1E5DA

Rubredoxin oxygen:oxidoreductase (roo) from anaerobe desulfovibrio gigas
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
401
structure length
401
Chain Sequence
QATKIIDGFHLVGAIDWNSRDFHGYTLSPMGTTYNAYLVEDEKTTLFDTVKAEYKGELLCGIASVIDPKKIDYLVIQHLELDHAGALPALIEACQPEKIFTSSLGQKAMESHFHYKDWPVQVVKHGETLSLGKRTVTFYETRMLHWPDSMVSWFADEKVLISNDIFGQNIAASERFSDQIPVHTLERAMREYYANIVNPYAPQTLKAIETLVGAGVAPEFICPDHGVIFRGADQCTFAVQKYVEYAEQKPTNKVVIFYDSMWHSTEKMARVLAESFRDEGCTVKLMWCKACHHSQIMSEISDAGAVIVGSPTHNNGILPYVAGTLQYIKGLRPQNKIGGAFGSFGWSGESTKVLAEWLTGMGFDMPATPVKVKNVPTHADYEQLKTMAQTIARALKAKLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUBREDOXIN\:OXYGEN OXIDOREDUCTASE
publication title Structure of a Dioxygen Reduction Enzyme from Desulfovibrio Gigas
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 145
structure length 401
sequence length 401
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1e5dA01
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1e5dA02
4UBQA 5ULLA 3K1YA 5A87A 4XWTA 2Y87A 3T9MA 1KO2A 1T0IA 4NQ5A 4YSLA 3HR4A 2FX2A 2FHXA 4N82A 4NQ4A 4AX0B 4D1UA 1FLVA 3X30A 4DY4A 5IQKA 1D4AA 4N9QA 1WRAA 4C1FA 1CZLA 5EWAA 2YNVA 1ZWKA 2HPVA 2RG1A 4ZNBA 3TEMA 3LT5A 1J8QA 2FZVA 4C1DA 2AIOA 5ACQA 3VPEA 2P4ZA 5HISA 3OJXA 4NQ2A 1FLAA 2GFJA 3JXPA 4TYFA 3B6KA 1HLKA 4QOEA 2YNTA 3PY6A 4QOJA 1AKUA 2P97A 3SVLA 3FCZA 1I1OA 1WUOA 1XYVA 2Q62A 5BUCA 2FAXA 3W79A 4FSBA 4XDHA 3TE7A 1J9ZA 2V5VA 3KNRA 4HL1A 2OYSA 3SBLA 4Y9UA 3I15A 5LM6A 5B1UA 4BP0A 1YCFA 3F6SA 4TZBA 4NLLA 1YCGA 3TP9A 1QBGA 3SW3A 4EXSA 2Q0JA 1DXKA 3GFQA 3DHBA 1ZNBA 3I13A 2BF4A 2YNVB 2NZEA 4LE6A 3W78A 1A7TA 1QHEA 4AWYB 2FDXA 2Z9CA 1TIKA 3T3NA 3T3OA 1QR2A 4FR7A 3IE0A 2WRSA 1QRDA 3KAPA 4U4LA 3L9WA 4P62A 3TZBA 1VGNA 2BR6A 2FK6A 3OX1A 3NHFA 3GFRA 5HIPA 1KBQA 3N39C 2YNTB 1XYYA 4S24A 1E5DA 1X8GA 5K4NA 1CZNA 4D02A 2MOKA 4ZVNA 4BZ3A 5LBTA 4LAFA 4YALA 4GI5A 4EYFA 2BMVA 4WD6A 2Q42A 4RL0A 5K4MA 1OBVA 5EH9A 3SFPA 3SD9A 2FVXA 1V4BA 3NHRA 2I7TA 5LLDA 3JSXA 3UXHA 1P9EA 5AYAA 4H2DA 3I14A 6NULA 5LE1A 4CETA 5F4BA 3GFSA 2QX9A 4YAUA 4Z67A 3G5MA 4TYTA 5JROA 3BK1A 3RKJA 5EV6A 3D7NA 4KEPA 2YZ3A 2M5DA 1H69A 2GSWA 3EDOA 3NHUA 2BC2A 1KO3A 1Y44A 3GAMA 3U7RA 4V0HA 3ESHA 2E7YA 5EV8A 4D1TA 5ACWA 2N1MA 5LJIA 3FAIA 3NHYA 4EY2A 1BMCA 5LCHA 3LVZA 1SMLA 1TLLA 1AKRA 4F6ZA 3KL7A 3N3BC 4C0WA 3FJOA 3R2UA 5EAIA 3WXCA 2AZ4A 4D1VA 3FNIA 1JA1A 2FZ5A 1ZTCA 4TZFA 4Z6XA 4ZO3A 1K07A 3BC2A 4QOIA 2B3DA 2MT9A 2WYMA 3P0RA 3OX3A 4Y7CA 1CZOA 3AJ3A 4FGLA 2BFLA 2I7VA 4HKYA 1AKQA 5B3LA 2X2OA 4C14A 3IOGA 4LTMA 2HNAA 1YKGA 1CZHA 2QINA 3S2YA 4C1CA 4AWZA 3IE1A 2DOOA 2Z9BA 1AHNA 1BU5A 5A4KA 5K4KA 4LA4A 3OX2A 4Z7RA 3OWXA 2BTNA 1DD6A 4TZ9A 5FQCA 3KEGA 4F6HA 3O2NA 2ZZIA 5LCAA 5TGZA 4N65A 3HLYA 2Y8AA 1RLJA 2BG7A 1DX9A 4ZVMA 2F1OA 4LTNA 2R96A 5EA2A 3MD7A 1XT6A 4YSBA 5EVKA 5ACTA 3F2VA 2M6RA 1BVTA 3IEKA 2YCBA 3FW1A 1RCFA 2MTBA 1KBOA 2BIBA 2ZWRA 3B6MA 4H6PA 1L9YA 2BG8A 1RLIA 3Q6VA 4U7HA 1KR3A 4QOHA 2ZKIA 3NHKA 5A5ZA 3R6WA 2BN4A 3H3EA 3W7AA 3NHJA 4GYQA 1J9EA 1SG0A 3A4YA 5B15A 2WYLA 2FM6A 3U7IA 2D5IA 1BVYF 2QJSA 1JA0A 5NULA 2NZFA 3IELA 4U7GA 1YOBA 1FX1A 5FQBA 4EYBA 3DHAA 1JJTA 3RPCA 3FVWA 3W77A 3KNSA 2BMIA 2AMJA 1VMEA 4AD9A 4UWRB 5ACPA 3ESYA 1JJEA 2YNWA 3IDZA 2BFKA 3ESZA 2BGAA 5NLLA 4EFZA 2Y8BA 5B3KA 4HS4A 2ZNBA 2Z98A 3NHPA 1WUPA 4CHLA 1WSBA 4YSKA 5KILA 3ZWFA 2FLVA 1AMOA 3OJWA 2Q9UA 3SPUA 3F6RA 1SQSA 5LMCA 4D1WA 3B6IA 5FA6A 2XR1A 3PY5A 3DH8A 3QFRA 5AEBA 1GG5A 2V5UA 3L9XA 2QMYA 3FX2A 3OVMA 3QE2A 2BG2A 2GKLA 3ZQ4A 3ZHOA 4Z5YA 2OHJA 5HIOA 4C1HA 4RBSA 5AXRA 3ADRA 2QX8A 4FGKA 4UWSB 5ACVA 3IEMA 1VJNA 2BFZB 2BG8B 4NULA 3P2UA 1D03A 4KEQA 3EYWA 4XUKA 5LCFA 1AZLA 4YAWA 3F9OA 2QEDA 2M5CA 4GQIA 2P1EA 2QMZA 2ZO4A 2QWXA 1DDKA 3BK2A 1X8IA 2QDTA 2Q0IA 3NHWA 1ZWLA 2QX6A 3NHLA 3X2ZA 3L6NA 5DPXA 3KLBA 5FX2A 3I11A 1DXQA 2P18A 5ACSA 3LCMA 3X2XA 5HH6A 1XI2A 4J5FA 3ES9A 1FUEA 5EVBA 5LSCA 4NQ6A 3K20A 2XOEA 4QODA 4U7FA 3SRXA 5A0TA 5FQAA 1J9GA 1CZRA 4ZVLA 1T5BA 1AKWA 3F90A 5B3RA 1ZX1A 5EVDA 2YNUA 4HL2A 3N3AC 4O98A 2NYPA 4OXXA 2QX4A 1C7FA 4QOFA 2FU7A 3B6JA 3NFRA 5LJLA 5F12A 2XF4A 4JO0A 4RL2A 3I0VA 2CBNA 1NNI1 3ESXA 2QDSA 2WYMC 3QFCA 2OHHA 4XDGA 4R81A 2W5UA 3RKKA 1YRHA 3X2YA 2V9CA 2X2PA 4RAWA 2BG6A 4GCWA 1ZKPA 4GYUA 2M6SA 4YAOA 4TZEA 5AHRA 1AG9A 4RM5A 1CZUA 2QR2A 2FOXA 5LVAA 5HH5A 4FGJA 4PTZA 5KIKA 4UWPB 5HH4A 2XODA 3AF5A 4ESEA 4UAMA 1MQOA 2FCRA 3IOFA 3PG4A 2BFZA 1H66A 3ZR9A 4M0CA 2HNBA 4C09A 1OBOA 3HA2A 4C1GA 4ZO2A 1OFVA 1D04A 4YAFA 1WSWA 2KLBA 2GMNA 5EMNA 1DXOA 4C1EA 3KAQA 2BPOA 5LBUA 2BZSA 4QOGA 4GR9A 5AXOA 2FU8A 4PVOA 4F8YA 2OHIA 1CZKA 4UA4A 1FLDA 2DKFA 3G1PA 5AHOA 1F4PA 2FHXB 2WHGA 3DHCA 5LS3A 1RTTA 4DIKA 1AKTA 5ACRA 3BV6A 1XM8A 5EHTA 3OWHA 2GFKA 3O73A 2Z9DA 4EXYA 1B1CA 1C7EA 4B87A 1FLNA 4EYLA 4J8PA 1XTOA 4PU0A 3S0ZA 3VQZA 2FU9A 4ZVKA 4PTYA 4Z5ZA 3IE2A 4FEKA 5ACUA 1M2XA 2HB9A 2WC1A 4LTDA 4Z60A 4J5HA 5K0WA 4ZEJA 1X77A 1AKVA 4YQEA 4ICIA 1YCHA 4PVTA 1X8HA 5F51A 2GCUA 4FX2A 1BC2A 4BMPB 1QH5A 1FVXA 2ARKA 4RAMA 2R97A 2A5LA 4XWWA 3NHSA 5FUQA 1WW1A 4H0DA 3NLLA 4HEQA 3QH8A 2UYXA 4AX1B 1YDGA 4C0XA 3UXEA 1JT1A 4DILA 2FU6A 3ZNBA 5A0VA 2A7MA 5EW0A 4Y9RA 2H6AA 5HIQA 4BMOB 4CF6A 1FTGA 2MWMA 1A8TA 4UWOB 5ACXA 4C76A 1QH3A 2KQUA 3AF6A 3RPEA 2R2DA 2VW8A 2NXAA 2I7XA
chains in the Genus database with same CATH superfamily
5K0JA 1ZNXA 2A4KA 1RKBA 3ZJTA 2JI7A 4Z4IA 1M9NA 2A14A 3LUFA 3R1IA 2HWKA 5DU2A 1L7QA 4J03A 2LUOA 3K35A 5TF0A 1KQNA 5A87A 4II2A 3A1SA 5JRJA 1E2KA 3IAEA 3QY0A 3UCEA 3WTCA 4JV5B 2C3OA 2QY6A 3LXUX 3OZEA 4C29A 3FUVA 1EE2A 3RQSA 1FU8A 3FJYA 3LCJA 3PC4A 3S7TA 4HGNA 2WJHA 5ALWA 5K3FA 1VJTA 2B1JA 2Q6LA 1TMOA 1OYOA 4TLEA 4TKUB 2BR4A 1TU4A 1WXGA 4GP9A 4NOMA 1A7JA 4XIGS 3CRQA 1YH3A 1BYIA 1E79A 1DQRA 1CQJB 2BP7B 3EH2A 3F1KA 4TMFA 3UTCA 3FF4A 3GNQA 3RF7A 3R5HA 1BXGA 2XQVA 3RS9A 4IJKA 2WHEA 4EG3A 2C7QA 2DP4E 3IO5A 1LPBB 3AQIA 4HNRA 3FETA 4M0EA 1FMLA 2QPAA 5FORA 4GECA 3PUZA 5G53C 2VT2A 4CIWA 1PJ2A 2QEQA 2OOKA 2B8NA 4GWLA 3NHMA 2NXEA 4JT9A 4UMDA 4F3RA 2PVPA 1T3LA 5IXSA 1G1AA 3UT5A 3IB3A 4E2YA 3RGWS 5DB4A 3ZWQA 3HCPA 4KSYA 3FPKA 1IEVA 4E03A 3JALB 2HFJA 3RKUA 4QGSA 4PRKA 1RQ7A 3UJ3X 3FDJA 1VHDA 4Z8XA 4R71A 4OQMA 1QMGA 2VDJA 4MH0R 4I8XA 4EK9A 2EZ4A 2VWHA 3CLUD 1NR1A 2RK6A 4FHZA 5DX0A 5IJAA 5TEWA 3T61A 3V4LA 2Q5IA 1ZOIA 1V35A 4MZDA 4R3WA 4LDNA 5B2FA 5IVPA 3H5OA 3ZD7A 4KZKA 1HYHA 3TUZC 5ITVA 5FPKA 1E6MA 5LKAA 3LUGA 1UIRA 5KMGA 1NKVA 1GPKA 2XUJA 1PT9A 3SLKA 2VT3A 3C5CA 4A23A 2SICE 1J9ZA 1ORIA 2P77A 1UPBA 1E2IA 4B3CA 1AY0A 1WO8A 5A1TA 3TLMA 4EL5A 3R7NA 1F3OA 1LDGA 1PLKA 1UBEA 2FPUA 3CLRC 5J4HA 4G5RA 2ZYUX 3I05A 4P3OA 8ADHA 3M1IA 5GZ1A 3D4LA 5LM6A 1SXJC 3QUAA 4M1TA 4Q02A 1YCFA 2A3NA 5J59A 2W2XA 5IABA 3WRXA 1EFTA 2O7SA 1NTRA 2ATEA 2JIOA 3V2HA 3ZD9A 1KGSA 3HJBA 1R66A 3FH0A 4CM9D 4DREA 5ALJA 1OAAA 2Z6AA 2CHVA 1O5TA 1XKLA 3A9VA 3LT0A 1N34B 1WKBA 1KJ8A 4RTQA 1KYWA 2IOHA 2VTBA 2XHZA 4XWOA 3TKLA 2RGDA 3FUWA 1NMZA 3I45A 2QSUA 2ZUTA 5C37A 5DWVA 5JDIC 1PNQA 1T6YA 4P62A 4L1KA 1O0SA 1EXVA 4PR3A 2QN3A 5DASA 3TFOA 3OX1A 1EEHA 4KDFA 2JIRA 3URKA 1WBJB 1S2MA 3V4PB 3W7VA 3AHJA 3B9BA 3X1YA 4EKEA 3QUSA 4YJDA 4LVNA 4CIYA 5CA0B 1CZNA 1R6AA 4R8MA 4RE5A 4TWRA 4L9WA 3AETB 2AFIE 1H1LA 2QTMA 4E4TA 2ISQA 1KMHB 3UJAA 3JQ7B 1TM1E 3TL3A 4A1FA 1QMPA 2AKEA 2VJCA 3K9FC 1DIOB 1ZP6A 3FD8A 1TK3A 2IKQA 5EH9A 3A4IA 3TW0A 4F45A 1Y8QB 5FPHA 5IANA 1DCTA 3CMMA 3B1KA 5EIFA 2I2WA 5C7LO 4NRDA 5HXAA 2WJ3A 2WBLC 2G8NA 3LQFA 3GCDA 2JKZA 4LZJA 1M8PA 2AN1A 2OUKA 2V9PA 5KYWB 3QYPA 4KEPA 2W83A 1KAGA 2VP5A 1LDNA 3A4VA 3D1VA 4MGKR 3ZVRA 4TLDA 2QHXA 2WJ4A 3V42A 4CLOB 2QUAA 2ZDQA 3K1ZA 4FOPA 5CX1B 4YHHB 1BKDR 1Y9JA 3ZY4A 2CZGA 1ULZA 4EJ0A 4ZVUA 4J0JA 2W6JA 3LDGA 1Z0UA 5B58T 2QDXA 1Y8CA 3HFGA 4KWCA 4HDRA 1ULTA 2J67A 9LDBA 2C03A 2G40A 4Z1MD 3BT7A 2Q45A 1D6JA 2JAOA 2Q8NA 3G5AA 3OSZA 2PZEA 4IG4A 4KPGA 2FHSA 4ES6A 3SICE 3O9ZA 4J16A 3W5VA 1TFRA 3S2SA 4FYXA 2GF0A 2HIAA 3IAM6 4M8KA 4WBNF 1LQ2A 3DCYA 4BV2A 2VYND 5L7WA 2DBRA 4FZ3A 1FBTA 3S40A 5F33A 4JLNA 2V3WA 1Z9BA 2B4RO 2QNIA 3AHGA 4FFDA 3QF7A 4YFVA 3KLMX 4E15A 4M0KA 3U0VA 3DV9A 4HQNA 3HBJA 4YMTA 3BPSA 2PJZA 2AUNA 1QLJA 3PX7A 1NXXA 2W4QA 4WOJA 4DWVA 5EIAA 3A1EA 4FDVA 2V98A 4H6WA 5DOZA 2GRJA 3M5DA 4AJKA 4ZIRA 1IBKB 1W44A 1QS0A 1MU0A 1JR2A 2H31A 4FGLA 1A3CA 2RGWA 2P4UA 4LIPD 4P81A 4AX4A 1BN6A 2R8RA 3BZUA 3R77A 4R8RA 1MB4A 4L9RA 5P8WA 3KRTA 3U48A 4LY6A 4DMKA 4EDFA 4CEHB 3NMUF 1RPTA 4MI3A 4L8FA 4A9AA 3B13B 3LMKA 4HEHA 4JYZA 1SUSA 1Z62A 2ZJZA 1E3MA 4N0PA 5I3CA 3BF8A 4TL9A 2ACWA 3OD1A 3OX2A 4F38A 1C9NA 3ZTWA 2BTNA 4PC7A 1H5UA 4ZPJA 4XYMA 5TX7A 1Y33E 1QGYA 1TIBA 3ENWA 4JQOA 4QJIA 2V8OA 3TUJC 4G63A 2BH2A 1TTPB 1ZH4A 1VTKA 3FTPA 4XRRA 1M34B 2J6IA 2Y3IA 3NG1A 4N65A 1CS0A 4DCVA 1J8MF 1KSGA 1X2BA 1B0PA 3FR7A 4UMFA 3SSNA 4BPBA 1JQDA 3LHFA 1KTVA 2P67A 5AJTA 5DYTA 1Z2DA 3HP1A 4MV6A 5HF5A 2FWJA 3K31A 1NUSA 5EA2A 2AK2A 5LDHA 1GPUA 3KVOA 4C21A 3LY8A 3ZXXA 1KO1A 3C1UA 3L7JA 4N5DA 3AJ9A 4IJ5A 3SKXA 3H1EA 2FW1A 2X6TA 2ZBUA 1N3BA 1XLUA 2OM2A 1NFFA 1GPJA 5BV2P 1U9ZA 8ATCA 5B5SA 1U28A 5ERGB 4KXYA 3OCCA 5K4AA 2P69A 4J9UE 2FQ1A 2ZKIA 4EJ6A 3TW4A 5CFLA 1ISGA 2ADFA 1Q0RA 3NB0A 2JC3A 4PNHA 5GGYA 4EHIA 3ZNBA 3BL8A 3EXEB 2FV8A 2H1SA 3PITA 1JFFB 4YRZA 3ON5A 1OI7A 3UKDA 1HDZA 3SBEA 1NE7A 1QX3A 5NULA 1JH8A 1OLUB 5LXTA 2NU6B 3UGQA 2NZFA 4XZ3A 1MJGM 4Z9YA 2VHYA 1V3UA 1C7IA 1OZFA 1XP5A 2DPXA 1CIVA 1YI8A 2Q28A 2XQJA 1GPNA 4IIXA 5EWLA 2A9KA 2LWIA 3GBSA 3KUKA 4R1UA 4CR7A 2JLUA 1XC7A 4DR4B 4Q6WA 2OTCA 4B3MB 1RWMA 4OK3A 2SKDA 1JQKA 1G5RA 2VT6A 4URHA 5BN1A 3FKJA 4TMTA 2H4HA 2OHVA 3LT2A 3T5DA 4MVYA 2NVUA 3H8VA 1R8JA 4P58A 1DKOA 2Y8BA 4IXDA 2XADA 4YCSA 1MAUA 2HQSA 3IESA 2A5FA 1I4DD 4FDUA 2X8LA 2CXQA 3OOHA 5K0ZA 3K6SB 4HQOA 4BV8A 5JFOA 2BTQA 2IITA 3D7RA 1Q0PA 3GFFA 4U9UA 3M6UA 4D1WA 1ZJ6A 1OYYA 2WMDA 3H9BA 1T0BA 2G9VA 3W05A 3GEPA 4XPIB 1UM8A 1KOFA 4ZHQB 3Q2OA 1K88A 2QMYA 4RXUA 1C7ZA 4MQFB 2BEWA 4XGQA 4DBVO 2FTKE 1JFRA 4C20A 2R86A 3N8KA 4W5TA 4RBSA 4FGKA 4JR2A 4MYUA 2GXUA 3LRTA 4GWGA 2L17A 1JLKA 1T9AA 3R6DA 5JISA 4JI3B 3U5TA 3NDPA 2BFDA 2V7WA 3WDMA 4CDGA 5ICEA 2CGEA 3OO0A 3REQB 2QU8A 2ZWMA 2I4RA 2P90A 5J4KA 3IP8A 2Z5FA 4INAA 4YAWA 1K63A 1GQ2A 3SIWA 2YDYA 3VBEA 3OTOB 1X9HA 1XDUA 1XCOA 4QFBA 2VA8A 4QGBA 3HO8A 2AYXA 2ZFUA 5BPHA 4YACA 2Q2VA 3GNSA 4O2LA 4OXKA 4Z86A 4AXBA 5LZ9A 1CJCA 1NLZA 4FFBA 4GYJA 4C2AA 4LJ5A 3HFRA 4AQDA 3DDCA 2F17A 4P83A 3PDUA 5LYJF 5JBQA 1N5JA 3L6NA 3X2ZA 3G0CA 4P2GA 5G0TA 5BURA 5C51B 3I11A 5A5DA 2A3RA 4Q21A 2ZXFA 4GXTA 1ODJA 3GEEA 2GD0A 4AJPA 5DYIA 3TX2A 4I4CA 4J5FA 3HU1A 1LKZA 3QJGA 2C9YA 3NBFA 2ZQZA 1IOWA 3ONEA 4QXMA 3HDHA 5ILOA 3ORRA 2X8JB 3FZEA 3DQQA 3KB2A 4TVKA 3AV3A 5BSTA 2JH9A 3TLZA 2WF9A 2HWUA 1RW4A 1ZGBA 1XD2A 2FUG1 2K2QB 4Y6LA 4Z7JA 3JW8A 4YROA 1AMNA 2I67A 2RKOA 3D8NA 3LDUA 2WP0A 4FBMA 2QPTA 4I5EA 5DF1A 3ZW8A 2IHNA 3M4ZA 3W1WA 3TINA 3ZR4B 2RGYA 4LXGA 3B6JA 4O4HB 1LK5A 3SDBA 4E33A 3D6UA 3NJ4A 2XXBA 3K09C 1BDJA 3GA7A 4GT1A 5FNVA 1MOQA 2VPQA 1UBJS 2W43A 5FUQA 2VZEA 1SC4A 2RK4A 1ST2A 1IJEA 3FNHA 1XLTC 2O59A 4NAHA 3LA6A 1KU6A 1BMTA 4YMSA 1NZDA 4WZAA 2YVUA 1M6VA 3LZ6A 3S8EA 2B1RA 3L8MA 1ZC4A 2ADMA 1AG9A 1J25A 4MGEA 1HEUA 4QTUB 4AUKA 3DOHA 4RZ3A 1SCUA 1SK9A 2R00C 3MWKA 1ACJA 5HH5A 4FLMA 4K88A 5IZCA 3P9PA 5CAEB 4MUJA 2B34A 5JU6A 2FSVA 2H7CA 1T6BY 1H2XA 2QU7A 4EUSA 4F0JA 4QQ8A 1C0KA 4S1WA 2V1XA 2IPMA 2EZ9A 1A9OA 2F9FA 2FP3A 2JAUA 2CY0A 2WG2A 4NK4A 4BQIA 2H0AA 2QTGA 3GEMA 4N6OA 1ZRMA 3JVEA 4HPXB 3GMIA 4PLZA 5FPSA 5K0LA 1U0OC 2I2AA 1R0BA 1XTBA 3TW8B 3IPLA 1PNTA 4ETMA 4GLLA 4KJXA 1R0WA 2A9FA 2I6XA 3B9PA 4AMVA 3HDQA 1WSWA 2ODQA 1LBEA 2JLYA 2GZAA 1DXOA 3H4VA 3VYTB 2Q3FA 4R5MA 4M53A 4UULA 3CCFA 2XCSB 1DC4A 3T12A 4GR9A 2B69A 4RZSA 1NVMB 5FI3A 3PCTA 3RJZA 1U5BB 3PT9A 3UQZA 2FFAA 4YI5A 1PR2A 1WD5A 3E5MA 3O3NB 1Y89A 4WJLA 2X5XA 2IE8A 4FGZA 1P5JA 4BFYA 1COZA 3CB4A 4BFCA 3LWNA 3I9JA 2XBLA 4BC0A 1YHNA 1P2FA 2W2QA 2NZVG 4UFPA 2E5LB 1JTFA 5LS3A 4WASA 4MDHA 5FWNA 2QZSA 3U9TA 2DPYA 2OMEA 4NYJQ 3VR5D 3WLOA 1G2QA 2W2MA 2XA1A 1NVXQ 2ZE7A 3OWHA 1KH1A 2C99A 3JVDA 2IZ7A 4CMIB 2J3JA 4LGYA 1H8EA 1FLNA 3JXEA 1N9GB 4W63A 3DKIA 1RACA 3GW8A 3VGPA 5EIXA 3G59A 3UUEA 3LVFO 2PGIA 1RT9A 5AUOB 1PT5A 1PZMA 4Y67A 2JFNA 1OWPA 5FOVA 1K86A 4A8PA 3UFXB 5DBEX 4PLHA 3KHKA 3HUTA 1U8UA 2OBFA 4FEKA 1W1WA 1RPZA 1XQXA 2PUWA 2H08A 4V0SA 4V1CA 3RJMA 1VCMA 3GFPA 1JHOA 1QNFA 5HRUA 3CZMA 1CQWA 5CT8A 1CDDA 1NVFA 2HLDD 2I76A 1DCFA 3D5QA 4UM7A 4FX5A 1OWLA 4LDQA 5BW6B 3AOEA 3ZLTA 2A1TS 5DI3A 3INRA 3UG7A 4B4OA 3RBVA 2X4GA 2CNNA 1I0IA 2F4NA 5CUQA 5TVGA 3DBHA 2ZE5A 3QX7A 3EIEA 5L9AA 1H2WA 3WAJA 3GA0A 5A5VA 3HA7A 1FUUA 1OTHA 3LVBA 1M74A 2H1RA 2NU9A 3EXFB 4BECA 4F06A 3TVYA 2FN8A 3A2NA 3RNLA 4GI1A 3P2MA 3TAHA 2QNBA 2A7MA 3GY0A 3WB1A 2BR3A 4D41A 2ZWVA 3RAFC 3N8IA 4KE7A 3LHKA 4M22A 1L5KA 2I91A 4NJOA 5AK3A 4B0OA 3LWBA 1EE1A 1HFKA 1JEAA 1Z35A 5G0SA 3UMVA 1HDYA 1YE8A 3SC4A 3IKTA 2AG5A 5JFTA 2DT5A 2KQUA 4C6TA 1ZFNA 4N5LA 3PC8A 2NXAA 3L79A 2OAQ1 2GEKA 4ESHA 2VJOA 2GAFA 1XTSA 2DWUA 4BNZA 2VRBA 3H4IA 4RGYA 5LXTF 2VJAA 2BI8A 4P9NA 5I5EA 1OZHA 3GJ7A 1F1BA 3QU9A 4LXTA 4XWTA 2Y92A 3L82B 1U94A 4YAKA 2QUHA 3ENZA 1AF7A 2B3TA 2XUKA 3GGDA 1CY0A 3JQCA 4Q9DA 2WTXA 2OP1A 4MTCA 3BJZA 3RRMA 1U0HC 1HLPA 2HZ7A 3FM9A 4YECA 4DY4A 4K2HA 4EYEA 4RD4A 3X2FA 5M34A 3UK0A 2PY6A 2QRNA 1GA4A 3DT8A 1PZEA 3ZWOA 2EHJA 1ISFA 2CVPA 4ROSA 2ZZKA 5EIWA 3E7PA 1BWRA 1P4HA 2BL4A 2IYUA 2BBSA 3KJEA 3MQ2A 1J8QA 4Q37A 4Q7EA 4C1DA 3FZQA 2GBIA 5DHSA 4OATA 3C5EA 4GRDA 4NNJA 4EB8A 3E7XA 2PSFA 2IYNA 2Q3EA 3E7DA 3BAZA 3OOWA 5B6JA 1AUVA 4DJFC 5J58A 4PYOA 2RB5A 4DXAA 4N48A 3IPYA 1WDTA 4NAVA 4FHFA 3WQRA 3DMRA 2XYPA 1T8TA 1G5FA 4L0DA 4QWMA 3ANNA 1R2QA 3UJBA 2YNTA 4DM7A 1H2BA 3OSUA 3PY6A 1YF3A 1L4BA 1FFHA 2IT1A 4JA0A 1YGYA 2H7VA 4JN6B 4FFSA 1KC3A 3HACA 3U3RA 1W87A 2L42A 1XRLA 4RABA 2OCYC 3WZ2A 5CDTA 5JH7A 4ACBA 5TMEA 1VSVA 4J0FA 4BKMA 4CV1A 4OI0A 3WVNA 5F73A 2JJ2A 4JI2B 2IJGX 2JFHA 3NUGA 3F78A 2PPVA 3QPUA 2RSLA 4G5XA 4LNAA 2P7IA 1MX3A 2PS3A 1Y9EA 1K6XA 2OZKA 2QLBA 1M6WA 1GQFA 1JMVA 2P6RA 1V8FA 2V5VA 2HLHA 3I0MA 3W6OA 3W4KA 3T15A 1ZD8A 3WRYC 1TNDA 2CYAA 2OGUA 4R98A 1AUPA 4W9NA 1B2RA 1WDLA 3RTAA 3IEVA 3IEPA 2XDWA 3I09A 1H5NA 2L0XA 3WNBA 2QN7A 3SW3A 4RWEA 2GK3A 1DXKA 4ZVSA 3O6VA 3SFTA 4CM4A 4R8SA 4BBPA 1ZNBA 3AIKA 2FPPB 3SDSA 4PHCA 2GB4A 1IHXA 2DXIA 5FP0A 2FSFA 4C2BA 2WP8J 3O4FA 1QRRA 5JSQA 3EASA 2D8MA 2VRCD 3IV6A 4BUJA 5LR6A 1OPRA 1GKUB 3AF2A 4ZI7B 1SUDA 1ZD2P 4ALNA 3TIVA 1A1VA 3L0ZA 5JCOC 1FU7A 1FUIA 2ETVA 4TYYA 3AQ4A 4MWBA 5EGNA 5EHXA 1KWGA 2VC2B 3FTQA 4IWYA 4GGPA 4BFLA 1QJCA 2IH2A 5HIPA 3J7TA 4XJSA 4C3OB 1XYYA 1J99A 4LOAA 1A7UA 3B82A 3OFND 5DBGA 1USKA 4MLCA 2NU8A 1OV6A 5B1SA 3V48A 4CG3A 4IEFB 5D3ZA 4DV4B 1EPUA 3GN2A 3AJRA 3ML1A 4HAOA 5JCXA 4GI5A 1Y3AA 4E88A 5KOHA 5LQRA 2GF2A 4XI9A 2GYYA 2I6FA 3PDJA 3BXXA 4NZMA 5KBYA 1VKRA 1JHDA 2GXQA 4QUKA 4DFDA 4RJTA 4KQCA 2ZTHA 4RANA 1X1CA 1UBCA 4IIJB 2V45A 1P9EA 3ACDA 3HM2A 1V6CA 1L6IA 3PYMA 5AJLA 5TARA 3D7NA 3IS3A 5CGZA 2YZ3A 1MO3A 3COPA 3N5KA 5TMBA 4YT4A 1Z4NA 4G84A 4PQYA 1F2VA 4DCNA 3EMBA 2E18A 5HCUA 3DE1X 3ZY5A 5BQ5A 4EJSC 2BGKA 3KPWA 1F12A 5JAHA 2CMKA 1JWLA 1NJSA 1YMUA 2VZLA 4PQGA 5K6AA 5LOVB 1XR3A 2CFUA 1VHQA 1BMCA 5LCHA 1P6QA 2IPLA 1K08A 3AUFA 5E6SB 2GVZC 1IULA 2BSQA 3LBIA 3PUJA 4ZRMA 1WZCA 3E18A 3T7RA 2G63A 5EIBC 1RYMA 4OU4A 1J23A 1QFXA 1QAMA 1FNSA 3NOXA 2AFIA 1A2BA 2Q1UA 4KXUA 2PZLA 3H1BA 3WB2A 3ETEA 1F0NA 2NWQA 4HNAB 4TROA 3WJ7A 2H2WA 4J7XA 1E66A 2XAUA 1VYTA 3JWHA 3OQ6A 3PJFA 4WIAA 5FV7A 5LB4A 1ZIYA 3ENNA 4R5HA 4PR0A 5EQTA 3UKOA 2Z6UA 1SUWA 4EEXA 1RRMA 1VSQA 4OYLA 2JANA 3MWEA 1N3LA 4FQ8A 2WYMA 1U9IC 2MDTA 1NBMD 4ASUA 5FUVA 1CQPA 1NP7A 3IHLA 3MF4A 4TS3A 2O2HA 2QE7D 2C78A 2WYOA 2RCNA 3CS3A 4OHXA 3NH6A 4EKYA 3KNZA 4ALJA 1I7NA 1EFVA 2W2KB 1XEWX 4XEHA 2GEBA 2D13A 3LXRA 5CLHA 2AW5A 4ZVOA 3NEPX 3QF4B 2P9CA 1BU8A 1CF2O 4DUZB 3CHYA 4NDNE 3LSTA 1L3CA 1VSUA 3WMGA 1EG7A 2QB5A 1B43A 3AUJB 5TF4A 2QTVB 2VHVA 1AHIA 3VPCA 4TTPA 1C9JA 1FP4A 2PKEA 3ACBA 3TR0A 2ORWA 3EWIA 5EMJA 2VAMA 1MVOA 4LBYA 3A1UA 3QTBA 4TKVA 1TADA 3VR2D 5B57C 4FM9A 1YFLA 2HR1A 4NMMA 4TZ9A 3DEFA 5FQCA 1HE8B 4EW3A 3ICCA 3WBKA 1NI3A 5LP6A 2XB4A 5EUCA 1LDBA 1QHYA 1XLVA 3B12A 3INYA 1SWWA 3USCS 4GAEA 4BQPA 4DNPA 2C4WA 5ISMA 5DGTA 5LCAA 4IGFA 3GP5A 4M0LA 4P31A 1VP9A 1IOZA 2MJLA 3LHSA 2X2FA 3QPBA 1KQGA 1S9DA 2PHZA 3OWOA 4ZOCA 5BNFA 2PMFA 2ODEA 3RTCA 4XQ0A 1ZW1A 2EZTA 1LZLA 1CRLA 3MGKA 3QI7A 1EFKA 2ES4A 4J1TC 2YXLA 5FHRA 3EPKA 5KYUB 3T38A 4GI3A 2P5TB 3WYNA 3MB8A 3FMPB 3OQ1A 4YRIA 1XPRA 4HSEA 2XYVA 3DDHA 2X7HA 4TL6A 2JEYA 3FW1A 1RCFA 1L7EA 1NWCA 1XJ0A 2EKZA 1TVMA 5TJ9A 3LBFA 2WVAA 3Q7EA 4PV7A 5DTIA 5FI0B 1KQOA 3STTA 4ALMA 3QNUA 3EVTA 1GU7A 1QKIA 3MOIA 4MYTA 1LNSA 1P2DA 3EHEA 3NHKA 4BX8A 2P2LA 5BO5A 3GX1A 5AH0A 1O95C 4KL8S 1N1GA 3REGA 1EP3B 1H9AA 1K6EA 2ZETA 3NVDA 5L3QB 3EZ6A 1CB0A 2I66A 2WMNB 4XH9B 2E4AA 2GJAA 2CKDA 4ZV7A 4BAUA 4EVSA 2IIPA 3OM9A 1WVIA 2X0IA 4HHEA 4WBSA 2Z2YA 3E03A 1WB9A 4TSFA 3WNZA 1JA0A 1MX1A 1LPPA 2LRHA 3DMGA 3QEMA 1HFWA 2HBZA 4GBMA 4C7OA 2IOFK 3VI4B 4FS8A 4OYYA 5JC1A 3DHAA 4ZQCB 1JJTA 5HCIA 3KT6A 3VX3A 5BT8A 2XGMA 3KJXA 2JGRA 2C98A 1XMQB 4AKTA 4XGNA 2QTCA 4UUMA 1FFEA 3ZHBA 4C07A 2G82A 1N5LA 5BMVA 5L51A 5M2QA 3IDZA 2UUCB 1A71A 4I4TB 2XVYA 3TOXA 3B3AA 3QX9A 1E3IA 5DYGA 1OZGA 3WXMA 4D82A 1XN1A 2G8LA 2ZJBA 1JDZA 4FFWA 3FTFA 2BEKA 1ISHA 4ROTA 1I80A 2YHAA 4KPYA 3WDLA 2I71A 1J5XA 1TFUA 2ZRFA 4R41A 4WEQA 4XIYA 4LZAA 2PQ2A 3PQCA 4FONA 3RIMA 3OUTA 1U0RA 1UH5A 1UMKA 1JJ7A 2H2DA 2H5JA 2AJCA 5KNDD 1C30A 3NNDA 2NVOA 3IEXA 2YDXA 4I2VA 1W30A 3DBVO 2QN1A 3L9XA 4I81A 4N3GA 4EHKA 1GZ5A 5FR1A 4OO3A 1I2BA 4Z5YA 2OHJA 1VLJA 3OCJA 2X41A 3T8YA 1L5VA 1Q12A 4BNJA 4BNLA 4UWSB 2D1FA 2QTHA 1WABA 4Y2XA 5ACVA 2NAPA 3D3EA 2G9RA 4E08A 2Y9MB 1KYYA 3JYLA 4FC7A 4B3BA 1VQ1A 4S3MA 1ZZEA 5LIPA 2OCIA 3PQ6A 5D84A 1OXTA 1NQUA 5TSDA 3UH1A 4BATA 4FOLA 3QKSB 1UZAA 2L18A 5JH7F 4MVJH 2WUGA 1L7VC 3OCUA 3V7FA 4AJJA 1MF7A 3A6FA 3ZUGA 2ECQA 2C9DA 3PNMA 4BN5A 4KR0A 1L5SA 3EHDA 1KHHA 2IS2A 1S1MA 2BUCA 2FE1A 3NHWA 1N3IA 3RT7A 3AEXA 3EZ7A 2F67A 3CGGA 4H7DA 1KNQA 2EEPA 3GT4A 4RPKA 1FXUA 3THXA 2YX1A 1OXKB 5JMWA 4NYIQ 4W1SA 4M0FA 3WDSA 1LVHA 4TOIA 5C52B 4C4PA 8OHMA 5H3HA 1TYDE 1B0AA 5IBRA 3OQIA 4C0KA 5HH6A 1RJGA 2YTZA 1WVMA 4FYWA 2V6IA 3L7YA 4DV1B 2AS0A 5EJ6A 3KOWA 1FSFA 3LWZA 1E2LA 3EZ9A 3OOSA 1M8JA 2MYNA 1MQSA 1JLRA 2COUA 4M38A 1U7ZA 4O5AA 2FWMX 5CVTA 3QKRA 2IQ5A 5EVDA 3D4NA 2VP9A 1QE0A 2QP9X 2MSWA 2QX4A 3R0QA 4TTTS 1PZHA 2OQVA 3VI3B 2YV1A 4BOYA 1SUAA 1M2WA 2ZRJA 2CBNA 1GARA 3CBGA 1UDRA 4BX2A 3QFCA 5HDBB 4B2IA 1YU6A 4NC9A 1EWYA 3CWCA 3HBFA 2NV2B 3A11A 1MVLA 1Z7GA 1MD9A 3G0OA 3FI9A 1RXIA 3D7LA 1C3OB 1V3QE 2W98A 3E0XA 3PA8A 2D2FA 5ETJA 1C1DA 4EQ6A 1Y37A 2D2IA 2IVFA 2UZ3A 5KYXB 2EKLA 1V11A 3N8NA 1YFKA 2PH5A 1QTQA 2CE7A 2HMWA 4F84A 4PTZA 2J3DA 5HZGA 1TK2A 3HKEA 4KR3A 2W2TA 5EMLA 3UHFA 5FTJA 2PUHA 1V43A 4Z1OA 1PR9A 1YDFA 3OBIA 3R24A 1NF9A 3H17A 3PQ3A 3O8QB 4NTZA 2FCRA 1QM5A 4B79A 1Z5ZA 4OQEA 3U3XA 1VE7A 2BFZA 1VPWA 4D79A 5JJKA 1Y1RA 2SECE 3GRCA 4I1SA 1IL0A 5E1DA 3TIXB 2IODA 3R3XA 1P91A 4F2GA 1ICEA 1PJQA 2O8EA 4XQ9A 4JYCA 5EHQA 4OX9B 5L3SA 4B4KA 2EFGA 3BQNB 1C4XA 5E7QA 4CCYB 4HPJB 1T5OA 2RGBA 4A15A 1ATZA 1BWQA 3G0GA 4J7CA 3GVHA 4FOTA 3HG7A 3VAZA 3NRCA 1K06A 2WJ6A 1G8SA 4FDAA 3VC3A 2IA5A 3KCNA 2IBTA 1J42A 3RRXA 4DNXA 3R3WA 2QQ5A 4B82A 5A23A 3LE8A 2BMDA 3DMFA 3MUOA 3H65A 3RVSA 4RULA 1X7GA 4KTTE 1YC5A 4CFYA 5H7XA 3VHXB 4X71A 4FFOA 3RU3A 3JYQA 5CHYA 4K03A 4G0PA 1KEWA 4D9NA 3ZNPA 5K9ZA 2QRUA 4BBAA 4IHJA 3ZJVA 4F9TA 1EGMB 2WTNA 1J7KA 4ZAZA 5DNCA 2PKRA 5HMMA 4EVRA 3T1HB 2ZJYA 1ZJ5A 3AFOA 3MT7A 3GPBA 1KYTA 2J7PD 2XZPA 4EX6A 1NW3A 3R44A 1LC0A 2C9OA 4DR6B 3OIGA 2MSCB 3ROPA 5E6RB 2AVNA 2YFYA 3QQ5A 4X84A 3TG2A 2BE7A 3VKGA 2QIOA 3DMHA 2Q3DA 4J2TA 1Z6QA 1KIMA 2OVBA 2ZULA 3I52A 7ABPA 2NX2A 4BQEA 3R5JA 5FBRB 4D4LA 5CP8A 2BVNA 4ZVKA 3WLAA 4K6HA 5J43A 1Q57A 4OSEA 4Z5ZA 4YAJA 4UU8A 1XRPA 4NNPA 3G0DA 1U8YA 4FQ5A 4N5IX 3LC1O 4LTDA 2PLRA 3R76A 3VJKA 3OA2A 3DFIA 4R7ZA 4PYJA 2WG0A 2XZOA 4PVTA 3C8UA 1GG8A 1E4YA 3KEQA 1U6IA 4M0UA 4BPRA 4IILA 1ZM3A 2CK3D 4JDUA 3LRXA 3SZGA 5JIBA 2PD4A 3X1WA 4C6RA 2J46A 2XSZD 3V8QA 2JBAA 3C3WA 3L6CA 3A10A 3AKZA 4NOKA 1EG2A 4D3ZA 4PO8A 2JLWA 4Q9KA 4Q7MB 1CF9A 3IUPA 3ZE6A 1WKVA 1BQEA 3G9ZA 2H4JA 3QEJA 1OGIA 1Y5MA 4I3HA 4DLNA 7ADHA 3S29A 5BR1A 4M76B 1HT3A 1WXEA 2H3HA 4L74A 2NT3A 3UFBA 4ER7A 3ECSA 1J21A 2IXGA 1MH9A 2OPBA 4P6VF 3Q2KA 3CPJB 3DT9A 4GGOA 2Z30A 5BW8A 1OA0A 3WBBA 3BMNA 2JG3A 1LPOA 1K75A 3STXA 4FCWA 3VZCA 4JYAB 2YICA 2PKCA 2YS6A 4ZT6A 1R15A 2INGX 3DNFA 4LYHA 4XW2A 4YRFA 2YC2C 1OAOA 3Q3EA 4OHZA 4B6QA 3DVRX 1P39A 2ZWOA 1N7GA 4MQBA 1ZN8A 1Q19A 1FDTA 2FRDC 1JR4A 1X1DA 2M2IA 3CLTC 3LH5A 1J00A 1AKEA 4UZEA 2EKDA 1I8TA 2QQFA 1AZSC 2YHEA 1JEQA 3LW7A 3HKBB 2DUMA 2Y1LA 2P78A 4QICA 4X7BA 4J7UA 1TDJA 2W8BA 3RC3A 2XXAB 2A7XA 1RBZA 4JSYA 3H2JA 5C5CA 1W29A 1XL0A 2PZFA 4F4JA 3CF6R 3L04A 4LE0A 3W06A 3QBVA 3VMMA 5C1PA 1GKLA 3FKSD 3OJ0A 5JC8A 1CU1A 1ZN2A 5DW0A 4AX0B 2FPLA 3TZEA 4PG5A 1U0SY 4WLNA 2JIZA 5TIIA 1ZRNA 4EFKA 5BMVF 1P77A 1I24A 2WF6A 4IXTA 3V7NA 5EXSA 1Z6PA 2EFYA 4D3YA 5EWAA 3IKVA 5I7WA 1LDYA 4JMPA 2NSJA 2FFRA 3KQQA 3ZNQA 5FWXA 4N54A 3EBOA 1VKNA 5IXJA 2OO3A 4N76A 4GQBA 4NBVA 1PR3A 1NRXA 1H3EA 4Z2YA 1PL8A 4LZZA 4EECA 3G85A 3OJXA 2EJUA 4QSMA 5J5AA 5KYVA 5I45A 4KSCA 1C0EA 1U8ZA 2I6SA 2X42A 4RFVA 3WIBA 2OZEA 3CN7A 4L8GA 4TYFA 1T3TA 3IQEA 3KR9A 3TGLA 4URXR 4BXOB 4P4SA 2YHUA 3CH7A 1FUYB 3FHJA 3HEMA 3HU3A 2JH8A 4BVLA 4FBGA 3WYAA 3ZLBA 5JSUA 1UODA 4DUPA 4LZWA 1FC0A 2JRCA 2RARA 4Y9DA 1A7KA 3VA7A 1ULUA 3K70C 2G1KA 3I1JA 1XYVA 4L3VA 1WZIA 1GLVA 3F7MA 5ENZA 2XE8A 3KQVA 3W04A 3K0SA 1F0YA 1Z37A 2Q5CA 4DWOA 5T7BA 1KI1A 3EXIA 4N0MA 2P2NA 1XZHA 5BWOA 4MUFA 4NOJA 2YBEA 1J2RA 1MRZA 2PL5A 4GKAA 3AU9A 3ZGNA 1D6NA 1ISSA 1G16A 1VYVA 4HGQA 3SBLA 5F5XA 5IK2A 3AV0B 1KETA 1TUBA 4BB9A 1M2FA 1PSDA 1THTA 2J5QA 4GXQA 2HWWA 4OY3A 4TZBA 4NLLA 3T0IA 1I14A 3L4BC 2Z09A 3E81A 3WKDA 3NPMA 1EFRA 5FWDA 4C06A 3ZVNA 4Y9TA 3RV3A 1NQWA 1YCDA 5EZ5A 3UK2A 4YAGA 4NDZA 3T9BA 2RHWA 2GPAA 4UTOA 3TF5A 5KTTA 2X0RA 4KO4S 5T3YA 1FFCA 2AG8A 1JA9A 1JKJA 2XIQA 2Q2WA 3KR0A 3LXMA 2DTDA 5JJIA 5C35A 3FYUB 1QRDA 3BZWA 4BDTA 5AM3A 3M33A 1W5TA 3Q1KA 4LKRA 1YE5A 5AKHA 1BWPA 2WJJA 4WDQA 3H6KA 2J0QA 2YH2A 1GZHB 2FSIA 3N75A 4Q4LA 2LCQA 1RXEA 3AR2A 4B7UA 1WD7A 3M6AA 4H1TA 4CW7A 2OCXA 5LBTA 1EM6A 3NDJA 4U3JA 3GARA 5JXJA 3R9XB 2CXTA 5DRTA 5C4MA 3HGQA 4ZVTA 2PZJA 4DLRA 4MB0A 2VAXA 3SFPA 1S2DA 5HGXA 2Y1DA 4V0RA 2HCBA 2PDAA 3DUFB 4N7RA 2E89A 4CG1A 4NE9A 3OZCA 3SAJA 5DDIP 4AK9A 3OOEA 2IUEA 1CRQA 1M6YA 4Q9NA 4KO1S 2QX9A 4ECEA 1V8PA 3CZ4A 4OMFG 3MTDA 5CFRA 5KNLA 1P2BA 2EBUA 3ZTYA 1JE0A 1JFTA 8LDHA 5FD8A 1J90A 4IX9A 3QENA 2Z83A 2D06A 1DOAA 3B3FA 3D02A 4LDRA 3PC7A 1RLOA 4V0HA 1N8KA 1NZJA 2OKCA 4NBNA 5JWOA 1EM8B 1DQPA 3TTYA 1ZK3A 4HVLA 3D7SA 4KWIA 4YV7A 1A8UA 1YNOA 5JCPA 1KWKA 1KNXA 3RYIA 2HQBA 3M6LA 4PZAA 5BV1A 1PT8A 4FFMA 1ADBA 1KK2A 1PTJC 4MCAA 5KSPA 3ZQJA 4C0WA 3HKDA 2XMSA 2GQ0A 2AZ4A 1GPH1 2CHQA 5FLEX 4JZYA 5DYWA 1FL9A 1PT6A 2H5EA 2J8ZA 3IULA 3LECA 1ZTCA 1OIWA 3SMVA 1M72A 1TZJA 1N0UA 2GRUA 3OZXA 3D6AA 6CHYA 4BMNA 2FQQA 4IHJF 1I7LA 2GD6A 2FOIA 1RWBA 2PH3A 2OL4A 2P2ZA 1FX0A 2TS1A 1L7AA 1H2YA 2VDOB 3A28A 5KOIA 1G59A 1WP9A 5FR2A 3QHQA 2Y71A 1P1JA 1CR0A 1DRWA 3KSDO 4JODA 2O4UX 1C7RA 4IICA 1CZHA 3DKVA 5K0SA 4MHOA 5LFAA 2Q3JA 5BNIA 5CLGA 3LUBA 4IIUA 2C4HA 2DECA 5FV4A 4IMPA 1DCMA 3EPPA 3EUEA 1EUDB 1KK1A 2Q7XA 2RHCA 2GJKA 3IUYA 3WLNA 1XZNA 3RUDA 4HH3C 2AT1A 5IDQA 4D3XA 1D1TA 3EDMA 2ZI4A 2XA2A 3FPBA 3UB3A 5JD4A 3EVEA 2ZIWB 3WMFA 1NUPA 3HK2A 1XVLA 3DE7X 3EW9A 4MUHA 1R12A 3ROGA 5HQTA 4HLUA 4M7WA 3CVWA 3ICVA 3HLYA 4H16A 4GKKB 3EOBI 5AIBA 4UVHA 3FPEA 5I7VA 2BG7A 5FBKA 1UAYA 2CDCA 1ANKA 1QDUA 3BJRA 2WJIA 2FZCA 1HA3A 3BWDD 3EAQA 3KU1A 1OBHA 2CLKB 3MD7A 1R9MA 4E32A 5CEEA 1XZCA 3AKYA 5DSZA 2OBYA 2YCLA 3FSJX 2DT8A 3BHMA 3RVBA 3S1LA 4OAPA 1DG3A 1X38A 2JF0A 3CT4A 1X1QA 3BOSA 4RXTA 5F2KA 1OHHA 1WV1A 3JAWA 3LPNA 1L8LA 1MO6A 4Y2YA 3UVEA 2C3MA 4KW7A 5AIAA 3PFNA 2QAGA 2XKBA 3DEIA 4IBOA 3V1KA 4ZMBA 4IV0A 4ND5A 1HQCA 1FS5A 5C34B 2D1RA 3DYVA 4CL8A 4J4HA 1PHPA 3FYCA 4WN3A 4MVJI 3VR3A 1V1JA 1MC4A 1K9SA 3UHOA 1FYEA 3IV9A 5ALFA 3V9AA 1P29A 3ZV5A 4Y3UA 3ZCSA 3L0DA 2WQ7A 1BOFA 3KHTA 3UAOA 1GPYA 1QE3A 2Y4OA 4TXNA 5ALUA 3DBLB 4RJIA 4JEIA 3B1YA 1UFQA 4ZVRA 5TDHA 2D7DA 1V1RB 3V8BA 3AEKB 4UPEA 1ZM2A 1HG1A 1TQDA 3CT6A 4BP8A 1P2SA 3L7KA 1PEKE 2QMOA 4U4AA 5EN4A 1D2GA 1JPVA 1LRJA 4OHPA 3D59A 4HWTA 5T4FA 3W1VA 2JLSA 5BN3A 4K9RA 4Y0NA 1T0JB 1IVSA 2FZKA 3AVYA 4K6CA 1COWD 3ZS9A 3F46A 3A27A 4KP7A 3NHPA 3UGJA 4OU5A 3B1FA 3FB4A 1WY7A 4J76A 4LOJA 3SKVA 3JQPA 4XRGA 1MPTA 5FRDA 2WSBA 5GV7A 4ZQFA 1XROA 1Z75A 1C9EA 4AJOA 2LD4A 3U40A 4ND3A 4JLVA 4GPEA 1TA9A 3FN4A 3SBOA 1MRNA 2ZANA 2E6KA 5LP1A 3MAJA 4OQXA 1BIFA 2XNKA 3BMCA 4ILEA 3THYA 2FEKA 1C2TA 4ZI3A 3RU9A 5KSZA 3G8CA 1UC9A 3LHDA 4RLFA 2XE6A 3SR4A 4B5KA 1CJMA 4DCSA 2CEKA 2OCPA 4OGFA 3IEMA 2QX8A 3K8OE 2DY0A 1C5KA 2WPDA 1UWKA 3IUJA 4H1HA 4ZT5A 1XDWA 2DKNA 4JBLA 2O2IA 2Q1TA 1NN5A 1G38A 3PE3A 5AM5A 1DJQA 3TPZA 5BOSB 1G291 5IWAB 3IAS6 1OYWA 3ETLA 4KVGA 4DC0A 3GZNB 2QP3A 2A84A 3CSSA 3MFQA 4ZU3A 3RC9A 3JYPA 1H0RA 2Z04A 2IUUA 3LOUA 3KD3A 4W9RA 4HZUA 4OREX 3W4IA 4ARIA 3FIUA 1WB5A 2C92A 4A8JA 1W4AA 4WKGA 1VPTA 1ZWLA 4ZDJA 2PKXA 1JYSA 1PX2A 2ZRNA 2QMQA 1AKNA 2ZU6A 3CLSD 3Q15C 4DA9A 3ND9A 3PHCA 1DXQA 3OY2A 3KVNA 4P0QB 4II7A 4YRAA 1X9IA 5ICSA 2GOYA 4ZOBA 3U4QB 4WTOA 4EZBA 3FBTA 2WIFA 4LSWA 4R40A 2EL7A 4OIMA 1OX4B 4MQEA 3BMQB 3BXZA 4BUCA 1EWRA 3NASA 4NENA 4D4MA 2YNMC 1KOLA 4KQ9A 4EWLA 1Y8RA 5I8WA 2VK4A 2Z5LA 3QMMA 2XD4A 2JFUA 1GL3A 4OQNA 2OZVA 1QCCA 3Q9LA 4MYHA 6NULA 1FZTA 3KPYA 5F1OA 1X0VA 4AW9A 3H6HA 2X3YA 3C97A 3ESBA 3SFVA 1XBTA 2F62A 3KR1A 5E4FA 5CLFA 3IXMA 1GPAA 5BWNA 1K7YA 4G56A 4G0OA 4EI9A 3DA8A 5BQOA 1II8A 1UBOS 4XSVA 5LDDC 5GJBA 1IU9A 1VBFA 1SHLA 2ZUCA 3L8CA 4Q0MA 1HUQA 5C0OE 2XF4A 3FSGD 3H5RA 4PS0A 4MS3B 5E2IA 1ISIA 3QW4B 1TYAE 3O3CA 3OECA 4IX1A 5HS6A 2II6A 3HP4A 4UD2A 1ORTA 1NT4A 3V8VA 3VPFA 4HUTA 5B4VA 1Z2NX 2HPZA 2QENA 1CUZA 5F77A 2YOGA 5CVCA 5HIJA 3OY7A 3IEUA 3DDWA 1Z5WA 2QM3A 4J9VA 2MR6A 2HPAA 1VPLA 2OO5C 2NYAA 3U19A 1NBAA 1BDHA 1NM5A 2ET6A 3HCAA 1V9SA 3O1LA 3KXPA 4WK2B 3RIEA 3KEMA 4YAOA 3ZV3A 3KSBC 1KI8A 1WCYA 3T52A 2FYTA 2ZW9A 3E5NA 2QR2A 4RHCA 3ZWNA 4KN9S 4RM5A 2Q41A 4WZBE 5JVDF 4UM8B 3I9FA 5LVAA 2PE5A 3KUDA 4H60A 4JBYA 2J9FB 1QZZA 4QG7A 4Y2QA 3R75A 2DB3A 1BJKA 3PWKA 2I2FA 1RAEA 3TSCA 2XWBF 5BYBA 1RYEA 4JASB 3SGLA 1P2TA 5JS6A 4X20A 3TCNA 1MZPA 4HGYA 1WQ3A 3I3OA 4KLZA 2JGMA 4LGVA 4GNKA 1L1EA 2G76A 1LFAA 1XTKA 2YYAA 1DQZA 5DMXA 4IF4A 5EYPA 1EHYA 2RHLA 4GE3A 5DBOA 5J63A 3TZHA 4C6SA 2ILVA 3TMAA 5CD9A 1SA0A 1U1DA 2GETA 5CDGA 5AM0A 3VDXA 2PZGA 3PGVA 3Q7PA 1T3ZA 2TMKA 3C3CA 3N1UA 4V02A 4C1EA 3E61A 3KAQA 4DA8A 3JYNA 3M3PA 2BJWA 1ODKA 4M0DA 1XRJA 1SELA 1DWPA 4PCVA 4MKFA 5AXOA 5KX5B 3C3PA 1TCAA 1Q1EA 1T9BA 3PNPA 4YCJA 3SC2A 4G1FA 2XD9A 5F2EA 3R9KA 3UMGA 1JIQA 1TF5A 2LR0A 4OMCA 2V7VA 3S68A 1LSOA 4C4TA 1R8SA 2FRVA 2FR1A 2A59A 2IHZA 4O3FA 5AHOA 5BVGB 5A2QA 4D1YA 1G4UR 1XJ5A 3EMVA 2ORVA 4L7QA 3NWOA 4D42A 1A9XA 4GLOA 5IVKA 3DHCA 1WHTB 1G6KA 3ZX4A 4NV1A 1IBMB 2P2YA 4P8RA 1H22A 2Z56A 4HRAA 3BRSA 2QRVA 1TAGA 2BAGA 4BCBA 4ZJPA 3X0DA 1CJTC 3Q3GE 4KC0A 5CLLA 1RBQA 4WI1A 4ER0A 1DO2A 3NVMB 5ADWA 4MWGA 1EUYA 2ZRIA 1Z47A 5SZKB 5KDOA 2XWPA 1C8BA 2WWRA 4JT4A 2JFZA 2N42A 3OZ7A 4FSHA 5CLIA 1S02A 3W2HA 1N2ZA 5CJ2A 4OYRA 5H81A 4R1TA 4MDFA 1VI6A 1M2XA 2HB9A 1RZVA 1N7HA 4C4ZA 3IGFA 3SSMA 4URWR 4B71A 1J5EB 4OK5A 5K0WA 4KRFA 1U02A 3MAGA 5JS2A 2XTZA 5IM5A 2Q46A 3WWPA 5HKKD 2QG4A 2A0WA 3OA0A 1KEVA 3DD5A 2Z0MA 3KFXA 3VMFA 1AS2A 2ZIGA 2HHHB 1BMDA 2Q8QA 1YVPA 2R97A 3Q3IA 3LVRE 1HMPA 1IHOA 3QXSA 4KE6A 3U6KA 2G1PA 4V39A 2OPHA 1JLLA 3GJQA 3WK9A 1B8UA 2F64A 1QFJA 4HDSB 1GL6A 4RUKA 4CMBA 4W4TA 2XKAA 1QU2A 1IEQA 2ZBRA 1N6KA 1DO0A 4BO8A 1HT0A 2RGAA 2I99A 3L0BA 3VOBA 4I1YA 1GRCA 5DM2A 4OA8A 5G3ZA 2ZB8A 3RANA 1IZ9A 4BZWA 1LXCA 4OVKA 4PFJA 3MTGA 4AO8A 3GBPA 4Z7NB 3D0KA 4KFRA 1TZ2A 4BMOB 2C7PA 4B4WA 1E3EA 1O08A 2PFGA 4QDJA 2DAPA 4A6PA 1AO3A 1L4FA 4DDVA 1J1UA 2XE4A 1ZO8A 1KU0A 4BB0A 2HMAA 1QQAA 3L7LA 2VW8A 5K4KA 2C2KA 2Q5OA 3CCCA 1JEYB 1ZINA 4C4XA 1E2UA 3WHKA 2UZ4A 1SY7A 4K40A 4AICA 3HUUA 4W8HA 1VJGA 2FEXA 4DIFA 1GGMA 5BWCA 5K0BA 3K6JA 1KO2A 2B1GA 1NU6A 2X22A 1NV9A 4MB6A 3A31A 5EQJB 4UMVA 4E6PA 1QE5A 2COEA 1CVRA 4GX1A 3LNCA 5LU9A 2FHXA 2W90A 2OK8A 4I4IA 2APJA 1T9KA 2P7HA 4JJIA 4UHCA 4WEOA 3X30A 2CMHA 2C1XA 4KMOA 4HDNA 5FPQA 2IHKA 1V4VA 1FQKA 2ACKA 4HAUA 4K8OA 4DXDA 4F4UA 5KNCA 1JG6A 1CZLA 1MJNA 1Z0ZA 3GGOA 4MHTA 2GN6A 4DNQA 3VKHA 3TBKA 4WXEA 4XX1A 2FZVA 4RNCA 2OVFA 3ZGXA 3LPLA 4NEQA 1E0JA 4Y2RA 3U3ZA 1E0SA 2QN6A 1Z0AA 2XMBA 2ZYDA 4BWFB 5HJ5A 4A6DA 2DLNA 2P9EA 2GYVA 4AU1A 2WTEA 5HIKA 4TYMA 4P5PA 1UFKA 1U3WA 2CCJA 3RSHA 3MLEA 3GPCA 3OE7A 4G5OA 4H15A 5J47A 2PXAA 3N2LA 3W5UA 1DPGA 3QLUA 4AS2A 4YCNA 1S8NA 5TMDA 3BE8A 4QPJC 3UK7A 1UZNA 4JI4B 2AI3A 2V1UA 4L50A 3UW3A 2WWHA 3C3DA 3TH5A 3F73A 4E2WA 3ZQUA 1UWLA 5JD5A 2BM8A 1K4YA 3GCGA 1E9FA 3G5TA 3UICA 3MJTA 1PHRA 5MGBA 3EXHA 3OT4A 3WYBA 5L4LA 1TT5A 2NSHA 2RGRA 1AQJA 2DOKA 2GWHA 3GG2A 1TTHA 3N6VA 1RKUA 5TNXA 2D1SA 3A3NA 4A4DA 1KVSA 2VDQB 2XT6A 3O75A 3V4OA 3GLFA 3ECCA 1JG2A 4XDHA 1WLYA 3CUTA 3L40A 3CEPB 3BIOA 3CTPA 4FB4A 4CLHA 2QTRA 2PBLA 4P4NA 3V1UA 4GSLA 4PVDA 1AOXA 2R1TB 1HLGA 5JYEA 4XYBA 2IUFA 1CXZA 3BIFA 2J59A 3FZGA 4MR7A 4RSMA 1CR1A 3N59A 1JAHA 1XVAA 4IJVA 3WG9A 1XQ6A 4HWSA 1XQVA 1EUCB 5L4SA 2DWOA 3VU0A 3A4LA 4PG7A 3OURA 4MP6A 3VPHA 3S70A 2VXOA 3QA3E 4HAWA 4IVPA 1YS2X 3CNQS 2CLIB 2G4CA 3KKQA 4LBZA 4NEHB 4IY1A 4P2BA 4BZXA 2Q5JA 2NZEA 3C3MA 4KQ6A 1AB6A 1SC6A 4KPEC 1V71A 5DEIA 1M1NB 2BELA 1T2CA 3IIEA 4KACA 1KZ9A 4PSKA 5D5HA 4HWRA 1EXNA 5ARDA 4EH1A 3KAPA 2OBLA 1Q50A 1ZXLA 2AC2A 4YWJA 4N0EA 3X2SA 4DEYA 4NP6A 4O2AB 5IJ9A 4DKJA 4U4LA 4RTNA 4PSAA 4YVFA 4AJEA 5M29A 1VGNA 3LKDA 2BKUA 2C9MA 3QVSA 4IM7A 3TCXB 3UMFA 2GK4A 2UV8A 16PKA 1LV8A 1T43A 1VZ2A 1NGSA 1X8LA 3NORA 1UBSB 4M55A 3ROKA 4Z5XA 2CFTA 3QYFA 1Y82A 1BVRA 1XCBA 1OXSC 4BCDA 1AZWA 4XVQA 2ZRHA 2YN4A 3AZPA 4UNSA 3EULA 2OD9A 3GLVA 4XJXA 3SZOA 3I1IA 2O5CA 3UAZA 1UCFA 1E99A 2ISCA 4CM3A 4EYKA 3NHRA 3WHIA 5AI8A 2AMYA 3AERA 3A6GA 3MWLA 4LXQA 4D56A 1RVDA 5E8RA 3OCWA 2BMWA 3UWPA 3N2IA 3I61A 3V34A 1YJCA 1JF8A 3FNFA 3IOBA 3E4DA 3UAVA 3ZYCA 1LSUA 3FCOA 4LSMA 4CUJA 5IU6A 5HTOA 1LW7A 3W8DA 4M1ZA 3U7GA 1H69A 5LA6A 1QHNA 3GA5A 4M1OA 3SEQA 3OKCA 3D6FA 3T06B 2E1RA 4D92A 5LN1A 1DJPA 1R9GA 1YA4A 2JKVA 4G5YA 2GBLC 5KHAA 3E22B 2O54A 2XB8A 5LLTA 2VF2A 3FAIA 1RQLA 4C30A 2B5OA 4P4TA 1KP9A 3LVZA 1SMLA 1CULC 3HJCA 4LUCA 3EZGA 3Q0TA 1T6XA 5BSFA 5DV9A 4IEEA 2EL9A 4DRYA 1V47A 3P9QA 4X6YA 4X94A 2G9QA 1PWYE 2F3SA 2VF7A 4JLPA 5B7GA 1JMKC 4NK5A 4F5ZA 5LMUB 1FDOA 5BT9A 2FZ5A 2V7QD 3EB9A 3RYFB 1DAPA 3BN3A 1PKXA 2X9NA 3KVVA 3VNAA 5TQJA 1O97C 3WLJA 3OJOA 4QKQA 3E3AA 2J1LA 2B4KA 4BE7B 5JSYA 2AMLA 2DBYA 1ZXXA 4OUKX 5T4BA 4B74A 2V0GA 4PX2A 1VLMA 5CH8A 4WUTA 4YIHA 3UAXA 3PDWA 1X42A 4CU5A 5BXQC 4WFJA 4QFCA 4HLNA 4YBRA 4B4VA 2ID9A 2MMGA 3V00A 2VQEB 2JIMA 4PPGA 3GIWA 4F11A 2H06A 2PD3A 4J16C 3ZXSA 3BSYA 1GPMA 2F3PA 3AT1A 4CKWA 7MHTA 1R0KA 1F2UA 1JHYA 2IHJA 4LPSA 4DJEC 5EPEA 3GUZA 5AYVA 1XAIA 1C1HA 1B3BA 5GADl 2I4NA 2XDQB 1EDDA 4YNBA 3ZDRA 1QBKC 1DBPA 1T5LA 2B0JA 1G1MA 3IAM1 4X6UA 3MGBA 1PJRA 1C0PA 1X19A 4LQ4A 1SVMA 3QOFA 1JZQA 1G8FA 2ZREA 2W00A 3QXJA 4NYJR 5K2OA 4IDAA 4GBJA 2WIKA 5EIOA 4EY6A 5B4UA 4NPCA 1EWVA 2W6OA 3DE4X 4IUCS 4ZXPA 4B8WA 4BQNA 1AA9A 4CLDA 4D26A 1JHRA 1CUUA 3FBWA 1ONNA 5B55A 3VYWA 3EGXA 3D7MA 1N0IA 3E4CA 3RGGA 2HT1A 2ZZNA 4LTNA 2JJ8A 3HH8A 5MN4A 1OWNA 1PQ4A 2DULA 5A3VA 1ZK4A 2GN4A 3AFNA 1O6FA 1WPQA 1JQAA 4MA4A 1SO8A 3RR2A 4MVJD 1HBJA 1GEEA 4HDKB 1NMSA 1AS3A 4UZFA 3OLVA 3R6TA 4LJYA 4PHTA 5C5DA 4AG3A 2Z2IA 1ZY2A 3Q5DA 4GBGA 1MNQA 3V3TA 3KQWA 1CEQA 2Q7DA 1S01A 1VLVA 4OCZA 5IT9A 1KYXA 3G5LA 3LT4A 3ZHUA 1HX7A 3WNDA 1QV6A 4QXPA 1PUIA 3L01A 4L78A 4DMGA 3HPRA 1AQNA 1CT9A 3VJMA 4E5YA 1E1CB 1E2BA 3CUVA 3N07A 4J0EA 5BR8B 3CLHA 3U44A 4KXFB 1GM5A 1FFXB 2WSSD 1M0EA 4GPIB 4FHEA 1S2NA 2WZBA 3I53A 5DLPA 1N25A 4H4EA 4Q9HA 2VBGA 1HT1E 3A6JA 3Q6IA 1T2NA 1MKYA 2PBFA 3MTAA 1GCUA 2QS9A 4W5WA 2FCAA 4YQFA 5IH3A 5LMZA 1IBLB 4Y2SA 1UPCA 1X2EA 4R7TA 4IUDS 1YRBA 3UPUA 4FZVA 2X0FA 3U7HB 1WUIS 3RU2A 4BASA 2EHDA 4AQ7A 1TM7E 5B7QA 5AQ1A 1SRQA 1E3WB 1WCXA 4WOPA 4EFZA 1XHFA 2ANBA 1ZGAA 4X1YB 4DBZA 2F1JA 1EP2B 3DFKA 2ZT7A 3IODA 1SMKA 5DI9A 1UK6A 4HNGA 1S3GA 1H94A 1NR5A 2MSLA 1ETUA 3PNOA 4M9XA 5GQSA 2V59A 3L0CA 4HYQA 3WGUA 2TSYB 3RODA 2NUAA 1TLFA 2XTAA 1B8OA 3B6IA 4AWXA 4ND4A 2VDNB 3D6VA 1CJSA 2YWBA 3UB4A 4DMCA 3PP8A 5TPZA 3RC7A 1WDKA 3WDKA 5D8DA 3I58A 1DKLA 4N12A 2ZTSA 4UBOA 3FMFA 3VYRB 2OK7A 4A27A 2BUAA 5AXRA 1ONSA 3OLZA 4D1VA 1E89A 3KJFA 3N2KA 2IUTA 3AP2A 5EZSA 2ZSIA 4E5KA 1D2EA 3LCCA 3QG5A 3S2UA 4H6XA 5HWSA 1VCOA 2W6QA 3PGKA 4WGFA 4UM5A 1AZLA 1FSZA 4GMKA 5SY9A 5JEDA 1XZ8A 3RUPA 2NXWA 4DZRA 2ZO4A 4AJIA 2J4DA 4TZ0A 3HR7A 1AUOA 3EZNA 3IBYA 2X86A 4MK4A 3QNMA 5DMHA 3GEIA 3Q9NA 2ZR0A 1P45A 3MFYA 1SHUX 4MPJA 1KP2A 3C1AA 3UV6A 2JJMA 4UD6A 1CY1A 4NJEA 2IXAA 4P22A 4AUEA 3KALA 4B3JA 1J6UA 2QG6A 3ZCRA 1H8HA 1G7TA 4B9AA 1EK0A 2ASEA 3DNPA 1IG0A 3E2MA 3KOYA 4EMSA 3AIOA 2AGVA 2C61A 3FI0A 3ILYA 4C88A 3AL0C 2OCBA 1ZNWA 1P74A 1CFJA 3RARA 4NX2A 4M1MA 2EGGA 2R3SA 3GLHE 1U3VA 1I6LA 4FHDA 1IMOA 5HFJA 1DUVG 3RHSA 3U3KA 2J33A 2GPJA 1W2GA 4ZICA 3H4TA 1HDCA 2ZAGA 3OLCX 1SHTX 4I4LA 1JIKA 3TDKA 4MQ4A 5E7IA 3EOZA 1F8FA 4L85A 4GGMX 4N5HX 2YNUA 2UZAA 1XD8A 3JR3A 1YBMA 5GVRA 3R5TA 2CV0A 2FMTA 4EJFA 3Q6NA 3WS7A 4EBFA 5EG5A 4YWHA 2Q1XA 3K1AB 1NPDA 2PD6A 1L8QA 4FYKA 3MCVA 4O2BA 1NNI1 1P75A 5DNEA 4FDTA 3CUYA 1Z16A 3H3JA 4KO8A 1L4GA 3D43A 1JWBB 3AJ8A 4WY5A 1CHNA 4QQKA 3OKFA 3NTUA 3DGEC 1IBCA 1YQEA 5SY6A 5TJHA 3G0BA 1KDYA 3A1WA 1UC4B 3D5EA 3RU7A 3ROFA 4CF3A 4OHYA 4GYUA 2PLWA 4L51A 5L8VA 1IJKA 1K6MA 2C95A 4JT8A 4MWDA 5DCUA 3W90A 2CVFA 1AS0A 3E2IA 2ZJFA 3VSAA 1OE0A 2RI1A 1KZGB 2YXDA 1EYZA 2IIQA 3HMKA 2X0JA 2R9VA 1WXXA 3L7NA 4QO7A 5B1HA 3LX4A 4LYYA 2XVMA 4BY9E 3D7KA 3UWKA 4KFSA 1U0GA 4ZU6X 2Q5FA 1LH0A 1U2TA 3G17A 3WKAA 3HN6A 5HH4A 2H2FA 1UBTS 2LBPA 5JCZA 3GLGE 4MKHA 2NUPA 5I9SA 3I2HA 1WZNA 2W6ZA 4XUEA 1H9BA 5ALRA 1QG4A 4J3JA 2HGZA 2YV3A 1Q95A 4M0CA 5ESXA 2YMQA 4DA7A 1OVGA 4L5CA 5JECA 1SBYA 3JU3A 4AZ0B 1KY2A 4QPZA 1H2ZA 4O08A 1A27A 2H1WA 3NV7A 1XXHB 2Z4SA 2ZIUB 3F7OA 3NBUA 3WLHA 4KK4A 4XIIA 4M6WB 4PAQA 4LX8A 1T4GA 3DXYA 1MFPA 4MTLA 1XF1A 2C83A 5LBUA 5LLSA 3TTVA 4NDAA 3CNLA 3T3MB 1ZR4A 1QZTA 5C8XA 2FSVC 4PWZA 5AJUA 3GFBA 1PDVA 4IZHA 2WFMA 2O52A 3W2FA 3OIYA 1M8KA 4FU0A 1UJ2A 3EXAA 5JDIA 2IELA 3E9DA 1PFQA 1QK3A 4IKPA 3K8QA 4F2PA 1VE1A 1N7IA 2FXVA 2BCGY 5FUBA 4EKNB 2YFKA 4RETA 1VHJA 1TO2E 5HSGA 4NZZA 3PE4A 3EOAI 4CM8B 4TS4A 4EUKA 4KYTA 1EP1B 1SHKA 2N47A 1H2FA 2B36A 5EJ8A 2GFKA 1LB1B 4NCAA 1P7YA 3KCQA 1NI4A 1RXYA 4RD6A 4UDOA 4NCXA 1RQ2A 1CP3A 2FI1A 4IRUB 4LK2A 2ZSHA 4JUBA 5AK4A 2EYUA 2O8FA 1SHZA 2DTEA 3FWYA 1MLDA 2VYVA 2H9AA 3IE2A 5BP7A 1CVIA 3NJ8A 1YZNA 2N3ZA 3QWHA 3V6MA 3RVKA 3NTOA 1XRRA 5CA1A 2WC1A 3QSGA 4UU1A 2ZXUA 4R51A 1KI7A 2PX8A 3Q3CA 2ZVQX 1E3DA 1POWA 3MXTA 3PIRA 4K9LA 4KQHA 4K6MA 4A2QA 2V7PA 5EP3A 2A67A 1ZD5A 4RLQA 4ZAWA 5HHTA 3OOYA 4WXPA 5AVRA 3PD1A 3K32A 2F8TA 1WDWB 2WMYA 1V6AA 4Y1RB 4DJ5X 5HRCA 2VHWA 5AW9A 3KDAA 4JKYA 4UHDA 2PPLA 4HH0A 3H87A 4JUDX 1ZM4A 1UT5A 4EGFA 4TS1A 4O4JA 2M9MA 4DPMA 3ZDYB 4OQYA 2NYUA 5DK4A 2VS1A 2O2ZA 1PLLA 1ZGJA 3Q10A 2H7YA 4U63A 3UXEA 4KN8A 4B6GA 1BD4A 2WHPB 3Q6MA 5IJXA 1KMIY 1Z0JA 1O94D 4EL0A 2EW2A 1NSFA 2MHCA 3HYRA 2D1QA 2XNDA 4G0MA 4JLSA 1AKYA 4EKGA 1QXSA 1NW5A 1BA3A 3TK1A 1CE8B 1HK7A 2VHJA 5CCEA 1T35A 1K97A 1QIJA 4KCGA 1OTXA 4MRRA 1NMQA 3KS9A 1L8OA 4KIJA 4H7KA 5DEOA 1E61A 3DH0A 4CQMA 1E1DA 4BNYA 4YPFA 1X7WB 2OD2A 4YRJA 1R4NA 3EVZA 3LC2O 2ODBA 1A9TA 2UVQA 4EF5A 1YAJA 1QH8A 4WKPA 2HIMA 5EZYF 2HHAA 4UARA 1CB7A 4ZZ0A 3QUTA 5HEKA 1N3YA 2W6MA 4UBQA 3T3PB 1P9WA 1UBKS 3L6RA 1G20E 3TS1A 3V2GA 3H9JA 1WHSA 2V7TA 2DF8A 3DO5A 4GMDA 5KTKA 3HEAA 3TQRA 2JVIA 4Y6OA 1PT7A 1QIKA 1UANA 4CN9A 2AN9A 3I9V1 4G81A 2SCUA 1HRKA 1XIVA 4YMVA 2PMCA 3HNOA 3M9WA 1E3SA 3WJ2A 2ZIZA 4MWCA 1J06A 3SZMA 3W2TA 2AF4C 2ODNA 2WMOB 4FYJA 4PFKA 3WKBA 4AJ2A 4N8DA 4EO7A 4F4IA 2JLBA 1OWOA 2JLCA 1ZOPA 1KVUA 3K9QO 4KGDA 4LDZA 4EHDA 2PUCA 3KX2A 4PICA 1QH1B 5HQJA 4DLPA 1E0KA 3B5JA 4ZYZA 4ZNBA 2UUPA 3NYIA 5DCWA 4QM6A 4QFDA 3H97A 1P3JA 4MR9B 4CGZA 4EHBA 3RJ9A 2PWPA 2H11A 3MILA 5IXYA 1FFAA 2R1VA 1E94E 1EUQA 2M1XA 4PINA 1E0AA 3EK2A 3LLSA 4MVJM 5FOXA 1KY4A 2O6LA 3DBRA 3LGXA 4Z0NA 4ARBA 3D8BA 4DZZA 1E2PA 2B6HA 2R7KA 4RGQA 2OXEA 3JXPA 4EB6A 1PFVA 4FR0A 1IJBA 2VK8A 4DM3A 4N3CA 1FE8A 1O4VA 1U1CA 3LPCA 5G1PA 4YTEA 3DO6A 2DKOA 2GJ9A 2WW8A 2LW7A 2ZATA 2NM0A 4X9XA 1RXVA 2VH1A 2MSEB 4GLFA 1P1HA 3IA2A 3NTVA 1B8PA 1KZHA 4MS4B 1Z4LA 2AEMA 3N6XA 3OCXA 1P9NA 2X5NA 4YRDA 3GLIB 1QQTA 4YJGA 1RZRD 2GZ3A 2ZR7A 2BM1A 3GGGA 4Y2HA 1PBNA 3ZBTA 1BSVA 2RJ3A 4M83A 3GEBA 2XRMA 3MZ0A 1OIXA 1XTRA 5BORA 1B1AA 1WOYA 5DXFA 4BMCA 4YONB 4UEOA 5K4GA 4JBNA 1E2JA 2RIPA 3QIVA 4H7IA 1N6IA 1VGQA 2Q7OE 1E59A 1E0DA 3SC2B 2DG2A 3N8GA 3RS4A 3VR4H 1PF7E 1J8DA 1U11A 2WD7A 2HY7A 2AA3A 4NAUA 1Q7GA 2DUUA 1Q21A 3BWMA 5K3FB 4WK0B 4F9GA 1XRSB 4GR4A 3GJ8A 3M3HA 1VRWA 3PENA 1U3TA 1N2CE 2PRKA 3GUYA 4OJYA 4MV1A 4NZPA 1YWGO 2FDXA 2RH9B 3AM3A 4QYIA 1BXGB 3GJ3A 1YL6A 2EBFX 1DLIA 4TTIA 1EAMA 3GHYA 3D3KA 4HPWA 5IC5A 1ZM9A 1JQEA 3CW8X 3H0KA 1L5NA 3WLRA 4ER5A 4MW7A 4MKIA 2IXBA 4GFDA 5HVNA 5HKOA 3TECE 3PR2B 1J2UA 2ZGVA 4NYIR 4Y2VA 2HO5A 5IASA 1II9A 2ZI5A 2V6MA 3PICA 1ONOA 2PSHA 1P8JA 4DA0A 4O2BF 4BQFA 1Q0ZA 2PQ0A 3N39C 3CPHA 3AKEA 3Q7IA 5K8CA 2D5BA 3KV3O 4QDTA 3KAJA 3NTRA 1G3QA 4I8IA 4XKJA 5EOVA 2FX3A 1DMRA 2AC4A 3FTNA 2Y1OA 4ZVNA 5A4JA 2FXIA 3HYCA 4QZVA 5K99A 4F4FA 3AHFA 1SOAA 1XELA 4ABYA 5KAPA 4JLBA 1KH3A 4OLBA 4LXIA 4UUAA 5LDGA 1Z6AA 1UADA 2I7TA 2GN8A 2GN0A 2YR0A 3ZW7A 4HT3B 5I7RA 2REXB 2B2XA 5KMGB 1PQYA 2Q1WA 2XCIA 3PR3A 3DZFA 3ZNOA 2XF2A 5BUQA 4FQ7A 3FCYA 3GFSA 5TR9A 2C5FA 4QVIA 1N36B 1SCIA 3FCUB 1IXSB 4G4IA 5JROA 1GU0A 1YR6A 5IF9A 1L2TA 3FWKA 1T2VA 1DQNA 1HWYA 3BWCA 3FTDA 3IUBA 4I55F 4E1VA 1RI4A 4PBTA 1WAMA 3EVNA 1KO3A 1UK8A 3H84A 3KEOA 3M1LA 3QX3A 4QXQA 1HFEL 1B26A 2AWOA 5IT4A 4O4LA 1E64A 4FYPA 3ESHA 1LD3A 4HVCA 2E7YA 3H99A 3H5VA 4OB7A 2FMIA 3KYDA 1G5TA 1EH5A 1T8UA 4FE4A 3OCZA 2ZUFA 1Q3TA 2ZI6A 4LQLA 1AIPA 4JUIA 2G17A 5EE3A 3C3BA 2YZGA 2I3DA 4B3FX 4CMCA 4ZKDA 1XHEA 4F6ZA 4C0SA 3KL7A 5B3AA 2IPNA 1IWPB 1TQ4A 2OGTA 2FN3A 3KL2A 1RWOA 4Q93A 4RNDB 1L7MA 1Y48E 4LJ9A 1SXGA 2Q5QA 3B1WA 4JC0A 4RMJA 4IDCA 4ZWNA 4G5HA 1TXGA 1NXWA 3VSCA 2VDVE 5ITZA 2VTBB 1A50B 1ZMRA 2G25A 4LECA 4CT5A 1QP7A 3BDIA 3UIEA 3VHRA 1S0UA 4JJGA 2I6GA 2FEPA 2P91A 1QOPB 4YMGA 3K09A 1NVVQ 1K07A 4Q19A 5LQUA 4HH4A 4UAVA 4FCVA 4Z99A 1G5PA 1MH1A 2E49A 3I4FA 4LJSA 4DY6A 4YP7A 2GN9A 5SZIA 3DMNA 5K6AC 1XLTA 1FDVA 1WKCA 2REQA 4Y6GB 3NV9A 3AJ3A 1H1LB 3UF0A 2K5UA 3V55A 1B2LA 2YMPA 2R48A 1IB6A 2G06A 4IZIA 4IAOA 2R00A 2BBOA 1UXOA 5ITWA 2FWPA 3TIGA 1S7GA 2WYVA 3FIJA 3I64A 1CY6A 2WHRA 3YASA 2HK9A 1A98A 2R5WA 3TVDA 1T91A 3L8FA 1VDMA 2C2XA 3MJVA 4BGUA 4D44A 4KXLA 1Z5GA 4P3NA 3UAWA 5CA1F 1VBNA 2BWJA 2V6BA 1P5HA 1LVUA 2AG1A 2DTXA 3QE0A 4DF3A 1P1FA 3O2NA 3NGMA 1XALA 1C9YA 4I19A 1XU9A 2FKAA 4DAOA 2ENWA 4DRXB 3RVMA 4YPVA 1RRGA 1W75A 2A0FA 1MPXA 4WSOA 1CUDA 4RY8A 4G1UC 2J9GA 1EAYA 4EGCB 2MIIA 3G7SA 3I0ZA 1UJBA 3OU6A 4JGIA 1W35A 3TJMA 1OFUX 3BTSA 1CF4A 1V5WA 2DU8A 4D6PA 2ZTUA 3G9XA 3BYZA 1FTWA 3J81A 2NNLD 2XNHA 3A3KA 1KPHA 2AEFA 2R47A 2QM7A 4AAYA 3KVYA 3AR3A 1QHHA 4WJKB 5SYAA 1C0LA 2W6IA 1VKZA 2E4XA 1R6XA 2HA7A 1P5ZB 2I1LA 2JFYA 2O3TA 2RHBA 4E3ZA 1DL5A 1I2AA 1M0TA 1TVCA 1QCYA 3NHJA 1QQ6A 4YUVA 4RZ2A 1RSZA 3A4YA 2FUKA 5B15A 4ZIRB 2JIDA 1LI5A 4JKOA 1QS0B 2X1MA 1DAIA 3B9RA 3C1OA 3OCYA 4HNQA 4XD7A 2HL6A 4KQEA 1JDBB 1GNPA 1Z74A 2VHTA 4U7GA 2O7RA 1QDEA 4OLAA 4HLCA 4YEDA 3RAJA 1QFSA 3D2AA 3V80A 1MEEA 1MXHA 1Z6XA 3V1NA 2O2GA 1A9RA 3NJRA 4Q3OA 2QAIA 4P7KA 1Z6GA 2IIVA 2WSYB 4MLDA 3GT3A 4UBLA 1E2DA 3I04M 3HB5X 5FQNA 3T7DA 1PDOA 2FPWA 3MINB 1CLEA 1U0JA 2X9GA 4UOZA 1CCWA 4EITA 1GPWB 3CFYA 4G9EA 3W9YA 1RJDA 4TWBA 1FMFA 1GTVA 4RJLA 2A9RA 2Z98A 5F5LA 1KAMA 2PNFA 1UMBA 2HMVA 2ZYGA 3JQ9C 3MTBA 4M1EA 4UAJA 3TJRA 2HA2A 1AMOA 1PNRA 1SQSA 4Q4AB 4FGSA 4QPCA 4CE6A 1R6BX 2VOEA 3MQFA 4YT5A 3PY5A 3IUMA 1VHWA 3UK6A 4G37A 1R0RE 1TCUA 1P4GA 4NECA 5GOTA 1NN3A 5JNLA 3SZ3A 1U2ZA 4BNUA 1YASA 1I2CA 1PS8A 1RM4A 2F3UA 2VJNA 2IWRA 3ZQ4A 3EMKA 1NBME 4D99A 4EOGA 1GRNA 1W85B 3TTXA 2ZSUA 1GQOA 4XCQA 3SX4A 3ADRA 1FNDA 2RGXA 4JUFA 1W9MA 2WPNA 4WLVA 1EXMA 2BH9A 3FE2A 4ZCTA 1LPAB 3UHPA 1V8OA 4XDZA 1FSPA 4Y2GA 2MYPA 1G21E 4RJ2A 3FVQA 3OPQA 1YR9A 1ZRSA 3HA3A 1DIAA 2B9VA 2RJNA 2Y1EA 3CPEA 2H0RA 3MOSA 4LC0A 5HKLA 2HSEA 1BMFD 1PQUA 1ZA1A 2QXTA 2D5CA 5G0UA 4Z51A 2WAMA 5KVVA 2FUCA 3BK2A 4FOOA 1TW2A 4NMXB 1UKCA 2WJWA 3QV2A 4ACAA 1WCV1 5HIAA 5LXTB 5JSHA 4ARZA 4C0QC 4MNTA 2OV6A 3NTLA 3SE0A 4CR8A 1YE3A 4PSUA 5EWLB 1Q0SA 1QRTA 4LF7B 3RM3A 4A6XA 2I62A 3WHPA 4H0FA 2VYNA 4R3NA 5DM0A 3RREA 1W4BA 2N1BA 3H5LA 2H4WA 4A2CA 5L40A 3H4MA 2WNIA 3K2IA 4Q66C 4TZKA 3TR5A 1P3Y1 2A9QA 4C4OA 2GNAA 2NVUB 3AG5A 4MEJA 3K4PA 5CFNA 5T6BA 5HMLA 1PWEA 5FQAA 2QSJA 2H29A 1MW9X 2EGHA 2O6HA 3PHBE 4P1ZA 5AUPB 5KSOA 2C2MA 4ITRC 3WJAA 2BTQB 4R6WA 2JEOA 3NDIA 1N2EA 3C8ZA 1TM4E 2CDBA 4TMYA 4AJ1A 1G3RA 5HGJA 4EW2A 2GT1A 1JDNA 2ZEJA 4QYXA 1C7FA 3NAGA