 3MSCA 4FFRA 5JXGA 2BP7B 5KJ1A 1A5ZA 2ZYVX 3X1JA 2O2SA 2C1EA 5KJFA 1XL1A 2A0WA 1T9GS 1DEXA 1KAGA 1Q20A 2D3WA 2JGJA 4EY2A 3AB8A 4CZ2A 2YV2A 1DDGA 4B2IA 1QCDA 4PZLA 1SIBE 4MMZB 5DNWA 5EPUA 5FQAA 4TT8A 1Z2AA 3TLXA 2X2PA 1V5WA 2DU8A 3KL4A 3VTFA 4WNAA 4EHAA 5AW3A 3QUAA 3R9WA 1T35A 3V2UA 5KSYA 4MVJP 3AVOA 4RVOA 2KM1A 4G5HA 2YTZA 3QMVA 5HIJA 5J59A 2PMKA 1P4HA 2Y4OA 5K45A 2GARA 1D6MA 1M72A 4RDCA 3ZU2A 1CHDA 2O7QA 4CXMA 4EYBA 1RQ7A 4JITA 1W0KD 3WQRA 3UMSA 3KR1A 1VBKA 3QVGA 4LRQA 2NU7A 2J0UA 1ZM4A 1XXHB 4IDGA 3WTCA 4BMSA 3BG5A 1H85A 1KI6B 2JCVA 1KWGA 2D62A 1UODA 2FG5A 3FPBA 1QF7A 4N3CA 3LRXA 3H2IA 4RMGA 4BU1A 1V16B 2QVCA 4TKUA 4LZAA 1WXEA 3GLFB 1JB1A 1FFEA 2WW8A 2MWMA 3F3SA 3HP1A 3VVLA 4BNKA 1J56A 4BYGA 3CH5A 3G59A 1GGJA 4ZQGA 5JDCC 4A16A 4D57A 4OLAA 4U6NA 2V6FA 3PC7A 2WF7A 5TQJA 3OCZA 1O6ZA 4NYJQ 3CVVA 3HJAA 1TQDA 1J39A 2YRWA 1U7XA 3R9IA 3VNUA 4TLEA 1O6CA 2Y8EA 3ND5A 5HIMA 3RT7A 4S1OA 3W0LB 3D9QX 1QO0A 3DXZA 5K03A 4JVSB 1KQ3A 2CHFA 1YCHA 1N5MA 1ETHA 2QMOA 2FFJA 3ANNA 3ISVA 2C9BA 4JFRA 3DLIA 3H1AA 3HPQA 3SC4A 3HTXA 2A57A 1X7WB 2IZ7A 4J49A 4B34A 4XB6B 5JCXA 4G07A 2P4HX 5C1PA 1M2NA 2XOKD 4PVTA 1HEIA 4JB0A 4P5DA 4KV9A 1E5LA 2QK4A 1CR2A 2P7HA 1IAVA 1EFLA 1F8UA 2Q3BA 3OKCA 1FNSA 1VZ2A 4MWOA 4A26A 5B2FA 5BR1A 2FW9A 3QLVC 4C4OA 4PC1A 2NPFA 3AKEA 4CU5A 4ND7A 1CY2A 2C03A 2HPAA 4UEQA 4COKA 5ECDA 3W5VA 3NPAA 4ZCSA 3AFMA 4L75A 4UFNA 1T9AA 3I05A 1U4SA 1YUNA 1Z0UA 4FYXA 1U0NA 3RRJA 5IC6A 2CMHA 1UJBA 2VYFA 4KOEC 5LBIA 3WKEA 1OWLA 2G7MC 3AETB 1NWHA 1AK1A 4KQKA 2IHZA 2VHVA 3PVSA 5LZ5A 3DOUA 1IH8A 3JQQA 4N18A 4OQZA 1WG8A 3PQ5A 5AOBA 4C4AA 3N87A 1ZISA 3TEFA 1G5IA 5KQPA 2QP4A 5TF0A 3KKNA 3Q3GE 3D4NA 4M0EA 3ZI7A 5KSOA 2XF4A 2A5LA 4NATA 5BWLA 4Y2RA 1H4TA 4Q1EA 5BUZA 1YMUA 2GBCA 3DE6X 5CHEA 5HJEA 2YINC 2PQMA 1J9ZA 3IA2A 4B33A 2P9TA 3H1EA 3B1VA 1R0KA 4IQFA 2WM9B 2XE4A 4BNUA 3AEXA 4HLUC 2Y9MB 4D82A 4ZV4A 2EW1A 1LDYA 1P2TA 5ENZA 1W1UA 1DKOA 4BGIA 4LK3A 3PJRA 1H5NA 2NLOA 3IERA 3A2KA 2HRBA 4JYZA 2CNWD 2JJYA 4R5MA 1B2RA 1SKYB 1P7PA 2WD7A 3DFUA 1C8LA 1K4YA 4IRXA 3V3KA 5C8YF 2L18A 1HZZA 2J9XB 3RQSA 3T12A 4EJ6A 1JV2B 2C92A 2IXBA 3UKOA 1MG5A 4M0LA 2WTXA 1NXWA 3NETA 3T7DA 3X2XA 2EWVA 2I2WA 1TNDA 4DLAA 13PKA 2HJVA 3K9GA 1IQPA 4RS3A 1P1BA 3PHIA 4YCJA 1UDBA 2ZIAA 2W8BB 1QP8A 5C8VA 5BPHA 2O3JA 3S27A 5AMXA 2HRDA 1C0EA 3T3EA 4NZ9A 3ECAA 1NP7A 1JAXA 2FSUA 4HJRA 1QTQA 3LLSA 2DY1A 4CV1A 1W2GA 2H4HA 1V5FA 2WWXA 2XVYA 2IGTA 1EFCA 2BR5A 3GFPA 3ND7A 1T5HX 2GN8A 4RACA 4RYDA 3IEIA 3IP9A 4MMYB 2ZJOA 3FNBA 4OK5A 5BQPA 2BF4A 1H2HA 3RFCA 1G2OA 3W5SA 1GZ4A 4XWAA 2A14A 1HYEA 2FWIA 3L4BA 3FVTA 4XGNA 4UWSB 5E0OA 1A50B 3W4JA 5KTYA 5DTMA 2DECA 4D8WA 5AVKA 3BMNA 4OUDB 4MJ3A 4XYMA 3NEAA 2C82A 4D74A 4E5UA 4A15A 4OHFA 1ZA2A 4LRWA 5ALIA 1FMLA 1P0IA 2R5WA 3OD5A 4LSMA 3NOVA 3HBMA 3Q8XB 3JY6A 3LBNA 1A9PA 4KDRA 4MS3A 1M67A 3SYTA 1M54A 1B74A 2IY9A 3I14A 2JVJA 2VK1A 4IMRA 4AMUA 2PZKA 4PX2A 3SD7A 1W4ZA 1WD7A 1EVQA 2C2MA 2CMGA 3C14C 3EZ6A 4PX5A 3W78A 3WMXA 3AJEA 3QX3A 3AL0C 4GR5A 2D1RA 4IBOA 2QLMA 4MW1A 1TADA 1UJ5A 1X7XA 2BHLA 3FOAA 2R751 5KOIA 1OE0A 3D59A 4J6EA 1Z6AA 2JFFA 1PYDA 5LUAA 4TWIA 2OORC 3GFGA 3I0ZA 4ZOBA 2DPLA 4J0KA 3OHPA 1T29A 1VKHA 3B82A 2QM8A 1R1DA 4B35A 2XH8A 1V6AA 5KSPA 4DRXB 1XTZA 3BF7A 4HWKA 3CWZA 4NH0A 5CG2A 1RD4A 1FSZA 5KOHA 2H5LA 1NURA 1DBWA 1RHKA 2D2FA 4G1VA 4GG1A 4L5AA 5CJPA 5GONF 1YBHA 2BGLA 2UVDA 3QP9A 5IJWA 5EKDA 3FPFA 1TAHA 3PDJA 2V0GA 1VPTA 3I5UA 4H1VA 3PQ2A 4O4IB 3I45A 4RH1A 3UMCA 1KYVA 3VPHA 4DLXA 2NT3A 3DKIA 4FR2A 1U28C 1XMJA 2FPLA 2C8JA 1B7GO 2J5XA 3LHKA 4RZ2A 3Q9UA 3I15A 3BQ9A 3TQFA 1XCMA 2WJJA 5IAJA 4L8GA 4M8KA 3D2CA 2CV0A 3CEPB 5CTAA 3H86A 2ONZA 3BD9A 1ISGA 2F43B 4J7AA 5J4VA 1I9CA 3PJFA 3M9WA 1QH8A 2AZTA 2EQAA 1ZK3A 2GX6A 2OFWA 2WVAA 3CGGA 3FPAA 3FPLA 5CBPA 4R1MA 1L5KA 5FWYA 3O4GA 2FB9A 2HD4A 3AU8A 3VR5A 4QATA 4R6WA 4V0KA 1ZHOA 3E2PA 4BPBA 1T4DA 3WIVA 1MO4A 1RQNA 2F64A 4IQ0A 3RF6A 1TKCA 3DXXA 1GKLA 3WOHA 1BDJA 2B20A 4Q3LA 4RK0A 4NXNB 4ZTBA 5EZQA 2ZB8A 1RJ9B 3PRYA 2ROQA 1T1SA 1XTUA 3B85A 4DLUA 5DWDA 3VC1A 16PKA 1EUCB 3X2EA 4AN1A 3UFBA 3GX1A 3AUJB 3UJ6A 1Q6YA 2Z57A 3TVTA 2Q4OA 3FM9A 4GDFA 2ZRMA 2VTBA 1EI9A 1D2CA 4HKTA 4BN5A 2W6JA 3CWCA 3RRYA 2O8BB 3SX0A 1GG9A 2PRYA 1L4EA 3CR3C 3FTNA 3CG0A 2IV3A 4CCWA 3O0DA 4V0LA 3G89A 1IHUA 4BBZA 5DW0A 4CTJA 1RYNA 5H9VA 4UMEA 2DM6A 1FFWA 5JTTA 2E49A 2FPPB 4YCBA 4NJEA 4J2TA 5FPPA 3RIEA 1NYQA 3N5KA 2VP0A 5JAIA 5JRZA 4RK5A 3UANA 1OVGA 2PA0A 1L5QA 1KRWA 2J33A 1Z12A 2VTEA 4DNPA 2QAGC 4RKFA 1A04A 1X9IA 4D3SA 3NIBA 5CLQA 3PPWA 2K2QB 4YRJA 2A2ZA 1YL6A 3TJRA 3O1IC 1E89A 2G88A 1GZSA 3QE9Y 2X5KO 3EXIA 4NBTA 4UQOA 3HXTA 1WSAA 4OFXA 4WH0A 2ZWPA 4TVBA 5LCXA 4BB9A 2NUAA 5L45A 4TYWA 2PO5A 5B6PA 4PIPA 1LK7A 2BFAA 3USES 2ZJ0A 1Z6XA 1PTJA 2I4MA 2VWPA 4TN1A 1NUSA 3F3YA 4JJFA 2W2OA 3FPCA 1CV2A 3BN3A 1L4KA 4OQYA 4MV5A 5CA0F 4G63A 1N2SA 3RUCA 1GV0A 4JOBA 5BYBA 2BTQA 2HBRA 2R85A 4NYMR 1ONSA 3WWOA 1SUBA 1H2WA 2Q7DA 1L6RA 1UK7A 4MDHA 3VPSA 1RI1A 4IPTA 4IOLA 4G4SP 3VHRA 3UUGA 4P58A 1V9SA 4WNAB 5ALYA 3LLVA 1QGED 3KR2A 1YE8A 3HCOA 1U81A 2IUYA 1C4WA 1E8DA 4LC0A 5LQSA 3LVRE 4K6OA 5EQFA 5TXGA 1VHQA 4LZLA 5KNCA 2JK0A 1YNSA 1K89A 2QJWA 5GIOE 2ZBQA 2M2IA 5G0WA 3A3YA 3GHHA 3BD6A 3IUEA 3NNDA 4HNQA 1DFHA 1T1IA 2WIKA 2F59A 4K46A 4JUAA 3QVGB 3OIUA 3AR9A 2NU7B 2J0UB 4HLQB 4Q12A 1WUYA 2DUJA 3LCVB 4U2BA 1NVFA 5D3ZA 5J5VA 4D0GA 3E9CA 1XN4A 1AKMA 2VNHA 3OBIA 4MEJA 1ULZA 1VDZA 1RZRD 2X77A 1L1EA 2DFLA 2YOFA 4IHQA 2JGLA 4P7JA 3PI7A 5F7ZA 3L92A 3TLBA 2GLUA 4DNQA 1L5SA 1GAJA 4TKUB 2VP5A 3JALA 5FAXA 4BY9E 4H3SA 5IJZA 1SD5A 5BNZA 4IXNA 1GWNA 1PLJA 2OXEA 3GFOA 3HB4X 2DUWA 2W4QA 3I58A 2CXUA 3QXGA 4PZDA 3RD5A 1Q50A 3AHHA 4XWWA 1E59A 4GKVA 3A4LA 4MI6A 1FXWA 4CCSA 5F76A 2NQ2C 4ITUA 1GSAA 2R47A 4I5EA 4UQPA 5HQJA 4BVBA 1Z6GA 4KCGA 4KXLA 1Y6GA 5BN5A 4Y0VA 2GD6A 1G4HA 2CNDA 4F0JA 3V8BA 4EW2A 1PWZA 3TW8A 1COWA 2LRHA 2NV2B 2Z9BA 3AI2A 4UAVA 1SEPA 2CMFA 5U4XA 3Q72A 3PY5A 2HHCA 3SEZA 4MVCA 2ZSDA 3AIKA 3H84A 1LFAA 4DCTA 3RYFA 4DDWA 2GILA 1KO2A 4QBFA 5IKEA 4E22A 2C9OA 9GPBA 1PZFA 3P96A 4BJ1A 1ZIXA 2CHGA 2FFRA 1FVXA 1IQRA 5BN4A 1SR8A 1XLVA 3A26A 1PZXA 3TR6A 1DOHA 5A5ZA 2HT1A 4JN6B 1QPGA 4Z99A 2ZTLA 3L79A 4KXFB 4RGVA 5JH7A 3DTVA 1WU8A 4WACA 1PL8A 1JL3A 3KB8A 1CNEA 2YWEA 1QYVA 2ZJ3A 3E3LA 3ROPA 1XZ8A 3UKJA 3W7AA 3PPYA 3CW9A 2V7XA 2WAXA 1A8SA 3DUWA 1N3IA 5T4EA 3KNRA 3QVMA 5IMSA 5IKPA 2IEIA 4G9EA 1UH5A 3U7EB 2V7PA 2CFZA 4J2OA 1NI4A 4ZV9A 1W87A 4C0HA 1YQXA 3NBKA 4Y2UA 1BXGA 1I32A 1TZBA 3IP8A 2Q8PA 3NJ8A 3GF4A 1FXUA 3A11A 3AX6A 3R7WA 1H66A 4TSRA 3B6JA 5REQA 1UT6A 2XJ4A 4LF6B 2HA2A 1RYHA 1U31A 4BZXA 4RULA 5EW0A 4RABA 4CM7A 3L01A 4XA8A 2QX9A 2FR1A 3ETEA 1KOLA 1HLFA 4LZPA 3QVXA 3SIPA 4GR4A 1BDHA 1F0PA 4M54A 5HWSA 2E7ZA 4NKRA 5B30A 2ZR7A 1K9VF 3U0BA 2ORYA 4MW9A 4AV7A 1NW4A 3UK7A 3UJHA 1USWA 1JVBA 1XRLA 2TMKA 5FV7A 4YSKA 1XDWA 2WD7B 2DERA 3CH7A 2YCLA 5FNZA 3BXXA 1QZ3A 1B2LA 1Y82A 1Z74A 2HU7A 1XDUA 3BEOA 2QTCA 3D8UA 2QSJA 3ZV3A 2C7OA 2H1HA 1KYZA 1OIWA 2J3LA 3SM9A 4NBSA 1VJ0A 1NJ1A 2JGDA 5JS1A 5HDBB 1HE5A 3SS9X 2ZITA 1DXQA 2GZSA 2BGGA 4WKCA 4YJ3F 3WL6A 4BVAA 2PYIA 4JR0A 2FWRA 4GI3A 4P35A 1EWVA 2GJ4A 5J58A 1J1UA 4OFWA 1A5TA 2OR3A 1S4MA 1HV8A 1XCJA 4X5OA 2J41A 5LYJA 3DQZA 5LA6F 2ZS8A 4XOUA 3ZQJA 4JT8A 2OHVA 1RKQA 1E7WA 1N8KA 1DWPA 1QHEA 3ABSB 2QRHA 3GW8A 4ZO9A 3T7JA 3WFJA 4DJJA 2AUMA 3MOSA 4C7XA 2LIVA 1EEHA 3BH0A 1IZ8A 4ZHSA 2B2XA 3ZS8A 2WC1A 3BMNB 2A5DA 3U80A 3DMPA 3SLKA 4C0KA 4OLBA 4AY2A 2C57A 2YR0A 1U1CA 4P4TA 1Z5NA 1EFPA 5J5AA 2GJKA 3LL7A 3JZMA 3TTSA 4F21A 3IAS1 3KB1A 1AC5A 4MS3B 3P4YA 2N0SA 1FW8A 2GR9A 4U0KA 1W5AA 1RPZA 3FYDA 2F3TA 1JIVA 3H3FA 1GPDG 2Y93A 3D6JA 5FR1A 1N3BA 3HHPA 3GEIA 3SBDA 2AXPA 1EVLA 1KF0A 1RIIA 2BCJQ 2GWHA 1P7ZA 2Q6KA 2XLCA 3A2NA 3EZFA 4LNAA 3L0PA 4OU4A 1K4MA 5JARA 4DCVA 2C7PA 4L6CA 1P9EA 2IPXA 1ISJA 3EPRA 3QQPA 3QF7A 3DOOA 4EPXA 3OUUA 5HK9A 3NW9A 4F3CA 3WYDA 1G291 5L3QA 1T25A 4NYIR 2X0NA 1B8PA 5KOHB 1JZSA 2AC2A 2NP6A 3O8RA 4CIYA 1OBOA 2BLLA 2H54A 3H9UA 2XT9A 1WVGA 1L7AA 4HH0A 3KT6A 6ADHA 4GOJA 4ALNA 3C0KA 3JQAA 4R54A 3JZFA 3VMFA 1MHTA 4BWGA 4I55F 4H0FA 2XHZA 3DAGA 2PSDA 5F12A 3F0TA 3W1EA 3EPLA 1HOXA 3B5EA 4HDOB 3NVKI 1E1CA 3ICVA 1NNSA 2LNDA 2VZ9A 1WZIA 3A6FA 3E9NA 5LCHA 3GPBA 1QH8B 4U2EA 3UH1A 1TMOA 5CBPB 4LRYA 1QYRA 2CL5A 4OJYA 4YT8A 4FMCB 5FWYB 5IDWA 3QWIA 1J6UA 2DPGA 2YV3A 4TRNA 3RT1A 1FS5A 4OP2A 1IONA 5IG2A 5LL6P 3E7DA 1DHRA 3QXHA 3TNLA 1YAJA 3MUEA 3AVPA 3NNNA 5F77A 4D8YA 1VE9A 2AOUA 2BJHA 3MA0A 1PVVA 3C70A 3THRA 1UUFA 1TT5A 3ZJ4A 1W73A 1BKYA 3DA8A 3OZGA 1OROA 4TZEA 4J4TA 4DLVA 5FUWA 2WOJA 1MTZA 5LZ8A 5T4FA 1CRPA 1NU6A 4DPKA 2ZK7A 4RXTA 5HRUA 2XMQA 5DPMA 3WGJA 4CMEC 1LDMA 4LOLA 3NS7A 1E6MA 3S3TA 2VTBB 1ULUA 3EY9A 1MGPA 2WQ6A 2FGKA 4ZO4A 1F7VA 4EPTA 2BRUC 3MJCA 4ZDKA 1K0UA 3TTUA 1ADGA 1E8MA 3CCBA 1G8FA 1VJ5A 2P77A 4Q39A 2OSBA 2RAUA 1C8BA 4RJIA 1JYSA 3V1KA 2AFRA 4C3ZA 3EYWA 5JPDA 3BA6A 4PGMA 3EXAA 1DPFA 2BFCA 4IMIB 1BW9A 3ZHTA 2VHTA 2UZAA 1F2DA 1D5CA 1XGKA 3IFSA 4D8TA 1FLNA 1SVSA 3LZDA 1E3QA 2ADFA 2D2XA 2IOYA 4U4AA 5LC1A 1PD1A 4ZHQF 3H7AA 4J1TC 2ZZKA 3ZQKA 3FAKA 3B20A 4EB0A 5EJFA 1FNDA 4DPLA 1LI5A 5IP5A 2AKEA 1XQVA 3EXIB 3VR4H 4ZZ0A 3PSAA 1FYWA 2BAGA 3LNCA 3R09A 2NUAB 4Q9AA 2ZXEA 5KREA 3QHPA 3UOAB 1E2QA 1WXDA 1RRVA 2NUBA 4Q1DA 4CFYA 2VDVE 4RJ2A 4TV9A 4WIAA 4MARA 4LGCA 1KAOA 2QDKA 2BTQB 3QSGA 4QA9A 4RK7A 2O48X 3OZBA 7MDHA 4N7MA 4U6QA 2D6FA 1UZUA 4H7HA 3ZBPA 3I23A 3RH0A 1B93A 4KGDA 4I4IA 1DKMA 3WRWA 1AGXA 2CF5A 1L5VA 3AEQA 3DFFA 3W6OA 2PZEA 4BNTA 4DJEC 3T1HB 5E8JA 4FDMA 4B3JA 1ZSVA 1HDZA 2WSYB 4Q01A 4H6VA 4QJ5A 4XX1A 1JEJA 3TFOA 3FAZA 1OX6A 2W6ID 3KHTA 1H8HA 2ZBDA 3C1TA 3HVIA 3UHAA 3UT5A 5HTOA 1GAWA 2CJFA 3EWNA 3QTBA 4A2CA 4CF7A 2RGAA 4BGUA 4FGZA 1GZ3A 3PIDA 4HNVA 1U0FA 1KAQA 2ZRNA 5HIPA 5LD2C 1EDOA 3C6ZA 1SXPA 1GZVA 3E9QA 1ZUHA 3LKBA 1NE2A 3CB4A 2H3EA 3CHYA 1R3DA 1EZZA 1JLSA 4TZBA 3JALB 5DF1A 3V2GA 4CR6A 3R3XA 3HCAA 1X1QA 1L7DA 4EO9A 3RBXA 3B6KA 3GVIA 2GM3A 2RHDA 2ZSHA 1E58A 4QKQA 5IDQA 4R3UC 4YJHA 3TXYA 5DEOA 4C1CA 3EFHA 1NASA 2QU8A 3RRXA 4Y2JA 1J2JA 5CH8A 3RYTC 1YMQA 1UBSB 2E6KA 3G5AA 2ZUCA 1C3XA 5HH6A 1QF6A 1HLKA 2QX8A 1CUGA 3VPBA 4YJFA 3TW8B 4DSNA 4Q82A 4RPLA 2OV8A 3B6ZA 3QPDA 2R84A 3DFIA 3CNHA 2CE7A 2P6RA 2QG6A 4EF6A 3GZJA 3H97A 5AK3A 4AJIA 4HNAA 4AN0A 1QHGA 1I5EA 3WHPA 3VPAA 2GMNA 3WP1B 4IZOA 2FH5B 4M76B 1GAEO 3RUAA 3RYFB 3JQBA 4WCFC 3LVZA 1ORHA 1T6XA 3HN6A 3HSKA 4GAEA 3U4CA 4ZYTA 3HL4A 3WKAA 5HF5A 1D2NA 5GP1A 2P9YA 1I4OA 1ODTC 2D06A 3C45A 3NPMA 4PONA 4QXQA 4UBOA 2RKBA 1ZSYA 3L7BA 2WHEA 4E4TA 2BW0A 2C2XA 4KITB 2YUTA 2ZTHA 3DBRA 2GYVA 1L0BA 1UMKA 3O4FA 2XCIA 4E15A 2OAEA 1DQSA 5JH7B 4XXHA 3DTVB 5JS7A 5K6AC 1KFJB 1VC2A 4MKFA 1T2DA 1D2RA 1SG9A 3IVRA 4I9GA 4PX3A 4EFKA 1GTVA 1OC2A 3Q0EA 3BX1A 3DFMA 3NKLA 4H3VA 2I8AA 2XWPA 4KPYA 5FH9A 5GJBA 4ZDIA 5G0UA 3TLEA 1GG8A 3AFGA 5HF6A 3VNAA 4L9SA 1NI4B 3TSOA 1X2BA 4P92A 1JIUA 1PFWA 3PEUA 1BXGB 5HPYB 1GD1O 2R2DA 3N76A 4BKUA 3GVXA 4JLUA 1XC7A 1UJMA 4TXJA 3R7WB 4BP0A 2O52A 3QW2A 1LTKA 4FWBA 1LLFA 4JJ4A 4JI2B 5REQB 1U1EA 2NAPA 5J43A 1P1JA 1QX3A 2ESRA 4N3AA 3RVMA 3WMRA 5D3MA 4OX9Y 5EP1A 1HDEA 1KQGA 4Z53A 4DQLA 2X6TA 3GJQA 3SSNA 3JCZA 3KWJA 3ZJYA 1VPWA 2YNMA 1NN5A 2HHAA 3SFPA 1NW7A 3CTMA 2R8EA 1RQ2A 3BXHA 3KEGA 3IILA 4UZEA 4BNWA 4YLGA 4HQFA 4R16A 2J1LA 2JZCA 3A1FA 3FMOB 5K8UA 2Q0JA 5EG5A 5AVYA 3ITDA 5H0IA 1HFEL 2AYYA 1J0XO 1QYDA 3FZYA 5AM3A 2YHUA 3OHMA 3KSZO 5EZYA 5IC5A 5BSTA 1UP7A 1E9RA 4TS4A 3UJ8A 1XL0A 2JGDB 4KL8S 5EUCA 1OA1A 3PE4A 1QE3A 1LPPA 3KQTA 2EZTA 1A71A 1UP4A 3G79A 3KHKA 4N82A 2WSSA 3Q6MA 3PB3A 4L27A 4GU5A 1KKUA 1LDBA 4TZ0A 2G9ZA 4XCXA 4JO0A 3T7SA 1E1QA 2R7MA 2IP4A 4FGKA 3T3HA 2HB6A 1PJZA 4CV0A 3OQNA 3PQDA 5LYJB 4RD6A 3SFVA 4BWVA 821PA 3ZE2B 5F5NA 2PSHA 1F3LA 3A6DA 4TL7A 5DLDA 3OZ7A 2BFKA 5ESDA 2M98A 1K7EB 1T4CA 5JZ9A 1LLQA 1NSYA 1SIOA 2YX1A 3D81A 3IUJA 3S2YA 4AO8A 1B0ZA 2FEWB 1LC0A 5DBIA 3VR6D 4GM0A 3NC1C 3ZHXA 3PENA 5LS3A 4NYJR 3H6KA 5AQEA 3I2YX 3VI3B 2OK7A 4FDLA 5JAHA 5IT0A 1AO3A 1UBMS 3T9DA 1DHTA 4E3ZA 5CK5A 1EFPB 5B1EA 2ZE6A 4RFLA 1QJ4A 1SNYA 1WMAA 3EH2A 4C14A 5K0TA 1LS1A 2W6NA 5ALJA 5KQSA 1UEIA 1N77A 1SFRA 2DFKB 3O73A 3O84A 3I72A 3MMXA 1MUUA 5M7EA 3OE7D 4WGFA 3KBBA 4Z9FA 5JC8A 1DIHA 1V95A 1Z8NA 2ZJ5A 2H7CA 4JI5B 2YJTD 1NN1A 3F6RA 5B7QA 2HMYB 1FLAA 1VP9A 4CL0A 5I7VA 5JD6A 2NSYA 1TIBA 5IVHA 4UPDA 1NJ6A 4IW3B 3C1AA 2DMRA 2VHJA 4X92A 3I0VA 1M34A 2X6RA 4GKKB 2P67A 3T5CA 2UZ0A 3WHLA 4II2A 5L3QB 1N6PA 5CVCA 2EKZA 1QGAA 3F7TA 3JZAA 4TMTA 3RU3A 4EHNA 5B3RA 3LECA 1P0CA 5EKUA 5JI2E 1C7QA 2DJIA 3LDUA 3OU6A 2VOJA 2O1WA 3PPXA 1DTWA 3T1OA 4FOSA 3LCCA 2IW1A 4FYPA 3ZY3A 4A2PA 4PEVA 3PRKE 3KXKA 4N8DA 1HDIA 4X24A 5DGHA 3JQAB 2CNNA 5AOCA 2YJ4A 2VQFB 2HLDD 3KQLA 1ZAKA 1QRUA 1WXXA 2DBYA 3E0QA 3GLGE 3WK7A 4JQZA 4DAEA 1UZNA 1E1CB 2BV3A 2Z0MA 1JMKC 4EPRA 3HB1A 2ZROA 2R97A 2WV7A 4JEMA 5AW1A 3LUFA 3PEYA 1KZ9A 5EAIA 1M1XB 3I32A 4P5EA 2OB1A 4POAA 2HXSA 2A9OA 5BWBA 4K28A 2YBDA 2QP9X 2RC5A 1NM5C 3ADBA 2A92A 1SHKA 1HKHA 4U7HA 4WXRA 2NO4A 1WPXA 2AOUB 4RADA 4RSGA 4Y18A 2UYHA 1PW5A 2O57A 2CBZA 1NBOA 1TT5B 2QN1A 3NP7A 4LKOA 4Q48A 2SCUA 4XEHA 5CNJA 4UTOA 3U4AA 3RUFA 3N2GA 3WKCA 4EDHA 1K5PA 4P62A 2RKWA 3UVEA 1GEGA 3KJZA 1RC1A 2B0CA 1FTQA 4Z7NB 1HYHA 2EDAA 2Q4RA 3A6ZA 2V4ZA 4PRZA 2AG6A 4LSZA 1L1RA 4B71A 4YAIA 1V5GA 5I7UA 3IOFA 1M76A 2WDZA 3LQRA 3Q8WA 4UBMA 4EVQA 2EX1A 3LH5A 3FKSD 5EWJA 1W94A 4NMLA 1OJLA 1ZRNA 5CITA 1ZM7A 1TM3E 4DCPA 3IJPA 3JQ7A 4P83A 3U4QA 2NXJA 2XV1A 1NVXQ 1WUKS 2GO1A 2PR7A 3C1OA 4YWJA 3TZBA 1Q83A 1M8KA 5A1JA 4IICA 2Z58A 4YY3B 5BYAA 2BFCB 3WTBA 4L0MA 1BW9B 3CSUA 3WLFA 2C0PA 3NBYC 4Z8XA 3UATA 1ZRMA 1ZGAA 1TRHA 1KY4A 5ERGB 2D1YA 3ZHYA 1UBGA 2Q42A 3WBKA 2V0NA 1O87A 2D5AA 4Q47A 3CVWA 3GL9A 1UBJS 2Z1DA 3HNPA 3WV4A 2B3TA 3AZOA 1J1IA 4PIMA 5JAPA 1HI9A 2NO9A 1AT1A 4MIKA 1UFKA 4Q3BA 1P60A 1LLCA 2Q46A 1T4GA 2I3BA 1QQ5A 2VR1A 2H1FA 1N8SA 2F3QA 2XDWA 3M4YA 3PNLA 4KZPA 1CC1S 3P9SA 3TIFA 2AEFA 2H57A 4ZYYA 2O2JA 2ZT5A 3ACBA 3MB8A 4X8OA 1MH1A 5CBKA 1K98A 4TV9B 1FDWA 1BRMA 4AW9A 3PXXA 2NGRA 3KQPA 4PFSA 3KHUA 5HP4A 4LF5B 1USUA 2C61A 3FUWA 4LTMA 2XCLA 3UCEA 3WG9A 4DG8A 5D7NA 1KIAA 2O2CA 3ZNOA 2D3TA 1U6JA 1ESMA 1YZQA 3P32A 3L7AA 1JKXA 3AEQB 3QXXA 3O8QA 1XCLA 1F4VA 1XD9A 4UAUA 5KS2A 1UZAA 4NU6A 4RD4A 4TLAA 1E2NA 3AR2A 4GPAA 3OPMA 5HE8A 3Q10A 2X5JO 3I6MA 1GZ5A 2IW3A 3IDFA 3VKWA 5EKTA 3VJKA 2IHYA 4XZ3A 3G5TA 5GAJA 6PFKA 1V6CA 3EASA 4ESVA 2UUCB 4LF7B 4F1KA 2GFQA 3B3AA 4QDZA 3UT5B 4BIIA 1P81A 3P2MA 4WZ6A 2JIMA 4C3UA 1ZOOA 1SVLA 1JQAA 1D8TA 1X7HA 1JJFA 1NAIA 5D7BA 4B2PA 2EU8A 1J2EA 2YHEA 2PGAA 2FMXA 3GI1A 1YHZA 2OCXA 1JS1X 3H04A 1U3WA 1U7WA 2PQ2A 3TLAA 2JVKA 2NOAA 2O2GA 4AF7A 4HT3B 3AG6A 2ERXA 2G4CA 3KVNA 2YMQA 3PZRA 3KYCA 4HDNA 5FBWB 1SULA 1QTIA 4O6VA 3TNFA 4MVJF 3X1XA 1KERA 4BYMA 4DCNA 2PUEA 5G1NA 3X30A 5AIJA 2AE1A 1LPMA 3GYBA 3KV3O 4OMCA 4RHUA 1Y9AA 2I1QA 2V4MA 4TGLA 5D2CA 1H6AA 1ZHHA 4DW8A 3NVDA 2GN2A 3KFLA 1YR2A 2PUTA 3AXTA 3H8SA 4YJHB 2CWDA 2OO5C 4CJXA 5J40A 5B7GA 4TLCA 1DJMA 4PF1A 3D0QA 4JQOA 1GQOA 2IX3A 3J80A 3IQIX 1MDBA 4HQRA 4LBVA 4DB2A 3JAMA 3QVTA 4PPQA 1XMPA 2H0QA 4O4HF 3SSAA 4Z54A 2G5CA 4F12A 4YJFB 4GWKA 2OXIA 1T5OA 2I65A 2OKCA 2OHGA 3A06A 1Z2EA 3NCTA 2ZSAA 4G37A 4HNAB 1PZGA 4CL3A 1SBNE 2B4YA 1CK4A 2ZUDA 3C5VA 1AK2A 3NKVA 1FQKA 1KYIA 4JBHA 4DOMA 3Q88A 1M2KA 4LRTB 1G8GA 1N6IA 5JRJA 1LWOA 2ZRIA 3Q11A 4O4LA 4KLAA 2BGUA 2RH9B 2VKQA 3UJPA 5ECWA 1WIWA 2WNIA 5HF9A 3U3JA 1RWWA 3CINA 3R5FA 1YRYE 2WT8A 4HAYA 3MAAC 3DBRB 4RVHA 4WLOA 5EXEA 3V46A 4A0QA 3LBIA 5ISMA 1TQHA 4A92A 4NV3A 3AHGA 4OXIA 4NEQA 4QTXA 4TMZA 1W36C 4UM8B 2GNAA 2OCGA 4ND8A 4S04A 3TRIA 4U63A 1C0IA 4UM9D 2PGIA 4ATNA 3Q85A 3VDMA 3F4LA 2V98A 2G3YA 4UE3S 4INAA 1PTKA 3L9WA 2WD9A 3TIVA 2FF7A 3F2VA 3TDMA 4IIXA 2ZI9A 1T0UA 4WFKA 5FV4A 3G7SA 4YCAA 3KU4A 4IGKA 4NDZA 3WGIA 1ZIOA 1IN8A 3KOOA 2R4UA 3EZLA 3ZTWA 1CS4C 5DTIA 4GC5A 1CF2O 4A91A 4PYJA 5D3MB 4UU0A 1R6BX 3JD3A 2A7XA 4A03A 2JLWA 4HATA 3EIQA 1G98A 3BBPA 3PFIA 4L6AA 3OQJA 2WMYA 4L3VA 4R68A 1VP3A 4UMVA 3QX7A 3RODA 5LQAA 1RPNA 1PK8A 4Y6GB 3N2NA 3UV6A 5TGTA 4QDTA 3GGDA 2AJDA 3VVBA 3VJMA 1QV7A 1V3VA 1WMBA 5BUCA 1QQ7A 3PEWA 1CTQA 4ZTUB 1VMKA 2RAPA 3IBSA 4WECA 4UTPA 2YICA 2F55A 2O7RA 4PRLA 3CNLA 1QDLB 3EVNA 1CB0A 4U5XA 3TZCA 4EY4A 2CNBA 3AL2A 4W4TA 3NHRA 1YCFA 2TMDA 2C4KA 3OJEA 3EOZA 3HC7A 4BO0A 5FEMA 3CF0A 4KR6A 1UWVA 3L8EA 2XEXA 3DAPA 4IOMA 4IHJF 5L9AA 3KD3A 2AEEA 3ET5A 2XF8A 2VSFA 4ED9A 3JQ9C 3K6RA 3OCUA 4JA0A 3QWFA 1E61A 3NBMA 4M8LA 4YDRA 1U8UA 3BJRA 3SVTA 1L7RA 2PNFA 2VHQA 3R2JA 2JATA 2Q3LA 1E62A 2E18A 2ZB2A 3JVDA 3W5BA 3C24A 1T4CB 2EZ9A 1O57A 4S1NA 4OP3A 2CE2X 3GAAA 3GB9A 5BT9A 5SY6A 5IS2A 3ICPA 4MI3A 5D6NA 1CVRA 1NMSA 2QN8A 3BH6A 3LFUA 2YY6A 4LISA 1Q0HA 4LDAA 2VNAA 2NO7A 2QL6A 2GYWA 4H4EA 2QSYA 3L3BA 2N9UA 1G3UA 1WP9A 2C4UA 2NADA 1PUJA 2HDWA 2RH8A 4M8NE 4V0ME 4V0QA 1QB8A 5AI9A 4C05A 4YUYA 3A1UA 3G0IA 3HEBA 1AIPA 2B30A 2OXCA 4JEIA 4MR7A 4X7BA 1KMHA 4XSHA 5CJ2A 5LYYA 3AUSA 1V8OA 4RK1A 4QRIA 1DKLA 1DT5A 1DLJA 1P5FA 1XCOA 3NWEA 4LFAB 2WYMC 3EW7A 4EG8A 3OTWA 1YQDA 2H5JA 5H81A 1UQUA 3M4XA 4KXXA 4MRPA 4EB8A 3VR1A 2W6OA 4OB7A 3EZGA 2AZDA 2Q5LA 4L5CA 3CT4A 2HXYA 1WX1A 1MC8A 3AUAA 4BB0A 5K3SA 1O96A 1FDOA 4Z9YA 1OLSA 4KWEA 5DMXA 3JQ8A 4I7EA 1VPLA 1M34B 4CQMA 3BGWA 3N2EA 3OFKA 2ZXUA 5A3JA 5ICMA 2YNWA 4B3RB 1WW1A 1OU4A 3VO1A 1X8XA 5EWLA 2RJOA 3G7UA 3RS7A 4KAJA 3NHMA 2AR9A 3RSLA 3TMAA 3DBIA 1DTWB 2WKPA 3AV0B 3I8XA 2WUEA 2HLNA 4G5RA 1TUGA 5FBZA 1AB6A 4FFVA 3G2HA 3R7AA 1YBFA 4UD6A 2NPOA 3JWIA 2DC1A 2YVUA 2ZJ2A 2IWHA 5BSFA 4WLFA 3SWWA 3KDSE 2IBTA 2VYQA 1SXGA 3EQ2A 4C01A 2B83A 5JCZA 3IUSA 4GPD1 4LY6A 3LXXA 4J4HA 1US8A 3I4LA 4QT0A 4PANA 4YCCA 3A27A 4FNOA 1N5JA 1V8FA 1XAGA 2JB9A 1W1IA 4J0IA 5DHTA 4YMHA 1OB5A 1O54A 1U7TA 3DM5A 3FNFA 1YR3A 2Z98A 3DL0A 2WVHA 2PL5A 2R8RA 5HFJA 4RM2A 2RGGA 1VRWA 3F8WA 4K40A 5U4QA 3QZUA 3T06B 5BR7A 3O21A 3CFYA 3WO0A 5KNBA 5JY6A 2OV3A 3DMNA 3IOEA 5YASA 3U2QA 2SCUB 2ZTVA 4D7AA 3WQBA 4EHFA 1W1WA 3N2GB 1BGXT 1QG2A 3FIUA 4G56A 5F35A 2P2DA 5I45A 1JXOA 2PGJA 4P3YA 4IJ6A 4D4HA 2PV7A 4RETA 4F38A 1YRAA 3UMBA 5AVRA 1NULA 1YV9A 1O9HA 2INGX 2V7GA 3EZ9A 4ZAZA 1J4AA 3KAJA 3OCYA 5EWJB 1NBME 1YUMA 3VQTA 1WLYA 3K1TA 2FSVA 3QPAA 3JQRA 4UCFA 1UQRA 3I64A 4A23A 5E6RA 3VA7A 3L77A 3JQ7B 3U4QB 1IUOA 2G8LA 1ESNA 4FBGA 2VIIA 4K5QA 4JBNA 1UXGA 2P0EA 5AXDA 4D6XA 1GQSA 3UHFA 1Q7GA 1X1EA 2G36A 2FX2A 4CV2A 3WDSA 4EG5A 5FOUA 1JA0A 2VXCA 4BVJA 5A6VA 5KX5B 4E5NA 2YWCA 2P1RA 3Q6IA 5CYOA 2BR3A 2OLEA 1RRMA 2P30A 3O8DA 1NAHA 3E1SA 4NIMA 4R1LA 5CVJA 1GFZA 1W34A 4BMNA 3BXEA 3PJDA 3ZWBA 3F98A 1Q0RA 1Q3KA 3DP9A 2C7VA 1NJGA 3F46A 2J7KA 4NRDA 2EFJA 2XTNA 3PX2A 4O2BF 3FOEC 4MV3A 1D4AA 5LLDA 1Z45A 2HLPA 3O9VA 1XZCA 4QJIA 4R1TA 4ALMA 1U6KA 1QZZA 5DCWA 1ISMA 3GA5A 4QULA 5EA2A 1XRJA 5CCXA 2E87A 2OCDA 5KTTA 3I2FA 3TOSA 4QM7A 5IYZA 4OQEA 1MAHA 1YZGA 2NZWA 1ES9A 3CZCA 2FN7A 3UAOA 4KSYA 2J9FA 2XA9A 3BHMA 3KL2A 4PSCA 8AT1A 2I76A 3JRXA 3HYLA 1N2IA 1P3Y1 2VJMA 4AD9A 3LX8A 4Q9DA 2QZPA 3KOUA 4ZMSA 3IKMB 1U0JA 2PLRA 4YB8A 3N3BC 4NQ2A 1X8IA 3QEAZ 2NV0A 1SC6A 3O8QB 2PMBA 5KX5A 4J90A 4OJQA 4ZT2A 2BGRA 2QYTA 1DBIA 3DLTA 2YMLA 2ZJ7A 1ARZA 3E9EA 4PBTA 5EC8A 4UJ5A 4DG5A 4ZEVA 3NBZC 4E6EA 3P9ZA 1Q0TA 1XKQA 1PQUA 1Y5IA 2JI9A 4I8DA 3IHWA 3URKA 1P4AA 4D4IA 2QE6A 3QIVA 1EDBA 1CBUA 1QBGA 3PYMA 3AJRA 4RTJA 2BEUA 2WE7A 1H3NA 3A4TA 2LD4A 3DKRA 1I1QB 2FP4A 4H17A 4LE2A 4HDNB 4ITRC 3SZMA 4D2IA 1VG0B 4F6RB 4KNVA 3ORSA 3GJ8A 4MQ5A 3T3GA 2IPMA 5H9WA 4XFDA 1TTHA 1W30A 3ACCA 3ZJ5A 4RJJA 3V8VA 1X42A 5EV8A 2RI0A 2I6FA 1S2LA 2FM6A 5LE1A 3QPVA 2GPAA 4RLFA 1YZKA 5KTPA 5HUHA 1JFVA 4B5LA 3JQGA 4HQNA 4XUKA 1U3DA 2R62A 4NEHB 1K8QA 1VHDA 2XMBA 4UTNA 3W6NA 1YS7A 1WJGA 4KBFA 3DVRX 1C9NA 1SU8A 3MYYA 3OC6A 3IHKA 4EFNA 3J7TA 3BUSA 3QVVA 2FZ5A 3O2NA 4JKIA 3G5LA 1NPDA 3PIRA 3R0JA 4LYFA 3OZWA 2LCQA 3HV2A 1M0TA 4F04A 4IWYA 2ZOSA 3QG1A 4BZPA 4C21A 4EF5A 2HQSA 4A8TA 1WQ3A 4ZARA 1BWQA 1MIOA 2IQ5A 5IC4A 1HRDA 5BSMA 3K53A 4PWZA 2DOOA 2C4TA 3BXFA 1USGA 4MP3A 4O4LB 3WGGA 2XZOA 2ZJZA 3E03A 4J7CA 4MUKA 3HCWA 4UBNA 1XFAA 4YACA 4ZVNA 3T9EA 1XHLA 3TD6A 5K20A 3V7WA 1RXWA 3CNNA 3N59A 1KVUA 3L7LA 4V3CA 4QZVA 3DT6A 4LOIA 3L7KA 3TMKA 4OHCA 4UTVA 5EVBA 1TYDE 1VTKA 2J5QA 4QG7A 3EISA 4B83A 1QPZA 3S0JA 4BTEA 4WA7A 2HJRA 4ND8B 1R4ZA 2QN3A 4PS1A 5BVHA 3MJFA 4YN3A 2AJCA 2I4LA 2QXUA 2D0DA 2HCJB 3V5NA 3V4OA 4CM9D 2ZULA 4R3NA 4X3PA 4OHZA 4ZJYA 2PIAA 4DEVA 2G9RA 5AKZA 4QDJA 2EL7A 3BRCA 3H9QA 4BVEA 2VO1A 4XD2A 2QGZA 2BTOA 1LRKA 1UBEA 1AXEA 1QOPB 1WL8A 2HEGA 5DNVA 2FZLA 4HLDA 2X0KA 3QEBZ 4QDUA 1YB4A 3DG9A 4TYQA 1SXJE 3TXAA 4AJKA 2CD7A 1QMGA 2COKA 4HPWA 3SBXA 1JHAA 4IEIA 4ZVTA 1D2GA 4M55A 2PQ6A 3P4XA 1KARA 5AXCA 2HWKA 4QO7A 2VJAA 3GJRA 3EIEA 3SBEA 4YRIA 3WXCA 3G17A 4A4DA 2B98A 1VI6A 2ZBRA 3MTDA 3DMHA 3GUCA 4OA8A 1KI8A 2VJQA 4UFPA 2FI1A 5DXJA 2YUIA 2J8ZA 1U04A 5DM4A 4KR0A 4BO7A 3IPCA 2QVGA 4EYGA 3FUTA 3HBAA 2EIXA 4MJ7A 4D3ZA 3HJUA 4O08A 2QRKA 3CX6A 3GMSA 5AK5A 2H4WA 1T8WA 4D8UA 3L8FA 1O94A 2JFUA 1EUDA 3TBHA 1GU7A 2WZDA 3O1LA 4M3NA 4HB2A 2HNAA 4MHOA 3D1LA 4Q7MB 4EJSB 2HMWA 5CLJA 2HB9A 4IS3A 3I5AA 3RIYA 4ZODA 1HMPA 4FFMA 1ACMA 1L4LA 3R7BA 5CLGA 1EVZA 4MCHA 1WTCA 4BLTA 2AQHA 3GDHA 3O92A 4LXXA 4ALLA 3G68A 3LDAA 1ATIA 4JAVC 1Y4UA 3NBQA 5SYMA 4NLLA 3U3XA 2FN9A 1VLZA 4MUYA 1LNSA 1KYXA 1O9GA 3AR8A 4JOCA 5F3RA 1IOLA 4ZCPA 1EE1A 1IPFA 4ETNA 5C37A 1BXKA 1TKRA 4IRUB 1Z56C 4QYXA 3UAVA 3WK4A 5HZGA 8LDHA 3UXYA 2A0XA 1N5OX 3ONDA 4JJ6A 1S3IA 2XW6A 4E0BA 1ULAA 1NHWA 2R5FA 3NP9A 4LWZA 1U7HA 1SN7A 5AIAA 2POQX 4EYKA 1AA9A 2VH2A 4NNPA 4M4SA 2H9AA 4EAQA 1K6IA 1NRXA 2O8FA 4MPTA 2FLWA 2YN0A 1KMNA 4HQKA 4DCMA 4ND3A 1WA5A 4NV0A 1UWLA 1ISHA 3K9CA 2ECOA 3QFRA 4MR7B 1P0FA 1KMHB 2E48A 2QXTA 2WVGA 3OM8A 1H65A 2RH4A 4KMRA 2WYLA 2E4XA 4AD8A 4HEHA 4U9UA 1ADYA 1CY6A 1EXWA 1QVVA 3CLSD 4DCGA 5ULLA 4N9WA 1L7BA 2PD3A 2XUQA 3IJ5A 1EFUA 1QFJA 4FHEA 3RHFA 2W8ZA 4Z0PA 1JA1A 2WU8A 2QUJA 3GGSA 1MHPA 3EC7A 4JJAA 1N32B 1SCBA 3RK1A 1R9GA 1FTNA 2YJGA 1O96B 1P5RA 1X2EA 4B7AA 1OLSB 3PC4A 1YDMA 3SHOA 2CY0A 2X86A 3JQ8B 4JL5A 5LZ4A 3WA7A 4CQMB 1J33A 4YJ2F 2P90A 4M6WA 5TF4A 1S0UA 1DBSA 2HRZA 2HNBA 2J67A 1H93A 1O5TA 3HYRA 1P3DA 3PRHA 1T8TA 2DG2A 1UP6A 1D0SA 4PY2A 4ZRMA 1PK9A 2ZRDA 5EWLB 2AIRA 4DSTA 3Q5EA 4IR7A 2ZUFA 4UUPA 1W8IA 1AV7A 1BMFA 3M89A 4EO7A 3HHEA 4O8ZA 5HG0A 1IATA 3AY7A 3O9ZA 4FQ7A 4G0MA 3PWSA 4TMKA 3S8MA 1EWQA 1EQUA 5JDIA 3ICCA 1MO3A 3UB2A 2YN4A 3I28A 4ZNBA 3DFKA 4DLTA 4DV1B 1LS6A 1M2EA 1QV9A 1UMCA 3AHFA 1N2EA 1Z15A 2W6IA 5DHRA 9MHTA 1D7AA 1G5HA 1US8B 2CXOA 1QH0A 1FYDA 3KPYA 3O75A 4U6SA 5CM2Z 4NCBA 4F9GA 1JHYA 2R1ZA 3LY9A 4AS3A 1PVOA 3MCVA 3RIHA 3ZY5A 5HKKD 2Z2IA 4JI3B 4CKYA 2VDUE 3EWSA 2ZZMA 5FA6A 4GOND 1PIWA 4ZVLA 4D45A 5L4NA 5H3HA 1EGQA 1P0PA 4K3UA 4JKOA 4OATA 1YUBA 4Q24A 3VISA 3OCXA 3TS1A 4NU8X 3W2EA 1VL8A 2QR2A 2VDRB 2PX2A 3TUJC 1N6RA 1JSXA 1ONBA 2GBGA 4TL8A 1AN9A 2B35A 4LRXA 2MSCB 1MW9X 3Q3IA 1R3UA 4OLFA 1E3IA 1K2WA 1XTBA 1NT2A 1RTKA 4XSGA 5BV2P 2C2KA 4ETMA 1KI2A 3EEBA 1A9TA 2ZZIA 2C42A 2QPTA 1PEKE 1SU7A 1VLVA 5E6RB 4DDKA 4M1WA 5BOVA 1F5SA 5EY5B 1YJ8A 4V39A 3ZS9A 1KWKA 4YC7A 2I6SA 4DLBA 4QTYA 5AVWA 2BUCA 1EGVB 5IT4A 3NT2A 1EP9A 4Z0TA 2E6UX 1N5LA 3N0WA 5IAGA 3L8GA 3VPFA 2K2WA 3ZHCA 1XJCA 4OYLA 3IX7A 4QNNA 1P2GA 1ECPA 1DCMA 2BUBA 2GN1A 3K6KA 2ODWA 5ALDA 1F2VA 1FU4A 1W2WB 3W8DA 2WFMA 3RWOA 3JD4A 3LX4A 4HP8A 4GLOA 3H5AA 1QRDA 3TQQA 5A5FA 4BQNA 5ALVA 5JR3A 3T3NA 2YVLA 3N2ZB 3KOZA 3VAZA 1QRTA 2OWEA 2OUKA 3E5NA 4N39A 3ZHSA 3LU1A 1BGWA 2DH5A 2J3EA 2F3RA 4IQGA 4WA8A 4X41A 5I7AA 2F4VB 1NBMD 4RXUA 5PNTA 5IYZB 3RPCA 1PAUA 3U9SA 4R8LA 1TW2A 1G6OA 4LJKA 2D8AA 4MXDA 1K92A 2P6NA 1XF1A 4HAUA 2J9FB 1OI2A 2FWPA 2HSWA 4Y2GA 3L5OA 5IU6A 1T15A 1VCHA 3RS3A 4CKWA 2VJMB 2EQBA 3LTEA 4KO2S 2WWHA 3RTGA 5D6OA 1YGPA 4CIXA 1QGYA 2PXCA 4OP1A 1XRPA 2VKTA 1W6RA 3K9QO 4B8WA 1UMDA 2D0IA 3B52X 4J0CA 1FVFA 4QASA 4ZI7A 5JVDA 3PHJA 4M53A 3DMFA 4OGKA 4DQXA 2BFMA 4POOA 4CMBA 2FRDC 1U98A 4Q1VA 1AS3A 1MVLA 5EWMA 4MKRA 1BWPA 3OIYA 4XIJA 2QOEA 3A1DA 4GSKA 2HL6A 4JNKA 5EHNA 4DQVA 5JZVA 3EVTA 3AF4A 4MZXA 1MCZA 2H29A 3QOXA 3AFHA 2BEUB 3LHSA 4ND2A 1MEOA 3GCGA 3C15C 2HMAA 2NACA 2ZYUX 2DBQA 2FP4B 1XSEA 2E4VA 4BJ3A 1AXRA 3NXSA 1ZOPA 1XQ9A 3K4QA 1EUQA 3HVRA 4EL5A 2PGOA