1E5DA

Rubredoxin oxygen:oxidoreductase (roo) from anaerobe desulfovibrio gigas
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
401
structure length
401
Chain Sequence
b'QATKIIDGFHLVGAIDWNSRDFHGYTLSPMGTTYNAYLVEDEKTTLFDTVKAEYKGELLCGIASVIDPKKIDYLVIQHLELDHAGALPALIEACQPEKIFTSSLGQKAMESHFHYKDWPVQVVKHGETLSLGKRTVTFYETRMLHWPDSMVSWFADEKVLISNDIFGQNIAASERFSDQIPVHTLERAMREYYANIVNPYAPQTLKAIETLVGAGVAPEFICPDHGVIFRGADQCTFAVQKYVEYAEQKPTNKVVIFYDSMWHSTEKMARVLAESFRDEGCTVKLMWCKACHHSQIMSEISDAGAVIVGSPTHNNGILPYVAGTLQYIKGLRPQNKIGGAFGSFGWSGESTKVLAEWLTGMGFDMPATPVKVKNVPTHADYEQLKTMAQTIARALKAKLAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUBREDOXIN\:OXYGEN OXIDOREDUCTASE
molecule tags Oxidoreductase
publication title Structure of a Dioxygen Reduction Enzyme from Desulfovibrio Gigas
pubmed doi rcsb
total genus 145
structure length 401
sequence length 401
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1e5dA01
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1e5dA02
3F6RA 4GCWA 4YQEA 3FNIA 4FGKA 1OBOA 1AHNA 4C1CA 2YNTA 5ACUA 3IDZA 1JA1A 2Q0JA 3IEMA 2V5UA 2XF4A 2Q9UA 1FLVA 1KO3A 3I15A 2MWMA 3B6MA 2BFLA 5EA2A 4F8YA 5A0VA 4QOIA 4QOFA 4TYTA 2DOOA 2FLVA 4D02A 3TZBA 4GYUA 3KNSA 4Z5YA 4ZVLA 4NLLA 1KR3A 2GKLA 2QEDA 1AKUA 4JO0A 4LE6A 5LS3A 3FCZA 3SD9A 4ZO2A 3OWXA 1CZLA 2FZ5A 2AIOA 2OYSA 2M5DA 3I11A 5EH9A 3ZWFA 5JROA 2BF4A 2R96A 1BC2A 2YNVA 2BG8A 5LMCA 3X2XA 5B3RA 1XT6A 3DHCA 1C7FA 5EMNA 5FA6A 4FR7A 3U7RA 2ARKA 3K20A 1A7TA 3AJ3A 3F2VA 1DXKA 1FX1A 2FU9A 4RBSA 5AXRA 2ZKIA 4PTYA 2P97A 2QX6A 4P62A 4Y9RA 4YSKA 5HH4A 4D1VA 3EDOA 4EYBA 2Z9DA 1CZUA 4QOHA 5HH5A 2W5UA 4BMPB 5HISA 3PY5A 2NZFA 3SFPA 2FX2A 3MD7A 4Y9UA 1WUOA 2E7YA 4AD9A 1RCFA 5EWAA 3SVLA 3NHWA 2OHHA 3ADRA 2QX4A 5LVAA 3IEKA 3EYWA 1AKRA 3NHUA 3KEGA 5ULLA 4GYQA 4NQ4A 2FAXA 4UWOB 4N65A 2Q42A 5LE1A 1H69A 4YAUA 4FSBA 1FLAA 3IELA 5ACTA 3W77A 2Y8AA 5KILA 1VJNA 1KBQA 4UAMA 4U7GA 1FTGA 4KEQA 2HNAA 4BMOB 2ZWRA 5AYAA 5K4NA 4V0HA 1DXQA 2Z9BA 3H3EA 4HL2A 3B6KA 1XI2A 1QRDA 5A5ZA 3LT5A 3F6SA 2N1MA 4WD6A 3N39C 4YALA 4Z7RA 1AG9A 3FJOA 2BPOA 5B3LA 4QOGA 4R81A 2P1EA 4DY4A 1JA0A 1KO2A 4Z5ZA 4DILA 1D03A 5K4KA 3VQZA 4C76A 5LM6A 3HLYA 4F6ZA 1J9GA 1CZHA 2QX8A 3ZHOA 4YSLA 3RPCA 2X2OA 2VW8A 2XODA 4Y7CA 3DHBA 3ZNBA 4U4LA 3TP9A 1QH5A 1ZTCA 3P2UA 5EVKA 5ACXA 1YCHA 2YCBA 4TZFA 4B87A 2ZZIA 3IOFA 5EVDA 5LCAA 5LBTA 3I13A 4LAFA 3BV6A 3R6WA 2QJSA 3NHSA 4GR9A 4XDHA 1T5BA 2P4ZA 2ZNBA 1FLNA 3O2NA 1ZKPA 2QX9A 2QDTA 2AMJA 2GFKA 5HIQA 2BG7A 2YNVB 4H0DA 1I1OA 2RG1A 1YCFA 2KLBA 4QOJA 2Z9CA 2WYLA 4ZVKA 1JJEA 4GI5A 3HA2A 1KBOA 4QODA 3ZR9A 5LLDA 4ZVNA 3UXHA 3L9WA 3OX2A 4S24A 3B6IA 5B3KA 1FLDA 1XYYA 4CF6A 2I7VA 3SRXA 1DDKA 4NQ2A 3WXCA 5FQCA 2BFKA 3IE1A 4C09A 3X2ZA 4UWSB 2XOEA 2M5CA 1ZX1A 1QBGA 5KIKA 3SW3A 4J5FA 2YNTB 4M0CA 3KL7A 3G5MA 5ACPA 4C0WA 5B15A 2FU8A 1DXOA 4XWTA 1WUPA 3X2YA 1CZRA 1OBVA 2YNWA 5K4MA 3KAQA 2BMIA 4EFZA 3L9XA 4XWWA 2WHGA 3GFSA 4Z60A 1T0IA 2A7MA 2I7XA 3Q6VA 1BVYF 3U7IA 4HEQA 3L6NA 4XUKA 1J9ZA 3TE7A 1ZWKA 1ZNBA 1ZWLA 1C7EA 5F4BA 3UXEA 1WRAA 2QDSA 1X77A 4XDGA 2BIBA 3HR4A 1YDGA 3PG4A 1X8GA 1CZKA 4PVTA 3BC2A 2H6AA 2M6SA 5A87A 3T3NA 1B1CA 5DPXA 4U7HA 4ICIA 1DX9A 3S0ZA 5A4KA 1QR2A 2YZ3A 3I0VA 1VGNA 2NYPA 1JT1A 2KQUA 1AKWA 1AKQA 3W79A 4FEKA 3ZQ4A 1JJTA 1CZOA 4D1WA 4PVOA 1YCGA 2BN4A 2D5IA 3S2YA 4BZ3A 3T3OA 4FGLA 5F51A 3N3BC 6NULA 2BMVA 1YKGA 1QH3A 3RPEA 2FHXA 1WSBA 4PTZA 3VPEA 1X8HA 4N9QA 5EV8A 3N3AC 4RL0A 4D1UA 2A5LA 5AXOA 2FU6A 3W78A 4F6HA 1GG5A 5LJLA 2QINA 4UBQA 3LCMA 1BMCA 4FX2A 2P18A 1TIKA 3JSXA 2BG8B 4DIKA 5A0TA 3ESHA 2FVXA 3OJWA 5EHTA 2WC1A 4UWPB 4KEPA 2QR2A 3KLBA 2HNBA 2NZEA 3GFQA 3I14A 4HS4A 1J8QA 4HKYA 4EYLA 3LVZA 2Z98A 2FU7A 2GSWA 2BG6A 4LTDA 3F90A 4TZEA 5HIPA 3AF6A 5EV6A 1FUEA 3NHPA 2B3DA 1SG0A 4BP0A 5ACRA 4RAMA 2DKFA 2Q62A 5LCHA 1WSWA 3DH8A 1YRHA 2V9CA 2OHJA 5EW0A 2XR1A 3O73A 1D4AA 2Y8BA 3FVWA 5EAIA 2WYMC 5HIOA 3T9MA 3IE2A 3IE0A 1AZLA 3OX1A 3W7AA 2ZO4A 4TZ9A 4AWYB 4C1FA 4YSBA 4RM5A 2BR6A 4NQ6A 1RTTA 1V4BA 2FZVA 3BK2A 3JXPA 5AHOA 4RL2A 1K07A 2BTNA 4OXXA 4RAWA 4UWRB 4NULA 2QMYA 4TYFA 4AWZA 3X30A 2FHXB 1YOBA 4HL1A 3ESYA 1P9EA 4LTMA 2NXAA 1OFVA 1WW1A 3QH8A 3SBLA 5FQAA 1MQOA 5B1UA 3R2UA 3KAPA 4EXSA 2Q0IA 2FK6A 5HH6A 4J5HA 1L9YA 2BC2A 1AKVA 2QMZA 2OHIA 1BU5A 5FUQA 4NQ5A 4C1DA 4C14A 4ESEA 2YNUA 3NHJA 1AMOA 4C0XA 4ZO3A 1XM8A 2FM6A 1M2XA 3KNRA 2FOXA 5LBUA 1E5DA 2Y87A 2BFZA 5TGZA 1Y44A 2BFZB 1A8TA 4N82A 2X2PA 4D1TA 4AX0B 4Z6XA 3NHKA 4O98A 5LCFA 1SMLA 3OVMA 3G1PA 3ES9A 3OX3A 4C1GA 4GQIA 4QOEA 5ACQA 5ACVA 5BUCA 1DD6A 5ACSA 4CHLA 3ESXA 3NHYA 3DHAA 4EYFA 2V5VA 3FX2A 3RKKA 3TEMA 1AKTA 2QWXA 2HB9A 2I7TA 4ZNBA 3ESZA 5LSCA 1CZNA 4YAFA 4C1EA 5IQKA 3K1YA 3NHLA 3NLLA 1XTOA 5F12A 3SPUA 4J8PA 2AZ4A 5NLLA 3QFCA 1H66A 3NFRA 3FAIA 5EVBA 1BVTA 5AEBA 3D7NA 1J9EA 3NHFA 4ZVMA 4UA4A 4TZBA 2MT9A 2WRSA 1X8IA 5FQBA 4C1HA 3FW1A 4EY2A 3QFRA 3OWHA 3IOGA 5K0WA 1XYVA 3QE2A 3AF5A 4AX1B 5AHRA 2MOKA 5ACWA 4H2DA 2WYMA 1FVXA 2HPVA 4H6PA 2R2DA 3RKJA 4U7FA 2FCRA 2GFJA 2R97A 2BGAA 2MTBA 3BK1A 4Z67A 4PU0A 3P0RA 2BG2A 1TLLA 1QHEA 4LTNA 2FDXA 1D04A 2GMNA 3A4YA 1VMEA 1NNI1 3GAMA 1RLJA 4ZEJA 3OJXA 5LJIA 3F9OA 2M6RA 4LA4A 4YAWA 2UYXA 4EXYA 4CETA 2BZSA 1F4PA 2F1OA 1SQSA 2CBNA 5NULA 4FGJA 2GCUA 3GFRA 4YAOA 3PY6A 3B6JA 5FX2A 1HLKA 1RLIA 3NHRA
chains in the Genus database with same CATH superfamily
3ED1A 5E2BA 1PR5A 4I4TA 1H05A 4TXNA 3TLCA 3L6UA 4FGKA 2VNAA 4K1XA 3NI2A 5F3WB 1QGUA 2UZ3A 4IMRA 2R85A 4NYIQ 3IDZA 5EIXA 4PSCA 3KOXA 3FPBA 1C0KA 2Z08A 1MVLA 1M2JA 3JWEA 3WLFA 2FMXA 1VI6A 4LF5B 3ZEIA 3O7MA 3F5MA 3AZPA 3LAWA 1FLVA 3SC3A 2VHUA 3ICQB 1NLFA 4PAWA 1HDZA 1ATZA 3NHAA 2VT6A 4L4ZA 4QPPA 3IHKA 3D7LA 5K3CA 4D82A 4MVWA 4W4TA 4WUVA 5AUNB 4G26A 3D0QA 4H16A 1EP3B 2LE0A 1NXXA 5D7BA 3VO9A 1L4FA 4HKTA 1A4UA 1YQQA 3GLHA 2IPNA 3P9PA 5A9TA 1R4MB 4F5ZA 1U1GA 2XAAA 1QIIA 5IANA 2QN7A 1XVIA 1QMGA 2JHPA 2PT9A 3FKSD 3K0BA 3QVGA 1C8BA 4GOJA 3SC2A 1NBME 5C80A 1W76A 4EDFA 2NVUB 2OYSA 4EY5A 4F3CA 5A5EA 4PDXA 5EH9A 1DRWA 2FWIA 2B2CA 4MIKA 4JI3B 2BKUA 5IHPA 3WOVA 2A33A 2UU9B 2XMZA 3L1HA 4X9XA 2HMWA 1T8RA 5DWDA 4D9IA 4UJ5A 3Q3CA 4UHHA 3AIKA 1Z7BA 3DHCA 4ZVOA 3PFIA 2G80A 2LP4Y 3EVNA 3D64A 3R5TA 4GD3Q 5HF8A 4RTQA 5HVNA 4P34A 1XKTA 2ARKA 2ZSJA 4N12A 1A7TA 1RYZA 3L8GA 3WSVA 5JH7B 3U3RA 1AGYA 4X3CA 4YPOA 1NC3A 4QDOA 5ICGA 2FEWB 2I67A 1F2UB 2O2ZA 4XSGA 1Z0DA 3NYRA 3P5SA 5HH4A 5BPHA 1YHYA 4NOKA 1S8AA 2NO4A 4NCKA 1XFAA 3CCCA 5D87A 3VR5D 1CZUA 2Y0BA 4M8KA 2WMNB 3HJNA 2KE5A 2ZYRA 4PZYA 5TRTA 4CM8A 5HISA 3I4CA 2C4KA 4OL0A 4RULA 3GIWA 1N7HA 1TB4A 4IYRA 3J81k 4R1MA 2I0FA 4U0KA 4ENUA 3KJQA 3CR8A 1UP6A 4AROA 5HOQA 5EWAA 2Y76A 1Q0HA 5L7WA 1EUDB 1A1VA 3WYBA 5LVAA 3EUWA 3K9WA 4NG5A 3TLKA 5LMZA 3P4XA 5CNIA 3UOWA 4NQ4A 4NZNA 1U28C 1NW3A 1TAHA 3NBUA 2W2QA 3SKVA 1HZZA 3IUBA 4JXKA 1BIFA 4JAVC 3VKGA 1FXWF 2YV4A 3MA0A 3NR2A 4OLFA 1P75A 1XQVA 4I3GA 4YC7A 3HU3A 3ZW9A 2G1PA 2O8EA 1EBFA 1MG0A 2Z43A 4JC0A 3TZQA 4P92A 1CRWG 4UZSA 3AI3A 4KQHA 4RE5A 3CUVA 4PPGA 3NM6B 4HH4A 1LF0A 4RGVA 3NBQA 3VOBA 3ZDAA 4INJA 4QPNA 4R8MA 4EGJA 1PJRA 1E2PA 3LK6A 3A4MA 1DKRA 3ZW7A 1LX6A 2NYVA 5AKIA 4CT0A 2C97A 4TZ9A 4MRNA 3RTBA 1AXRA 4LJKA 1E9CA 4P0QB 2YOGA 1RAFA 2OILA 1UEJA 1Z4KA 3B2EA 5K3OA 2W42A 4EG1A 3E22B 2B8NA 3WKAA 2M98A 4I55B 2P1EA 4H3KB 3GGCA 4MWCA 1T5SA 4REMA 1P18A 1T5LA 1W1IA 3V46A 2VP9A 2AR0A 3L40A 2EGHA 1TF7A 5CFLA 5BQFA 4DC0A 3M82A 4YRIA 3HLYA 1Y8ZA 2IEBA 1K68A 1M83A 3AR5A 1JJVA 4NNOA 4GF5A 4Q7LA 3RYTC 1U3WA 4HDSB 3TIXB 4A8JC 4S1NA 5K8CA 1T9BA 4FVTA 2EFHB 3DHBA 4C4OA 2D0PB 5LL6P 3PTLA 3I73A 3A1CA 4E5KA 3P2UA 3DL7A 2V7VA 1IVNA 2YCBA 3G8CA 3OZSA 1GTMA 4RH1A 3ZTYA 1NY6A 2H0RA 4K6OA 4LZWA 3S2EA 3ULKA 4LAFA 1OB5A 3GLHB 3SR3A 3FMFA 5CX1A 4EVIA 1UBNA 1B6TA 2RHHA 3M4XA 2P4ZA 2J87A 1A88A 4EA8A 4OLHA 1UPFA 3TN7A 2Z1DA 4MUKA 4RF3A 4X6LA 3QVUA 2QDTA 3LDUA 4FILA 3A8TA 3ZHBA 5K8UA 4MGYR 1N2CE 1QFZA 1JQLB 1MB3A 2ZUCA 3LM8A 2KLBA 4B6EA 2FEKA 1SC4A 3GT7A 3TD9A 4ZVKA 4IY1A 2VK4A 3MSXA 4PHHA 4TVOA 5KTKA 3Q5DA 4MVXA 4RTKA 2D4AA 4LYJA 4CV0A 3IEVA 4RQTA 2IH2A 5FYQA 2FZLA 1WXWA 3FDXA 3K9HA 3OX2A 3T7IA 4AS2A 2YV1A 5JH7A 2AFVA 1KORA 5BW6B 1GRCA 3PE4A 4DCUA 5BQXA 5EWJA 3H0KA 4WXHA 4EY7A 2GO1A 1G16A 2PNJA 1EP9A 2GD0A 3Q8XB 4Q05A 3BGIA 4C6SA 2MYUA 2GH1A 3HDHA 3R7FA 4ZHQF 4YA6A 4DIBA 5LOVA 3WADA 1BROA 1ML3A 1XDSA 1XPRA 1P2UA 5E9WA 2Q4RA 5ARDA 2BFOA 4DCJA 1A8HA 4II2A 4DMUB 2I3AA 1GDDA 3IIKA 2SICE 5C34B 3GUVA 2VUHB 3IEUA 3LBAA 3VXKA 4XYLA 4DIUA 2VVTA 2JCYA 1W36C 3HRKA 1TEVA 1VI2A 2BRUA 3ER8A 4MR7B 5BSKA 2R86A 2IUSA 5B15A 5JO9A 1BU8A 1G4AE 3CRQA 4RKYA 5SYNA 1RAIA 5J23A 1B0ZA 1PVDA 3GZTB 3T1VA 5EUMA 1SOUA 5AIJA 5B1EA 1NNEA 1V6SA 4KW7A 4WXRA 2GERA 3O9ZA 3VPXA 3R9XA 3D1LA 1I9GA 2BFBB 2P9BA 1R8XA 4K9LA 3L6BA 1M8GA 2QP3A 2VEDA 2ZPAA 1L7VC 1VE5A 1F4LA 1SWVA 2R7KA 2ZSIA 4G65A 4A8PA 4WPGA 2BMIA 2X4IA 3NNNA 3RW9A 5I7OA 3M4NA 4JNCA 3HCBA 4QWWA 1KZ6A 1TLFA 1Z08A 2HHCA 2I7XA 2PY6A 2B5WA 5ICFA 4QJ3A 5BV8A 3Q6VA 3HDTA 3VGJA 3EULA 4XFKA 3PT5A 3TE7A 1UR5A 1CR0A 3B3QA 1PUXA 1SWWA 2FNAA 3EVAA 2EYUA 3X0DA 1WRAA 1RQRA 1XTTA 2FCAA 2AXNA 2J09A 2UUOA 3B6EA 4IXDA 3TUJC 4QHSA 4ZPXA 1EJBA 5DT9A 2QENA 4CZ2A 1ZM3A 1QHSA 4G0WA 1XQXA 3VPFA 3CO5A 2H1IA 1Z8NA 5AM4A 2DFNA 2XCSB 1SOMA 5FBKA 5DGCA 3WB2A 1P2SA 1SA0A 4Q19A 3ROTA 1HXHA 3PGA1 3K5PA 4KC0A 4UHFA 4F8EA 1R7RA 2Y9PB 1M8KA 2BJHA 3I30X 5ER9A 4IFTA 1HKUA 4U2BA 3I0VA 4BC1A 1E3DA 4M49A 1Z6ZA 1ORDA 4I8IA 1R10A 3T3PB 4O2BA 1JT1A 1V8FA 3NIGB 1HY3A 5DHFA 3EW9A 1E2GA 3ZD8A 5KIAA 4K87A 1ZCBA 2I78A 3VKFA 3ZVKA 5IF3A 3TZHA 4IRMA 3N59A 2X58A 1E99A 3AFHA 4ZEXA 3HLTA 2W70A 3PL5A 3JWGA 3QI2A 4R7ZA 2BN4A 2RGNA 4IIJF 4LE1A 4R68A 4FGLA 4DLVA 3CURA 1NBWB 3N3BC 3REOA 3G89A 3WAKA 3GLVA 4DA6A 2XI4A 2Q6OA 1U0EA 2W8BB 3O1IC 4RFSA 5JHGB 3JD3A 1ZCJA 3HCRA 4Y9DA 2PFKA 4DCGA 1J8VA 2C9BA 3QKWA 4C4ZA 1JHDA 3QFFA 2CDBA 4I1OA 1VBNA 2ODEA 2ONKA 1PRYA 5ICEA 1P91A 1PFKA 1YS9A 3DF7A 5FO0A 5F1KA 3PXGA 4GBGA 4MW2A 4CI0B 5IAOA 1AQLA 1TIKA 2WF8A 2YX1A 4W5OA 2XMRA 5BOVA 3RAJA 2IHZA 3E2MA 1PI3A 5B3JC 4URWR 1I5EA 3RFXA 3PUIA 3G2QA 2WM9B 4LJ8A 1OVMA 4KQ2A 3HZRA 1GZ7A 1U80A 2NZVG 2O14A 5EWLA 2Y68A 1FJHA 2HNBA 5EKUA 1JB1A 2Z8XA 3UG6A 1NXOA 3AHDA 3PNMA 5JECA 2FX3A 4X20A 1IN5A 1CIPA 5F1OA 2O2JA 3KU1A 3ENNA 4XQCA 4YT4A 2IOFK 5ARBA 2PWBA 2V6IA 4EBBA 2WMYA 3L4BC 1D0VA 3S2UA 4V2UA 3D7KA 4MW7A 3R7DA 3NHPA 3CZMA 3ZBTA 4LFCB 4PCAA 4FOOA 4RXUA 3PB3A 2IODA 4A2QA 3RRFA 1YRQA 3OQPA 4JLNA 2GF2A 3ZBUA 5DRYA 4BTEA 3VAZA 3FAKA 2RJ3A 4BP0A 3X3HA 3K9BA 3FROA 1QPZA 1KL7A 4YP6A 3CY6A 4BVGA 5FA5A 4CDGA 1YRHA 4RF4A 4PVDA 5JSFA 3KLMX 4FFSA 4DFDA 4RAOA 3NIWA 3UUGA 2EKQA 1QB8A 3IC5A 4BZQA 5HJ7A 1NZDA 3JQPA 3PXAA 5ADUS 3S7TA 3F73A 2P5UA 3DBRA 1R0CA 3EAFA 3GGDA 5FTNA 5GZ6A 1ZRHA 3UT6A 4LV8B 5AUPB 5AHOA 2ICAA 5EMJA 1XJ0A 4NDAA 5U4QA 1RXWA 2AVNA 4GFDA 1F48A 4XPIA 4A0HA 1Y1TA 2CMGA 4RELA 1GSHA 1DX6A 3LWBA 1H8ED 1FFCA 4CLOA 1W88B 2JHAA 5IX8A 3K3PA 5ER6A 2IYTA 3X30A 2GCNA 2H8KA 3SXPA 4ZHSA 4PLFA 4JODA 3FTPA 3WQRA 5DYNA 2XE7A 4HQOA 2P8JA 1TA4A 3AOEA 1DBIA 2PV7A 2WYIA 3VDXA 4CKBA 4TKUA 2BEKA 5LD2C 3SBLA 1ULBA 2AC7A 4UU1A 3TW8B 1EUYA 4AM8A 1M5TA 2R6HA 3OTIA 3TKAA 4DMRA 2CL0X 3TJMA 4TN1A 1U6JA 4HMOA 1C81A 4Y2UA 1GILA 1HM5A 5BWMA 2IZOA 4O5OA 2CMKA 1CX9B 3TUIC 1ZVVA 1ZH6A 3I4FA 4DIOA 3O8BA 3BE8A 4OJKA 2DHEA 2H2AA 1T3HA 3P97A 2V8BA 3D8RA 3FYSA 3ZWWA 3O4VA 4EHFA 3KNRA 2ZRLA 2ALJA 5FBRB 1MO4A 4MWZA 1GU7A 1KAMA 3UVEA 1T24A 4DRXA 1FTQA 4O98A 2YJ5A 4Q3NA 2W0MA 2AQIA 2O4UX 4NFYA 2B4TO 4BASA 3WKCA 3K0CA 4HEA6 4I99A 1PS0A 1UBSB 4LHYA 2M6KA 4ER7A 1UXOA 4YRAA 1RXVA 1ZK0A 1XSEA 5EQJB 1A8PA 4DE5A 1TK9A 4LF6B 4OQLA 2EFGA 2GK6A 3VI4B 1NLUA 1RJEA 3EWIA 4X7PA 4HNUA 1W581 1G6OA 4H7JA 4TV9F 1E69A 4S0ZA 5DHQA 4Q9DA 2R2AA 3KKNA 1KAOA 4Q1DA 2VAVA 2PGXA 2JEZA 3QFSA 1GXSA 4QFCA 3RU3A 1QGAA 4E07A 1E3WA 1E9FA 4E14A 2WD7A 3DLHA 1UBFA 2IWRA 3MG9A 2ATIA 4MKHA 2R7MA 2V74B 2XH8A 2AKAB 5T67A 3W5HA 4DKJA 3G2JA 1XC7A 3QVLA 2UZ1B 1E59A 3BEOA 1HMPA 1I1QB 3P2YA 4RD0A 4ALIA 4EYEA 4I81A 4E0BA 3TL3A 2OXEA 3NHFA 4KXWA 5FTJA 1JHVA 1WTAA 1EFPB 1JEAA 3L7LA 1Z18A 3ZWXA 3ZWBA 4AUMA 3HCCA 4UMFA 3JWHA 4C78A 3P2EA 5BNWA 1CUSA 3CE9A 6ABPA 2AF4C 4HP8A 2FV8A 4J03A 1AMUA 4B6PA 3L1JA 2HPAA 4PQEA 4H2DA 4Y0AA 5T8KA 5I9LA 3PIRA 2HPVA 3NU1A 4R1OA 4LOJA 2GYYA 2QU7A 3JWJA 1DE0A 2R2DA 4UNIA 4V38A 3CE6A 4IQ4A 3ESAA 4LW8A 1PKXA 5D5HA 1QU3A 4CVNA 5K9ZA 2CXTA 5KX5A 4TYNA 5CU7A 2GVDC 2IDKA 3T0FA 3IUSA 2GXUA 2BG2A 2PZJA 3AUFA 1TLLA 2EIXA 2FJPA 1Q20A 3KWFA 1E64A 3D6NB 1G3QA 4DYHA 2IIVA 3L7MA 3Q6IA 2E3JA 4Z7NB 1OSNA 1PJ4A 3EFOA 3I9NA 3R23A 2JK1A 1SUPA 5IDQA 2QN3A 1PU2A 4EXYA 2AG0A 3A9WA 1X9IA 1ODSA 2COKA 3PF8A 4JT8A 2RAVA 1OTHA 1E1NA 1KKLA 3DMRA 3GAAA 1Z3IX 4KMSA 3S2GA 4CKBB 1UBGA 2ZJ2A 5DU2A 4Z0PA 1YXMA 4K03A 2J6HA 3FFAA 4B3JA 1CJUC 1V16B 1YI1A 3H2BA 4C0KA 3DFFA 4A1OA 5JPCA 1FBTA 3JW8A 4TYMA 2DB3A 2QRGA 2JIZD 1WSAA 3HWX1 2P8SA 3X2EA 1H4QA 3C48A 2PUHA 5BSHA 1ZAYA 3QEMA 1YB7A 2BGJA 2YNTA 3CEPB 1X7XB 1OE0A 1J0CA 1U0JA 3EGXB 4OVKA 1PEYA 3E53A 3K16A 1UZAA 5CA1F 2EG5A 1AXGA 4MEAA 2I55A 4WOKA 5J4VA 2WKRA 2Q9UA 3R3SA 2RIRA 3BRQA 3EPRA 4QICA 3T3MB 3HYLA 4C22A 2VSOA 4BX9A 2A86A 3DV9A 1HTWA 2E85A 1PK9A 1RJDA 1C8LA 1KMHA 2BMEA 4Q9AA 8AT1A 2V3WA 1OIXA 1UIMA 3C70A 3IQXA 3P45A 1S2DA 3FFBA 3HV0A 3Q7IA 2PUEA 1OJ7A 1G66A 2BFAA 2QTCA 2ZJ5A 3TZBA 2HIHA 1FQWA 2ZYSA 4KL8S 3L3BA 3D6TB 3SEQA 3ZW8A 1D0IA 1Y5RA 4E2YA 1X7ZA 1SHKA 2YDYA 4OM7A 1ISSA 5IDYA 2GHIA 1RRGA 2VKTA 2X0JA 4OQZA 3FCZA 4YT8A 1I0LA 3L6EA 4BHTA 2GN4A 4QLBA 3I11A 3EISA 3TM4A 1LVUA 3EIQA 5JVDB 3VR4A 4Q4HB 3AH8A 3CINA 1F60A 4GRDA 2BG8A 1M67A 3X2XA 1FSGA 3EH1A 3NTQA 1XT6A 5DVZA 5IG2A 1I7DA 1C7FA 1XGKA 4Q7EA 4ZXFA 3PC8C 4R8LA 3VVCA 5IK2D 1PJAA 1YHNA 4Q01A 4ZQCB 5DXFA 2HJGA 4MP8A 1BMDA 3MUFA 5EHNA 4BV8A 3F2VA 3OT5A 4PN7A 4KIGA 1NBAA 2VQ3A 4E2WA 1E8NA 3LQRA 3MTGA 4D3ZA 3FTDA 5JDIA 3U13A 2CNKA 3DE4X 1P1KA 3GJQA 4QU5A 3RAPR 5A2QA 5GONB 2QX6A 3BRCA 1UPXA 5G1PA 3KJZA 5FB3A 4RTMA 2B37A 4AXXA 3NNDA 1XDZA 1NVUQ 1GEGA 1IZ9A 2A9QA 2CXHA 2OCKA 2ZR8A 3O8QB 2KS6A 1DQRA 5B53A 2VWHA 4MWGA 4QOHA 5LC1A 3AEUA 5CA0A 3WFZA 4ZTUB 2Q21A 2ZULA 2HSDA 2HJSA 3JTMA 3LDGA 4EG8A 1D2NA 1Z63A 2DOKA 3EF1A 3IXQA 2WWRA 3CBGA 4FEYA 4TRRA 4X8MA 4HRAA 4YWJA 3T41A 5CA0F 3B8EA 2KHZA 4OQNA 2O0HA 5BN5B 3JPWA 3QV1A 4P4SA 3H87A 1ULUA 4J16C 3S70A 2LIVA 2OHHA 2E21A 4LOKA 4R51A 1YB6A 3IUQA 4BFSA 3RWMB 6REQA 2YHEA 5ULLA 1WD5A 4KBFA 2VUIB 2DT8A 3TQSA 1MV5A 2XMBA 1P19A 2DFVA 5ED0A 1NF8A 8OHMA 4QYWA 1QHXA 1ACJA 2R60A 4OU5A 4BZXA 1NVEA 1LC0A 3JVDA 4WINA 3BMNA 1VE9A 1NVVR 3VZRA 5KILA 3AR9A 3UUWA 5D3KA 5C37A 3GMSA 4RA9A 4HNQA 1EA7A 3P8ZA 1IQRA 4IWYA 5K8TA 2O54A 3NC1C 1WEKA 2QTVA 5GJVC 4G81A 3VKUA 2BZ1A 4ZIRA 1U8EA 4HGZA 4M0PA 16PKA 4BMOB 2DUUA 3B70A 1EFRA 2B92A 3C7TA 3KHKA 4QU8A 5BV2P 5BORA 6ADHA 2Z57A 3F67A 3LHIA 1QRDA 3PVCA 1XA4A 3F6SA 1FFXA 2H9AA 3LTNC 1XLTC 1UJ6A 4FGSA 3A0UA 2PUDA 3ZWAA 1A9XA 2LZ0A 1ZYUA 3OCWA 4KYIB 5A6SB 1KERA 3IT1A 4AZWA 2JD0A 2YNMD 1JPUA 1IONA 1SG6A 2HYIC 1X8KA 4WXPA 1JNXX 4G6ZA 4I9GA 4BKPA 1CUHA 3F8SA 3VISA 6Q21A 4CIXA 3RBVA 1MEEA 1CS4C 1N5KA 1Z25A 2VJNA 4GRAA 4Y7DA 5T3YA 1B1AA 2VHXA 4MUGA 1QOPB 1MPXA 1CZHA 1I6LA 1OTXA 1ICIA 1RE0A 2IA5A 2QX8A 3GL9A 4XQ0A 3U7JA 1O0CA 2XB8A 1GFSA 2A84A 2G6BA 3W04A 4AWXA 2HGSA 3EWNA 3IBCA 2XVZA 5LYJF 2P6UA 4Y7CA 1FSPA 1WY5A 3GVCA 3BA1A 4FONA 4JDUA 3HNPA 3IAXA 4YI3A 3T7DA 3W1WA 4XTRA 1ZTCA 3THSA 3ZE9A 1I14A 2ZZIA 3PX3A 4YLYA 4QDKA 2ZI3A 5COQA 4NWIA 1LRLA 3TB6A 2BZGA 1M34A 1TW2A 2OCIA 1KAHA 4AW9A 1GITA 3N0VA 3EHEA 3OLZA 2FMUA 2X1HA 1P2TA 2X6RA 2P41A 4IV0A 3G8AA 1SHZA 1XNGA 2EHJA 1U9ZA 2AQKA 1UKVY 3LF2A 3WYCA 3VR2A 1KFEB 5G02A 1Q7BA 5LQKA 1PG2A 3FLAA 5DBHX 3NYIA 2ZI9A 4YQFA 1QPBA 3HPRA 3ACBA 3AKDA 1GY8A 3UMMA 3GWZA 9ATCA 4KXUA 1YI8A 2ZUWA 1IDOA 1Q1NA 3JYNA 4RD3A 1JU3A 4DVJA 1SCUB 4UFPA 3FI0A 4JZKA 5B7GA 3DTTA 4ANFA 3PFCA 4YV7A 5K6AC 1J42A 4FYXA 3FYTA 4CQNA 1T43A 1B2LA 1GYQA 1LBSA 3PEVA 3CVVA 1CVLA 5DBFA 4C87A 4PZAA 3WLJA 2CHGA 5EJ2A 3WXCA 4M0UA 2WTXA 3ZHUA 1HNZB 3MS7A 3NDRA 4TL9A 4EHBA 2BFKA 2AJCA 1JZSA 7YASA 2C5GA 2YXLA 1Y37A 4WOBA 5GJCA 4B8WA 5E0KB 5AK4A 1Z7YA 2QNBA 4OBEA 4WLOA 5IJ0A 1N92A 3I61A 2JLWA 5K3EA 1RJGA 2Z4TA 1L6IA 3LXMA 3WC4A 4AKGA 3ORSA 4RK0A 4DR3B 3Q6NA 3B3FA 1T0UA 1R5JA 5KSZA 4A2CA 2X8WA 1TPYA 1W0JD 1D1QA 2H07A 1S2OA 1E6KA 3NHZA 1G5RA 3BCUA 3OUTA 4ND4A 2HKIA 4AX8A 4B6QA 3JX9A 1DMRA 1N2EA 3C7KA 2IS4A 4I6EA 2BMDA 2PUFA 2CCGA 3N75A 4OOFA 5TF0A 1TRKA 2I2XB 3ZV4A 3CLUC 3HS3A 1GYPA 4QGGA 1N7IA 5FI3A 5HR5A 2A0FA 4EFZA 3IRUA 4OCZA 3UBTA 2ZAIA 1DKNA 2BM0A 2IP2A 3FDJA 4IL5A 4YYZA 3UMYA 4A15A 4CG0A 2FJUA 1BFKA 5F21A 1J9ZA 2QTFA 3UKOA 1UMDA 4XGRA 4Z9BA 1ZWKA 2DWQA 3UW3A 4BMVA 3EFEA 5JYEA 1XAGA 3LA8A 3NOXA 1FPQA 1Z83A 3PZBA 5CHYA 3L06A 1TC1A 4X66B 1YDGA 2XYVA 2ZM6B 3ROXA 3PG4A 2PWZA 1X8GA 1PFQA 1WRBA 1XR3A 2GB4A 4NC9A 4MS1B 4QYIB 4XGQA 5LQSA 3RSCA 3VKWA 3E22A 3GQBB 4CMAA 1VDZA 1JBQA 4KNVA 4KR6A 1EEXB 1BGVA 5A87A 5D2CA 2WFLA 5L7YA 2IE0A 3VH2A 3CUYA 4X5OA 4E88A 3J7AC 4Y6GB 1LDBA 1YRWA 3QPDA 2HYDA 2YH2A 1PL0A 2X0NA 4G1VA 1RABA 2ZSBA 4HNGA 4BE4A 3W5CA 1R0LA 2V3VA 2E55A 4QPCA 1CVRA 2EWVA 4RY0A 2CBXA 1CZOA 5SZJA 4POOA 1OFTA 3UGQA 4TSRA 2EZ4A 3OLQA 3T9EA 4CPDA 2WHRA 3BSFA 2JBAA 4Q82A 5HIKA 4NPAA 3QMMA 4RIHA 3TZLA 5IU6A 1KS9A 4GI7A 4MAFA 1HDRA 3AQ4A 5J5AA 3ABZA 1T1IA 4E6PA 1HQKA 4W5RA 2AN1A 1AX9A 1E7QA 1GGJA 1R0ZA 4QFMA 4R2XA 3ZVNA 1FU4A 2VJCA 3C3MA 3BF8A 2B83A 4JT4A 3EVBA 4W6QA 4HFMA 4R83A 5MDHA 2Q6IA 1M7BA 2RHWA 5IWAB 1OB2A 4TTQA 4BU0A 1CY0A 2X3FA 1LK7A 5ALOA 1NBMD 1Z4LA 1JHZA 4O2AB 1BMCA 3VSAA 1FQJA 1V39A 1XEFA 2H1FA 4LOLA 1O03A 5BMVA 4G1BA 1U0RA 1HWYA 2OV1A 3GCZA 3HGTA 1GQSA 2QJTA 4KMOA 1K2VN 3W7BA 4K9OA 1Z73A 2VP5A 3PKZA 3I1JA 1ZN7A 3I9LA 4J94A 5DM4A 2HK6A 3FZYA 3EE6A 4UAJA 4WCFA 4JELA 4R8KA 3ZCPA 4AVYA 4TMFA 3FOWA 3LGSA 4WVFA 4IDAA 5B1SA 1KEPA 1QHFA 3GV0A 4I9HA 1KJNA 3AUTA 3VSBA 2QRJA 1DTEA 4EUFA 2WP0A 1QVZA 2X0IA 1H5UA 1XD2A 2CJWA 1KOGA 5HIPA 2ASVA 4KACA 2O20A 5IKPA 3O92A 1GIAA 4EJMA 1FFBA 4JQSA 1NOIA 1S2NA 3WJ1A 1U0HC 2Z5GA 3OZIA 4DDVA 4JEMA 3RRBA 4W7HA 2V7GA 1RC0A 1E61A 1FX0A 4MI9A 4EABA 2DHCA 3JAKB 1YU6A 4M9QA 4FFBA 3DH8A 1TT7A 3QVOA 2LW7A 4OMDA 3L0YA 1I01A 3ZUPA 2IP4A 4KQFA 1A9QA 3KCQA 2ZRMA 3I2JA 3Q3JB 1Q22A 1SKUA 4IMJB 3IE0A 4GH5A 3OX1A 5JY1A 2AJTA 4K9MA 2VLBA 3MJHA 3N53A 2F17A 3AWIA 3IP5A 2X7HA 1K86A 2YIDA 4PNPA 8ADHA 1CDZA 3AW9A 3RS7A 3D8SA 4ZKDA 3HRHA 1FZTA 3R3YA 1ZZEA 1GQQA 1NY5A 4FBMA 1KJIA 4M36A 4QM6A 1NMZA 4DV5B 3OM9A 2VHEA 3O3MB 7MHTA 1VSBA 1SUCA 1PSZA 4BP8A 2V5AA 2IYVA 2Y4NA 3DBVO 3RVJA 2DYKA 3HTXA 2BHTA 4I19A 3PUKA 3OPQA 3UHPA 1OX5A 1RMTA 3ND5A 2H1HA 1EFKA 3UK0A 1I4WA 3USZA 4EHKA 4DR2B 3CLTD 5FI0B 4GM1A 3PE3A 2VDLB 1Z3CA 1G17A 3I1YA 5C2JB 5LLTA 3GRKA 3H5AA 1C7IA 4DLWA 1H8HA 2Q5EA 4S2UA 4RVSA 1QE0A 1W0JA 2FRVA 2QV0A 1II8A 4B35A 5C18A 1U9IC 3EXFB 3LGAA 4TZTA 3WRVA 1MN6A 4L8LA 4HMPA 1LDGA 1RBQA 4OK6A 4YNBA 5FUBA 3RRMA 1U2DC 2HX1A 2FOXA 1U6IA 3ON5A 1RXUA 1HRDA 3FYCA 3K2EA 2FDRA 2DSTA 4INAA 1MC1A 1U4NA 5HIMA 1BG6A 2JAXA 2H1SA 2J6CA 3U4HA 3NAQA 4U6NA 3VR2D 4HDMB 3OE7D 1OIWA 1CP2A 5IZCA 1OLOA 1RKQA 2WSMA 1JHOA 5AI5A 1G1MA 2AYZA 5HKBA 3VDQA 4C2AA 1Z4QA 3SZGA 2Z2YA 1MQAA 5DULA 1DX4A 1TFRA 4FFMA 2O2DA 3KYDA 3NHYA 3SZUA 4E7PA 1DAGA 2GRJA 1L5KA 3QWFA 5FD8A 3KDAA 3UOGA 1AKTA 3FKSA 4REQB 3RSFA 5KINB 1RMQA 4RMNA 2EP7A 4OD0A 4BKRA 1JI3A 1CZNA 3ADOA 3AV0B 4OYHA 4N0DA 5DH9A 2BBTA 1N77A 4EGSA 2WFMA 3WGOA 2QTWB 3ZZTA 1DDIA 2Q49A 4J8PA 3JATB 4ZI3A 1XZJA 4G23A 1SZDA 4BQEA 2HIAA 1DKOA 2RKWA 2VH2A 3QU4A 3BL8A 3NCTA 3TOZA 3ZWPA 2BFWA 4JI2B 2ZJBA 1F2VA 1NI3A 1D8AA 3BHMA 2D1FA 4ZZ0A 1ZVQA 3K9QO 3UUEA 2I33A 5IZCC 4GYWA 4IHJF 1ZOLA 3HEAA 4RZ2A 5G1NA 4LI0A 3ONFA 5DISB 3EDRA 1A72A 4J9VA 3ZY2A 4EG5A 1V3QE 2WJGA 1SBNE 2H06A 2ZSDA 3LT1A 2P2CA 2F1KA 2VYQA 2AN5A 4OGGA 4D43A 1I7SB 1M1ZA 2BMWA 4ENPA 3ENKA 3B9RA 3IAM1 3H3JA 1L8OA 3A6LA 2R87A 3ND7A 3U16A 1AZWA 3U6KA 3KNZA 1FUUA 1G8YA 2NV0A 1GV1A 3DR5A 3WLEA 2JGIA 3JALA 4K6FA 3ZJ5A 1QRTA 3SX2A 4QUIA 3L1UA 4IGAA 5CPFA 4PNHA 4XIJA 2AXQA 3ML1A 2HQSA 3GRYA 2FDXA 3U3XA 1B3BA 1KO5A 2B61A 5IUJC 5AHXA 1JR6A 4LDJA 5CVVA 2HCBA 2XITA 1JILA 1KNXA 1P1FA 5AICA 5AJHA 3PD1A 4XWAA 1X7ZB 2KPOA 2TMYA 3GJ6A 1ZOSA 3EARA 4HFNA 3ZH2A 1KRWA 2FRDA 2XVYA 3UATA 2ERYA 2X1LA 4AX4A 1VCNA 1YE8A 1CE8A 1U1EA 2E7ZA 2HJVA 4MGIR 2Z2JA 2ZJ7A 5DGTA 4HFRA 3SNHA 5K6RA 3P9ZA 1IPFA 5L6MB 4QTXA 3B7WA 1V1MB 2PEZA 2PT7A 4I8DA 4W5WA 1JBEA 4UHCA 3VR5A 2R6GA 4YMTA 1TGVA 3E7XA 3SQXA 5JBQA 1MO5A 4UE6A 2WLTA 5J59A 1A4IA 3N2GB 5DYIA 3IKTA 5LB4A 2SBTA 3J81A 3K6RA 4KJZA 4EK9A 3NFYA 3CA8A 2YYZA 4MI1A 1SKQA 5LSCA 1DV1A 3BFVA 4KEAA 1JIXA 2Z5FA 2J4DA 4G67A 2NZ8A 3CF2A 3FUWA 1SUSA 3MWEB 3DL0A 1RAGA 3RFCA 3AHHA 4UUOA 3GPCA 1E66A 3QMVA 3ZDBA 3U17A 2WJ3A 2F62A 2N3ZA 3N0WA 4JX8A 2VTVA 1TM7E 1P1JA 2HTEA 1NMEA 2BP7B 4J0CA 1P3DA 4P4TA 5CFPA 3OEHD 3CZ9A 2XB2A 3MTDA 3ASZA 1IOLA 3DBOB 3EVFA 3QV2A 1JKJA 4JASB 3K94A 1BOFA 1P44A 1XNHA 3OIGA 2XBUA 4HYEA 1VI5A 5DO9A 2NT3A 4L4UA 3R41A 5KSPA 2NQTA 2GXSA 2E1PA 1FBNA 1Z6TA 2QJRA 1XMVA 1SN7A 3EXHC 3K92A 5CFOA 2J5QA 1N9ZA 1R0BA 4E13A 5JTTA 1EDBA 4JB2A 1K5HA 3YASA 2XWSA 1ORHA 1KMMA 5BRNA 1AQIA 2GZ1A 1T9GS 1U1IA 3IP6A 4LMRA 1JAHA 2Q2NA 1FNDA 3GLGB 5EXSA 1DDGA 2JLVA 2QVCA 3T1HB 4M37A 2N46A 4G5OA 2OFFA 1GPLA 3SMVA 1O58A 3ND8A 5CLHA 1PDWA 5TSDA 3KPYA 1WAMA 3PDIA 2W6IA 2AOTA 2JLBA 3RT1A 1QIKA 2UZ1A 3DDCA 5F3RA 3KELA 1GPNA 3V1YA 2P97A 4K9SA 2BKAA 4KFTA 3W5BA 4CCAA 1L5ZA 2PCJA 4F6RA 1F12A 2ZPUA 3NT2A 4NV1A 1EFPA 4TTRA 3SSAA 2QT9A 1PTJA 1GKUB 1VHWA 3UMRA 4L08A 2OENG 3H11B 2O9JA 1MO6A 4NU6A 4XEUA 2LDBA 3DMHA 3A7EA 1E79D 1RWOA 4G24A 2Q4DA 4C3OB 4AJNA 4EW6A 1MTOA 3KEQA 1YA4A 4V39A 2G9ZA 2O7SA 3BJMA 2WJVA 4C07A 5KYTA 2ZE5A 2CGEA 2RGGA 1Y3CE 3K72B 4TL6A 2FAXA 4RLHA 4UJ3A 5A3VA 1W19A 3JD2A 1O0BA 1AB6A 3GJ5A 1TJ4A 4I2NA 3CMMA 3KYIB 1SQ6A 1W1WA 2IX3A 4AG3A 3MWDB 5BSFA 3QLVC 2FWPA 3WLKX 1DAEA 4KFSA 3WWOA 3TPFA 3LY9A 1F0NA 4FOLA 4WKBA 4LDRA 3OECA 3W77A 3WO1A 5JZBA 2N9UA 1GT91 3RO7A 3KHSA 5TQ0B 3E2PA 4B4VA 2Q3MA 4DN6A 1KI9A 1KBQA 2G25A 2VF8A 5CDYA 1Q3HA 1R6XA 2PWAA 4BUCA 5CDFE 4PPFA 4YCCA 1BN7A 1SC3A 2NSJA 4ISBA 3B7PA 4V0HA 1DXQA 1KVQA 1NYRA 2Y27A 3ZQKA 4MDFA 1J90A 1A2OA 1SIOA 1I2BA 1U0SY 4HH3C 1THGA 4J0IA 5TPWB 3T3DA 3L82B 3VDMA 4CKEA 2O8BA 1H2FA 4WH0A 5E3IA 4R1LA 3PIDA 3C8DA 5FLEX 3ELDA 1YDHA 3W4KA 4GMKA 1B00A 4B79A 2WKSA 3O3OB 1QH0A 4J1TC 4MKFA 5DN6A 3IR5A 3FA2A 1GCAA 1PGPA 2QTRA 1Z0JA 3FETA 4J43A 3S8MA 5DNWA 1Z5UA 4F2WA 3AJ9A 4NSNA 3PL1A 3WWEA 1XUOA 2SCUA 3EXIB 4IM7A 4F9FA 3IMGA 5A9SA 5B58C 3T7RA 2WQ7A 2QL7A 3SYKA 1CUWA 2JFFA 2XAUA 3GB9A 3THOA 3KXKA 3G5LA 4GZLA 5EXXA 4YSLA 1AN0A 4OU4A 1RHRA 1EWQA 1SQ0A 1MIOA 1NNLA 1C2TA 4EHNA 4U4LA 1SVUA 2NNLD 1PR1A 1XL0A 3FRIA 3CWQA 2RHBA 4L2IA 1WB5A 5EKDA 1IN4A 1E6WA 1K06A 3MUEA 4NX2A 1KQNA 5BR8B 3PQDA 5EVKA 2JGDB 1LEHA 5CURA 2B1JA 5EVDA 5LFAA 3GLIA 1W52X 3OIYA 4CQJA 5KNCD 1OYYA 2C0QA 2O0KA 3AYXB 3I13A 4Q3DA 1NP3A 4BGUA 1G3RA 4FYWA 4QXPA 3KOOA 3TZKA 4DNPA 3OZUA 4EMBA 2NO1A 2RGDA 3I05A 4TLDA 2TMGA 1U5AA 3MJVA 5CCEA 2ZNBA 2WE8A 3AHCA 2ZYGA 1N3BA 4NV3A 4DOMA 1Q0ZA 4WGGA 1YIDA 2IWHA 5C8YF 1P0IA 2V7WA 2RGXA 3E81A 2VZEA 5DEIA 1TW3A 2VXYA 2WZBA 3F4BA 4JYAB 3C3DA 3IVRA 3M5PA 3PQ2A 4X90A 4GPD1 5L3ZA 3A25A 2HEIA 1SBCA 4MV7A 3V3TA 1ZSYA 1R74A 4QUEA 2F00A 3GLGA 2WPDD 3JQAA 1JJEA 4G0PA 4YFVA 4ZAGA 5LLDA 1DC6A 2PSJA 1TQ4A 3QKRB 4WBNA 1K7SN 3WHPA 3S28A 3G1WA 5EKSA 4D92A 1YD7A 5DNCA 2UYOA 4X1YB 3W9UA 1PV1A 3PGJA 2UYCA 4Y3UA 4DMKA 3VAYA 2NU7A 3I37X 2ZATA 4G84A 2PS3A 2PUVA 2QE7A 3W4JA 3AILA 3M4JA 4ZWNA 5BSVA 1NNSA 1GGEA 5H16A 2WWXA 5EHIA 1XTSA 3HP1A 2XOEA 4IGIA 4CG2A 3Q98A 4I4TB 1QORA 3BL5A 4L4XA 4TYWA 1Q14A 3COZA 1DDOA 5JDCC 3U4AA 4BB6A 2IQ5A 4IHQA 4PFJA 3CBQA 4PWYA 5SZIA 1PZXA 1Z39A 5CXUA 4L3OA 3BD8A 3UB2A 4EECA 5T64A 1KETA 4L8VA 1TAUA 1E6MA 3D9QX 2QKYA 3U81A 5AW6A 1XG5A 4TRMA 2QLTA 2FFJA 1R6TA 3EHDA 3L49A 1E1CB 4ZAWA 1KJJA 3ZHRA 1VKZA 4FQ8A 1C7RA 3MJDA 1TQDA 4DB2A 1XP5A 5HE8A 3BGVA 2BDTA 1EZZA 221PA 5GWXA 4D57A 4ZI7F 4Z60A 4Y2VA 3T3IA 4DCTA 2PHZA 4Y6LA 1NBOA 4O4IA 1P1RA 3ZS8A 1H1LA 4L22A 5DLDA 3RKSA 2X3YA 4RTLA 3A2NA 4WXEA 3FBWA 3HCPA 2NXEA 3K32A 1BVUA 1XVLA 1FSZA 3GG9A 3PXBA 1XVAA 5TPWA 1OV6A 3T06B 4CKEB 3BWBA 4EHIA 3FR7A 3TLXA 3QUBA 4C3VA 1N3YA 4HX2A 2VAPA 5JNRA 3TECE 2A1UB 1EK5A 5K20A 2PKCA 4B74A 3RS3A 1XTUA 4PQYA 4H17A 4XQGA 3EZXA 5ALFA 3GD5A 3BC2A 2CC2A 2VZLA 3GFTA 4FS3A 2R0QC 1U8YA 2F8SA 1E60A 3EEIA 2ZXUA 1YZTA 3H9UA 1NBEA 3GJ3A 3L0DA 3TEFA 4DZRA 3ORHA 3ZKWA 1RXSA 4FDUA 3HHEA 4HZGA 4URYR 3ZDFA 2OBBA 3VPBA 3KYCA 1LLUA 1P4GA 4MV8A 4R1NA 7MDHA 3HO1A 4Q4CA 3DKRA 2IY7A 3WWYA 3QMPA 2QRPA 1LLFA 2VPYA 3MPOA 1ZP6A 1IM8A 4IQ8A 3GNTA 2PX2A 1K66A 2WJ4A 2ZANA 3C98A 4RABA 1SJ9A 5EUBA 5E95A 3AU8A 4LGYA 2BGGA 1NQVA 3KQNA 4W1PA 5KB3A 4HYYA 1XZPA 2CHEA 2PV0A 3KEOA 4JJAA 1PG5A 5F51A 3MTBA 1P2BA 3O75A 3K31A 3RYIB 1IEWA 1QV6A 1TVMA 6NULA 1QKJA 2F9LA 3PG5A 3UG7A 4JK3A 1H22A 3W5DA 2RGRA 1FX0B 4AZ3B 3H2KA 2B3TA 5ECWA 1UJ4A 2EJWA 3JY6A 3OQHA 3S1LA 1TEZA 2RGAA 5A5FA 3DGFC 2ACEA 3OF3A 1GTRA 3L7CA 2HU8A 1DWUA 2YWRA 1NNUA 3CR7A 3IVAA 4U7TB 1OHHD 3LLVA 3IQZA 2GXAA 4G97A 5HGXA 2QL9A 5AW2A 1R4NA 2NUPA 1RHUA 3M9WA 1U81A 2L82A 2R5NA 4AY3A 5FDFA 4FCVA 4NU5A 2ZIZA 1T3ZA 2BUCA 1UKBA 1EQUA 1ZC3A 2LVBA 3IDSA 4ER3A 4DREA 4DJTA 2KB0A 4PRKA 2QZSA 3IH5A 3CEJA 1HYQA 2FGJA 4XSVA 4CLHA 2DT5A 3KKPA 4DG8A 3ZD9A 2CUNA 1B7GO 1K0UA 4JKYA 1U2ZA 5DI3B 2DFTA 5JCXA 2Z56A 4KGVA 3PHJA 1TU4A 3EVEA 3NH6A 4WX2B 4B3XA 2X41A 2CUZA 2I4NA 3ET4A 3IAS6 4O8ZA 2CHQA 1D2MA 3WQHA 4LMAA 3TTWA 1H2BA 3T52A 3WI7A 4L16A 2PX0A 2Y66A 1HYBA 2FPRA 1X0VA 2HV8A 3AUSA 4BLVA 4BWYA 5KYXA 1XQWA 4GU5A 4W9RA 1I6KA 3FHCB 1SBZA 4YX9A 1A5BB 1I7PA 5D86A 5AOBA 2F3PA 2ZREA 4EB3A 5CG1A 2WU1A 4B3HA 2ONJA 3LBHA 1ZGJA 3L1IA 4YR9A 1AZLA 1W2WB 4FPXA 4MIYA 3ADCA 3KX2A 4PS0A 4RM5A 1J99A 4UM8B 1O6BA 1SH7A 3QBVA 1MO3A 5THXA 2O8EB 5AW3A 3WK9A 4J0JA 4FZRA 2DUJA 1DZ3A 2H51A 4PS1A 5JQGA 5F9HA 3NATA 4BWVA 1EWVA 3P52A 2XUFA 4L27A 4OG2A 3VJMA 4MYDA 4ZALA 3HSSA 3KZCA 3SLKA 1H1LB 4AKEA 3HE3A 1K7EB 2VF2A 5PNTA 3BXHA 1BEZA 4ALNA 1LBIA 4NE7A 3WIUA 4PY2A 5JI3E 2WWWA 1TJNA 5DLYA 4C7KA 3FLBA 3LOQA 2F6RA 3MS2A 4IDGA 5I4BA 3HYTA 1U3FA 3OE5A 4WBSA 5HA5A 2ZRKA 2AZTA 3II6X 3NM5A 1CQXA 1NQAO 4FEAA 5B1UA 1T2UA 4L0DA 3RUCA 4JY7A 2F43B 4UVGA 4YJGB 2IZ7A 4BBAA 4MLPA 4DCVA 5HH6A 4CM9D 1D0SA 3SP1A 2BBOA 4CMCA 3G7NA 2H0QA 5IM5A 2CVPA 4J76A 3RRZA 1E4EB 3MD0A 1FW6A 1BC5A 1M10A 2O0LA 2ZPTX 3JYQA 4EQ6B 3RE1A 5DPMA 3RS2A 5K51A 4FLMA 1SBTA 3GD7A 1E2DA 4KAXA 3OFKA 4S04A 3U1VA 2QZ9A 2AK3A 3ZNPA 5JMWA 5JADA 2EZTA 4RVNA 1VJ5A 3BGWA 2PQ0A 2XF2A 1PT6A 4G1MB 2LDXA 4QBGB 5AW5A 3SYNA 3WP0A 1NN5A 1SMLA 4KWEA 2CB9A 4AXHA 2PPVA 3QEJA 4Z4HA 4N9WA 1AUVA 3DNPA 4U7PB 3A6PC 1XELA 4EENA 4Z3DA 5ACQA 5CVUA 1KDYA 2JFQA 2VAWA 2QZJA 4BNKA 1X1EA 3Q41A 4PICA 3T61A 3U7EB 5ACSA 5BN3A 4JXZA 1SKYE 3BSSA 1PCXA 4HH0A 4MV9A 4K46A 1BH6A 1AS3A 2WUFA 2FEOA 2Q9BA 4JXJA 2HB9A 3P96A 3UJAA 5GZ3A 1J0AA 2PGLA 3Q85A 4WKCA 1QVVA 3DGEC 2OVFA 2XIJA 1IHDA 5CT9A 1JG4A 1YFKA 2AFRA 3EZLA 5KWIA 4F3NA 2VWGA 5SV2A 1HMYA 1M0TA 5HTOA 1T8YA 1UEXC 1MOPA 4IIUA 1IXSB 3HU2A 3JQ9C 1XXHE 1ABFA 3D2AA 3WG9A 1T6XA 4NZPA 1KKUA 2EBUA 1V7ZA 3QFCA 5NLLA 1N5MA 1QB7A 4ENRA 4YY3B 3EIFA 3FKJA 2DPHA 4PYQA 2ONYA 4KE7A 5SY4A 3B5IA 4JKOA 1Z6XA 1CUEA 1X9HA 5TB5A 1C4KA 3N05A 1HNWB 2CFSA 4XX1A 1WQ4A 4BVAA 5GGXA 5FEUA 5LOVB 1OOEA 2QSJA 4JQCA 3UMVA 1A4RA 2VF5X 4YJ2F 5FPHA 1AUPA 3PQ3A 3SYMA 4R1QA 3EIEA 3FOBA 5FR1A 3EIXA 2BI7A 1MC8A 4Q02A 4MYSA 4FFBB 1UH5A 5ERXA 3RTGA 2WSIA 3GLIE 3L93A 1IBCA 3VR4D 4IEFB 4RH0A 5ICMA 2IPLA 1DCFA 3REQB 1Z56C 3TI9A 3D3NA 3WKBA 1G98A 1NXSA 1C3XA 2BEWA 3C7AA 3QPCA 4BO3A 2BDUA 4A6XA 5DP1A 4P54A 2X5KO 4A91A 1KEZA 4LQ4A 4MP6A 4DC1A 2D3TA 1WW8A 2JJ1D 1D04A 4H08A 4ZJUA 3F0TA 3L7DA 2WIDA 2C5AA 5KSOA 3WIEA 4ZEJA 4BKUA 3KSBC 1SXHA 5FOSA 4HSGA 5J2UA 2LCIA 1DQNA 1ZK3A 3R3VA 3F3MA 4H6XA 5I7EA 2OK7A 2P9ZA 3C5VA 3HXPA 4CETA 3FOFC 1AN9A 1PQPA 2WWHA 1IXYA 2B25A 1V26A 3SQOA 3DBLA 2O5RA 4BNDA 5AUOB 1G8JA 4M1OA 5GPBA 4BU1A 1ADCA 5HUQA 4MQUA 3ANXA 4XASA 5C51B 2XMCA 1KAEA 1C9NA 2HLDD 3LHKA 3PFKA 4R5HA 4RJLA 4F04A 2CFUA 5TS3A 4RM3A 3WISA 5CEEA 4ZICA 1SXPA 2NU6B 3IVMA 1RLTA 3PQ4A 1HT2E 1L8QA 1G21E 2JIZA 3K09A 5TGTA 2Y99A 2WWGA 3ZTWA 1JT2A 4TXJA 4EPXA 5I7RA 1PHPA 4JBXA 4DXHA 3B2QA 1ENYA 5CM9C 4CFYA 1W49A 2HRZA 3KSZO 3LQYA 1W0KD 1WZUA 4CODB 3WVNA 3H5NA 3O4FA 4FOSA 4DDMA 4F92B 3ROFA 3B1YA 1ZMRA 2MWMA 1LJLA 3B6MA 3CKYA 3RFTA 2Y0DA 4MULA 2P3QA 4HK4A 1UFKA 4B7XA 2FX5A 2BY4A 2I6SA 2AE2A 1NHWA 4WA7A 4MDEA 1QG0A 1YR7A 1T1GA 4FD2A 3KQQA 3V8VA 3QPAA 4TMTA 1F8XA 4EEKA 2YV5A 3CEAA 3GDFA 3FCUB 5KHAA 2ZVDA 2YN4A 1NR5A 1EX6A 4BNHA 4QULA 5KDOA 4N5MA 1TZCA 1K6XA 4Y18A 3X1MA 1DBSA 4H7DA 3EGDB 2BBWA 1TZ2A 3DAHA 3ZKAA 2J4FA 1DJQA 3TFQA 1G4UR 3D81A 2R11A 1PKEA 2I8AA 4HAYA 1B14A 1G9TA 4KK4A 2I76A 1HTTA 5B7PA 5KKCA 1W36B 1DJLA 2PTHA 3IAAA 1WCIB 5G0VA 5H7XA 421PA 3I5UA 3LRXA 1PNTA 3R3XA 4FW9A 3M6AA 3CNOA 3FPGA 5IABA 4EUKA 4YBZA 2BTQB 2OV8A 5CK5A 2QR5A 1K88A 2QORA 5FA6A 4ARVA 4YYEA 2AMVA 2PX5A 1WPQA 2B35A 2NTNA 3E5NA 4PCLA 2C8LA 4FC6A 4PG7A 3A3OA 4DM3A 2REOA 4CFSA 3KR9A 1GPMA 1DXKA 1V95A 2HMAA 4B43A 4BTVA 2NQ2C 1C1XB 4D6PA 4WZBA 4ZDIA 1G5HA 4HSEA 4EY3A 1HOXA 4MPDA 1PD1A 1Q95A 3DZDA 3E18A 3MUOA 4HWTA 3WJ7A 3OBBA 3ZJ4A 1HDIA 1Q11A 1UFVA 4TKUB 5HH5A 2GKSA 1DPFA 3V2IA 3RROA 2QW8A 3N5KA 4O4HB 1R66A 1KTVA 3LOPA 3RKUA 5HKKA 1CEEA 1KDVA 1C9DB 4YMWA 2E2WA 2CZCA 4YRQA 3NYQA 3ITDA 3N8KA 4GICA 2D2IA 2BHNA 1V37A 2CY0A 2EZUA 2ZSEA 1YL5A 4P98A 4TTJA 3GDGA 1HL3A 2E5WA 1UK8A 3DFIA 3AKEA 3V97A 1YMUA 4BNMA 1DVRA 4CEJB 1NW9B 3FVRA 2PD4A 2PZAA 1ODCA 2DFKB 1INLA 2OAQ1 4P0TA 3WRYA 4EI8A 4EKNB 5IN4A 1K0FA 4B17A 4F6CA 2VHTA 4ZV7A 4ZA2A 4BO1A 4YAUA 2AFIA 4KI0A 3LUDA 3VPAA 2X8AA 4EVSA 2HA6A 3V4LA 2UVDA 4DSUA 5JR3A 2Y8AA 4D3SA 1NJ6A 2EKBA 1OR8A 1CJCA 2DCUA 3UH0A 1MH9A 2YUIA 2C94A 2RHRA 2QQEA 3UANA 2EFJA 2Q3EA 5DTIA 3HZHA 5G4LA 2EFYA 2ZJ1A 3NAMA 4OIMA 1CJSA 4RORA 2Q46A 3H3EA 1R8QA 1CE8B 2PO7A 2REQA 3ZVMA 4FEEA 1J6UA 1EGHA 4Y1RA 1ZS9A 5I7WA 1VIAA 1XQ6A 2MHCA 1XVUA 3GEDA 2QLFA 4HDNB 3MINA 3PGLA 1IEQA 1I0IA 4JLDA 5JLJA 3C7CB 2ECQA 5FT9A 3OICA 2GCOB 3WFJA 2LD4A 4TVBA 1NMYA 3ZU4A 5IFLA 3BRWA 4X93A 2CFRA 3SXJA 1SXJA 2FSVA 3PWZA 4BE7B 3C3EA 4R2KA 3IPAA 5ISMA 4BO7A 2CE2X 3PUJA 4RWEA 2BHRA 4YO7A 4AMGA 1ZMTA 2NQ8A 3RG2A 1FTYA 3DDHA 3UMGA 3QU9A 4YEDA 2JC3A 2ZYTX 1QOZA 5EUQB 4OHZA 3AZOA 3DQQA 4ECAA 2DHDA 1PR4A 4D8VA 1NAHA 1OI3A 4BN0A 3IFSA 3NB0A 4TLLB 5AKLA 1R12A 4TVSA 5BQ3A 1QF6A 2O59A 2V8OA 3T5DA 1MZPA 5DBIA 4ARIA 4JL8A 3AY0A 5I3CA 3P71T 2WWVD 4CM1A 3ZI7A 4OXRA 3BF7A 1Y7TA 3IOEA 5HIJA 5LQCA 1EFHA 4MPPA 3C15C 4YV2A 2XD9A 1IEXA 2A94A 1TA0A 1UEIA 2Q6VA 1USGA 4MROA 4ND8B 4U2CA 5HOEA 1DC3A 1CYDA 3TQQA 3V7WA 2EEPA 1JLKA 3IB6A 5JY6A 1PQYA 3W8NA 1ZXXA 2BG7A 4M6WA 2AJLI 3R5FA 1I1OA 2X9NA 3PK0A 4IPTA 4JCCA 4LNAA 4LHXA 2IEGA 4TUYA 4UBNA 1A95A 1C1YA 3FGOA 1C3JA 3HUTA 4O3FA 1CUBA 2FVYA 3UV6A 4L51A 4BE9A 5E0OA 1GDHA 1XZDA 5A1JA 3LY8A 5K0TA 3JD0A 1VMDA 3MK31 3AUKA 4J6FA 3SDZA 3AEQA 5JNSA 1H0HA 1MA3A 1MT0A 4L85A 5THQA 1LNSA 3GUUA 1WTCA 5DZSA 1LVHA 1DJNA 1RKXA 4CF4A 2AT1A 3EZ2A 3NHBA 2NO6A 4ZO9A 2AI3A 3PD0A 4CM9A 1P74A 1J49A 4DCPA 4D2IA 2QRHA 4KG7A 2B36A 1GRVA 1P39A 2GRUA 3CU5A 5KYVA 4ZYYA 3PT9A 4GWKA 3RBAA 3GZ4A 1J23A 4O4LB 5AW9A 3F8WA 1O0SA 4ND6A 4RHTA 5LOVF 2FQQA 2PL5A 3WLTA 4C0AC 1PEDA 1Z5NA 4MQEA 2VWQA 1HFJA 1XZGA 3NC0C 4NMWA 4TQUS 3MOSA 5BQ5A 3L46A 1HNXB 1NBMA 1M73E 1U7WA 2X8JA 4K28A 4Z8XA 4OHYA 5A03A 3W8RA 1R0WA 2J32A 4US1R 1NXWA 4XWTA 3WA6A 3LP8A 3H4IA 1S7GA 3RUFA 2GD6A 3TAHA 2G06A 1R8JA 4CMIA 1BX1A 1U31A 3ONNA 4UDXX 3Q9UA 1L5QA 4EW1A 1QX4A 3FWNA 1P1BA 3JYPA 3I2KA 5AXCA 3CX8A 4LIPD 5GV8A 4C4AA 1A1SA 2AOUB 4RD4A 1QQAA 2V3CC 4LJRA 3DQZA 1WMFA 1Z47A 1AQ6A 2TYSB 1X1RA 4L6AA 4D1YA 2I4LA 1DTWB 3LLMA 3R74A 4WASA 2CVFA 4N1AA 5IS2A 5IHXA 2R68A 3CNEA 3F6YA 4PG8A 2XXAB 5IBRA 1G21B 1YULA 4JGBA 2C2WA 1BS2A 3L0SA 5JD6A 5K0BA 5EJ8A 1ZWLA 4B4WA 4KWCA 2IXEA 2YIJA 5PGMA 4JUBA 3QI7A 2MIIA 1IY8A 4PGHA 1NDUA 2NTVA 3HXTA 4PLVA 2MSKA 1CDEA 4EUHA 4CDRA 3D3WB 4CMBA 4I0WB 4R2WA 3L6OO 2H6AA 1E9DA 2JLSA 3HYRA 2VQEB 1CRPA 2C4VA 2GASA 4HYTA 5BVGB 3C97A 3DZGA 4MEJA 4AO8A 5K2OA 2PMKA 2VHZA 3PQ8A 1S3IA 1NP7A 1WKBA 1Z7WA 4JNKA 3ETLA 1XN4A 1Z0UA 4FI3F 4KIJA 4ACAA 5JO0A 2D4HA 1D2HA 1T6ZA 1FXUA 1IY9A 1AGXA 1H65A 1PJ2A 2HK7A 2ILVA 2XLCA 1DQPA 2FUG6 4OI4A 1OGIA 1U7PA 5FBZA 3W79A 3P0IA 4IV5A 3BEDA 3I5YA 4X6UA 5F2NA 4E5MA 1NV8A 4OLBA 3WLLA 1VLQA 4YBRA 3HBJA 3L04A 3EBPA 3S2YA 1NLMA 2PVSA 2PX6A 3BH0A 3GGOA 4I5EA 4C7OA 1DRJA 1T9GR 1L4YA 2D54A 2YWXA 3KIPA 4FDAA 2OBMA 4CM7A 4KXXA 4UM5A 1KMQA 2Y77A 4LC0A 4DARA 2PUAA 4D97A 1CUUA 5IVKA 3DXYA 4G5HA 4A82A 4KX3A 3CUEF 3OPXA 1SO8A 2UYYA 3Q3EA 1BKDR 3EX7C 1FU7A 1YR6A 3MT9A 4GPEA 2FFBA 4KPUA 3GR6A 4FQ5A 1Z35A 2I99A 2WPNA 5AKJA 3RD5A 3O9MA 5TLSA 1EDEA 3VU3A 3AJDA 3DMNA 1BVRA 1SCDA 1UODA 2R1UA 3LNTA 4QARA 4EOGA 2ZE7A 2Q8PA 4L0MA 2DLCX 3MTAA 5C7LO 5F5NA 1TJYA 3X1DA 2JARA 2FSIA 4BQQA 3FSGD 4HQ6A 1ZH4A 4D99A 5HGJA 5E38A 3PHCA 4HS4A 4ZJYA 1IM5A 721PA 2QTVB 4O4JB 4IGEA 5A4AA 2OCDA 3KWMA 1RQXA 2FPIB 3FTCA 5H4HA 3F3YA 3MSCA 1BHJA 1L4UA 4ON9A 1FJGB 3DLTA 3AF6A 4R7GA 5EV6A 1E92A 1NUQA 2GPBA 2O7VA 4RAQA 1FUEA 2X9VA 4WN9B 3EQ9A 4JJGA 2UVPA 3O2QB 2OUIA 4B8YA 1EH5A 5IXYA 2IXBA 1EK1A 5JSHA 1JWLA 4RAMA 2GK7A 1TUBA 1J20A 3D6FA 3IP3A 1A9OA 1E4EA 1AUXA 2Q62A 3G2KA 1AS0A 3QZUA 1I8TA 2ZJAA 1EFLA 5HZKA 4HGRA 4TSFD 1Z5ZA 2QVZX 2V9CA 2PA0A 4FXOA 2XR1A 5KCMA 4OI2A 3RUIA 2Q4TA 5KYUB 3KQYA 4Q66C 4PSDA 3IE2A 3VYSB 4Q9LA 3W1EA 1OH5A 2IKQA 2A92A 2VP4A 3NTXA 1KK1A 4BV9A 3HY4A 4EI9A 1DEKA 4MV3A 1YR8A 3BK2A 1TGYA 3EUFA 4TOIA 3AVXA 4JEIA 3R8XA 2PO5A 2V55B 4RESA 5CR9A 3T1OA 3GJRA 3UEOA 5T6BA 3OO1A 4KLAA 1W0CA 3GIDA 3KKOA 3RF6A 1TF2A 4TYFA 1EIZA 1QCCA 1R15A 2ILTA 4PGGA 4UARA 3VUFA 1A9YA 1FFEA 1UXIA 2FMTA 1QVWA 1Z4PX 1GCGA 1T9ZA 4YRTA 2XA9A 3VYRB 3L0PA 2XKJE 4Z9AA 1YOBA 2EX0A 3K5HA 5I45A 2YN2A 3ND9A 4FUQA 2RB4A 1OXMA 1KI1A 4LTMA 2H08A 3TLAA 1WF3A 2ZUUA 4MMXB 4YO8A 2I5PO 2OGZA 1N2JA 4MAAA 1VHLA 3ONEA 4K6KA 2IHYA 1G18A 2ZTUA 4GL4A 1YQEA 1LPPA 3AOGA 2VKQA 2Z2KA 1HFEL 5IUNC 5AOAA 3GW8A 3EMKA 4IDFA 4L28A 5BVGA 4C1DA 3ZCSA 3LSTA 4HDCA 1N4DA 1RQGA 4BY9E 3EN0A 1O96B 4CIVA 3OJFA 1NWHA 1N0UA 1U3GA 3MJFA 1PLJA 1S8OA 1YKFA 3RIXA 3WBJA 1HH4A 4Q3EA 1IUPA 1MB2A 3IP9A 4BVJA 2QRVB 2D5LA 1M6VB 1NZFA 4KSCA 5K0FA 1VRWA 1Y6JA 4LFAB 5JS1A 2AMLA 2XTJA 4FE3A 2AX3A 1S0UA 2P9GA 3RRYA 3DVQX 1I32A 4P38A 4UBMA 4GXTA 3MIIA 1UFOA 2CNLA 3DEYX 3MN1A 4RUKA 3TI7A 3ZR4B 1JE1A 1WLYA 3UJ3X 4XJSA 5IJ0B 1UDBA 3DVLA 2VYVD 5ALPA 4WNAB 4HRVA 5K0GA 4X6YA 2XUQA 1F6DA 1E5QA 3DWIA 3ESRA 1DD6A 3KQKA 2ZIXB 4TT3A 2QQ0A 2OORC 3JVUA 4BJ6A 3RWOA 4A2WA 4AF8A 3DHAA 4GG1A 4HB3A 3HKDB 1B23P 5L4NA 2OEPA 4IUYA 2IOFA 3HKBB 4NZYA 4RDXA 3AVOA 4UVIA 3DMFA 2XDAA 1P0MA 4UU8A 4DUZB 3ZGNA 1ZIPA 2KBEA 2I4MA 4GUDA 4IDQA 2OUKA 3UB4A 3MMXA 5FLKA 3ZXIA 4ZCTA 4XAQA 4YAFA 2UUCB 3F7NA 4CCYB 4U3JA 1KI4A 2C07A 3TNYA 3CH7A 3QOWA 3B82A 2IW1A 1N2SA 2YMMA 3WMXA 2AX4A 2GZDA 5IULC 4BNUA 3PEFA 3T7AA 3GZJA 4AY4A 4BVBA 2Y9MB 2JPDA 2OXRA 1LU9A 2WF9A 2G63A 1H5NA 2V9ZA 4MTCA 1B2RA 3ANMA 1GQYA 3GVPA 3HDGA 3NIBA 1WMSA 1A2KC 1UIRA 2VQDA 4U39A 1GG9A 5EJ6A 3TQFA 5EJFA 3HFRA 3QNUA 2AD1A 3VOTA 1UUFA 1TJ3A 4JEUA 3BB1A 4EHHA 3QFRA 4CGYA 2CZQA 4WN3A 3MCVA 4BATA 3LYUA 3AF5A 3QE2A 1RWNA 5CX1B 4GL2A 1P0QA 3H83A 5ENDA 1W5EA 3GT4A 5KHLB 4BNWA 2F8MA 1UC5B 3STUA 1Q0RA 2ETXA 5G40A 3JS5A 4UCXA 1CY6A 3P9NA 2FW7A 2QUBA 3ZWKA 1E6EA 3NO4A 4CN8A 2N0SA 4YRKA 4KOEC 4ZEVA 3T35A 4GNKA 3W6PA 4AJEA 1U28A 1LRKA 2Z8YA 2VSQA 5I4IA 3GLSA 2GMNA 3SKXA 3CW8X 4NBUA 2XIQA 2J9FA 2EERA 5MGNA 2QM3A 2BR5A 2XB6A 1SVSA 2UYXA 3GPDG 2QAGB 4LJSA 2ZRJA 1FP1D 4V24A 2QU8A 2PGIA 4IHJB 3K0EA 1NKVA 1WE2A 2FZEA 3MQFA 4MRVA 4QPJC 5J5VA 5C0OE 4B85A 4C4XA 2V6BA 1P0PA 4RZIA 4XUGB 2XCOA 4CF7A 1UOPA 1WD7A 2FUKA 4PYMA 3IVXA 4O2AA 4E51A 1G4HA 5JMTA 4YK7A 3CIOA 2O57A 3DNMA 1HLKA 3GVHA 4GX5A 5HP4A 2VSNA 1CKEA 1U7HA 1EVYA 2J9GA 4HWGA 5L53A 521PA 3VPHA 4Y2GA 3IL2A 1FMFA 1T3LA 1QTRA 2BEVA 2JCBA 2VJBA 3CONA 4M1WA 2QGNA 3HGQA 4QUGA 3TQIA 3BXZA 1JQKA 4QLAA 4DABA 3CVWA 1NVVQ 3IVGA 1JIUA 3D7SA 4LK3A 3TLGB 3JXEA 2D7CA 4UTOA 5GP1A 1IOZA 1RYDA 1WKCA 4FWTA 4DLNA 5CG2A 1NXVA 4NFHA 2DTEA 2BGWA 4NCNA 5LDGA 1A97A 3SBXA 3FDIA 5EA2A 4MI6A 5DJ5A 3BWYA 2JIBA 3OKFA 4G2NA 1HLDA 4G4GA 2FKNA 2GN8A 4KQJA 4DEXA 4D9KA 1MXFA 4TLBA 4M99A 3WWPA 3R5HA 3M34A 1CF9A 1RTKA 3IMEA 3KT8A 4PX5A 3A2LA 3QUAA 1CY1A 1KMIY 1JMKC 3HBFA 3S8YA 2ZCVA 4TXMA 4LG1A 3LYHA 2JS7A 2I2WA 3ST7A 4HLUC 1AKUA 2W6JD 3V8RA 4CL0A 5H0IA 3B60A 3MFYA 3WIOA 4D5GA 4WT7A 1FYXA 1NL3A 2AIOA 2A3RA 3ZWFA 1G7TA 1G55A 1G8HA 4RZSA 1R1DA 4BO5A 1BC2A 5C3UA 4BFCA 3LLSA 4R71A 4N3BA 3ROEA 4E46A 1AA6A 3STXA 1WDMA 4E94A 2ZAGA 5BMVB 2XMGA 5IVHA 2PEYA 4GYKA 1WP9A 3C5WP 4M22A 2ZWAA 3SKYA 2ZJ0A 1F8UA 3OLCX 4L5AA 4CCYA 1FFYA 4F3KA 3F74A 1LK0A 2EW1A 4AK9A 4IDOA 1P7YA 4GKJB 4YCJA 2X14A 5ERGB 4OQFA 3M89A 3K9NA 4J91A 4JFAA 1KP3A 2FU9A 1G6Q1 2I6XA 2OAEA 1E2FA 1Z34A 5HF6A 1QSGA 4JLVA 4JVNA 1KGSA 5CM2Z 1XN1A 4I9FA 4IIVA 4PC3A 1EXMA 3HR7A 4UZEA 4M0LA 1XZMA 1XV5A 3RUPA 3F7TA 3IS3A 1MVNA 3EEYA 4IFBA 4R05A 1K2WA 4LRTB 2PNFA 1ZW6A 2Q5OA 3K9LA 4UNPA 4B6GA 1PWYE 1TAQA 1MHTA 4AT1A 4KQWA 1SOAA 3VNQA 1KU0A 3NBFA 1U2QA 3V5NA 2E7YA 3TINA 1CEYA 1JKIA 1WPGA 3FPCA 3OA0A 2Y6VA 3L84A 5ECDA 1AUQA 1MAWA 3IEKA 2IV2X 3VR6D 1YFLA 1JG3A 4B84A 4ZCMA 3FF1A 3RV4A 3E4CA 2FEAA 5K45A 3ZI0A 1PYOA 2B5VA 4JBLA 5BWLA 1SB9A 4BUZA 2I34A 3LOUA 1JQBA 1VJGA 3AR2A 3KHTA 3OTGA 3PCXA 3V80A 4EG6A 2HZBA 4Z4CA 1CB0A 1A2QA 3LUCA 3RYCA 3TIFA 5EWLB 2JLXA 4J3JA 4OY3A 3QQPA 3QVKA 4IDDA 5MFPA 3QEKA 2ODTX 4UAMA 1AXEA 3CSSA 5DGDA 1FFWA 4PZDA 2FP4A 2XMSA 3CRMA 3LKZA 3MT0A 2GJSA 4RK1A 3SK0A 2PKXA 3CISA 5JWHA 3OFND 4BFXA 3NBMA 4A0SA 3DOFA 1L7MA 4QXAA 2P3SA 2ZJFA 4C5CA 5KOIA 3DH0A 4O63O 1XDGA 3FYHA 1PFGA 4IUBS 4DMFA 4K9PA 4NCIA 3L8MA 1SHTX 4JIGA 1T4BA 2HPZA 1UMBB 1TCAA 3ROZA 3RWBA 2JEOA 4NIMA 3AIMA 4P08A 3WQQA 5KU1A 4BKQA 4XGKA 3MT7A 3STVA 1JG2A 3D1VA 2L18A 4XIIA 3ZWYA 1Y89A 4TTAA 3VQZA 1M1YB 3HU1A 1E1QD 2CHUA 3IBTA 1OLUB 2XVAA 4R6XA 1CDOA 2IVFA 4TT3D 4DLAA 3D6AA 3DHNA 2PWPA 1RM3A 3HO6A 3M1YA 5TPZA 5KQSA 4DQUA 2VW8A 4O2AF 4DLTA 3I5AA 4ALKA 1KY5A 5F4ZA 4G5FA 3TS1A 1Q1QA 4HJRA 1ECJA 1YCHA 2G9UA 4IDPA 4B3IA 3VJRA 3O5AA 4OHBA 3DTNA 3ZNQA 1RFGE 4FIDA 2JGAA 3ZJUA 3UA4A 3MQ4A 4LKRA 1ZD5A 1MHPA 1UBRS 3BCRA 1T5BA 1XTQA 5JE8A 5A3QA 4JOSA 5CB0A 5LQNA 3GRVA 1ISFA 2HT1A 1MJGA 1TMOA 2MMCA 2P0EA 3WMEA 3U1BA 3ABOB 2H8GA 1Z0ZA 2GFKA 1C3OB 2YNVB 1D9ZA 2ID8A 2WHPB 3A4VA 5CVEA 2WKQA 4OXYA 4EZEA 1U0FA 1VCMA 2QVLA 3HO8A 2ORVA 3ZU3A 2Z9CA 2ZBFA 3PDHA 3CJTA 2Q5IA 1VL0A 2GFQA 3BIJA 1KBOA 4Q03A 5KHOC 1BWSA 1T4MA 1PX2A 3IESA 4WL0A 5B4VA 1F2DA 1TJ5A 3AEKB 5FCDA 3BCSA 4ZQEA 1H5QA 2PJDA 4JP3A 3WZ2A 3KSUA 2KYRA 4AP9A 3RAEC 2E1RA 2TSYB 3MCUA 4BMDA 1G5QA 4PCUA 2C4NA 2I7VA 4U2FA 1O7JA 3DAOA 4GWGA 2BVNA 1IH8A 1DMSA 1F5SA 1WL8A 1BA3A 1KY4A 4DG5A 4WCVA 4RK7A 5DYWA 5CD1A 1PE0A 3VR3D 4EA6A 1YSCA 1G42A 4ILKA 4QTYA 1L5RA 4RHYA 1DQZA 1I3MA 2GI4A 3EQ6A 5CFNA 1ZX1A 2BCGY 1SVWA 2IYYA 3H0CA 2I65A 4BBPA 1NFRA 3AG5A 3SW3A 3VC2A 4M0CA 3KL7A 2RHTA 4LHVA 1UXGA 3ENVA 3JAWA 3CH5A 4N76A 2XTZA 4DR5B 1E3SA 4R0MA 3ETDA 3HHPA 3X44A 1DXOA 5JYBA 2R84A 1JQEA 1R4AA 2Q5QA 3JQGA 4ATNA 2QAGC 4AP6A 4ND7A 2C2OA 4MICA 4KTVE 3N2LA 8MHTA 2O2GA 1ZLYA 3M3PA 2O3QA 3O82A 1E8MA 4NYJQ 1JR3D 3LDAA 3QUQA 5FAXA 4F2HA 3AVWA 3U60B 2Q1UA 2A2ZA 1JEJA 1RNLA 1ZD8A 3L9XA 3GFSA 3WRWA 3ZQ6A 4CTNA 3ICPA 1Y33E 3OESA 4PLHA 4AUNA 1GA4A 3IJEB 4N48A 1YQ9A 3AESA 1X87A 4GZ3A 5F33A 5FXMA 4YRNA 1F9EA 3AV3A 2ZTLA 2ORED 2OK8A 4OQ4A 1ANKA 1KA9H 2QZZA 2CK3A 3NBKA 4TMZA 4QTTB 2HZ7A 5FUXA 4R7TA 3R76A 1QE5A 2XZTA 4FX5A 1NG9A 3UK1A 1UK9A 4XDGA 5CFQA 1H3EA 3EIWA 2CCKA 4Y6PA 3WIBA 1M0WA 3KL4A 4F7WA 2ZTMA 5FJIA 2I2BA 3P2JA 1GGKA 4NK4A 3IOCA 4RPLA 3DZ8A 3B7GA 3WGHA 3VHRA 2QR3A 1AA9A 2OBXA 2UVQA 5FFMA 3SVZA 1ISIA 3IPLA 3MTJA 4Z54A 4OJNA 1YU9A 3RB8A 3T3GA 1XMOB 2YXPX 1Y7HA 1E2UA 3OM0A 3AT1A 5D6OA 4M88A 2WTAA 4M1ZA 1B8OA 3BWEA 1RWMA 3HXOA 4H59A 2UZIR 4L73A 5B4TA 1A4XA 5BSEA 2ISCA 2YHIB 3PNKA 4IXMA 4IVNA 4EUEA 1TVKB 1Q7GA 4R69A 1ZI8A 5HS4A 4FMDB 4F3TA 2ZUFA 2IS1A 4HZUA 4MUBA 1FFAA 4DLKA 4BECA 4UNQA 1KSJA 3DTVB 3BORA 1Q15A 3HWSA 2IOHA 1JALA 2BMVA 4XVRA 1HG0A 2JI6A 4Y6QA 2NTYC 4RJIA 2PKQO 3NWBA 4ZI7B 1CUVA 2CFIA 1R16A 4MB2A 3UFXA 3GJ0A 5D5PA 2HBRA 1TKBA 3P20A 2JL1A 3BMQA 3LW8A 5JZOA 3U4QA 1Q19A 1Z7GA 3G85A 2JAHA 1GGVA 2CJYA 4H0FA 3CPHA 3VYWA 3GEPA 1ECFA 1I4EB 3RGGA 2QYHA 2AWOA 3QG5A 5K4HA 1UM8A 2WV7A 4N5IX 2SHKA 3ZYCA 1XP8A 1VHQA 5CUQA 3KPWA 5EJAA 5HQ3B 5EHTA 1X19A 4L1KA 4MQ4A 4QQNA 1VGVA 2Y3IA 4UULA 2BKXA 4AJHA 3PUHA 4AI6A 4QYXA 4B3RB 2D7JA 2FW9A 1LZKA 2CNWD 5EZQA 4HAWA 3EXHA 4UMEA 3PHGA 3T7KA 1XCMA 4Q4AA 3ZQJA 4OQPA 2XRYA 3ZDEA 4CRWB 2O5CA 2OGSA 1R6VA 3BXFA 5HCIA 3H84A 4BMZA 2GPTA 1F3OA 5KVVA 3PUVA 1PK8A 3Q8MA 1Z13A 2WTMA 2GEVA 2XJ4A 4XM0A 2ZRFA 4M83A 3B3AA 3DVRX 2RBKA 2NYAA 3KSRA 2QD3A 4G25A 4YQZA 3TH5A 2RGNC 1KK0A 4BPRA 4F5WA 4ARZB 1QK3A 1OWLA 3KFVA 2H11A 5DI9A 3SY8A 4HBGA 1NQTA 3L1KA 1EVKA 1P9LA 3EZFA 3BREA 3WV5A 1PT7A 4I2VA 2IDZA 4ABYA 3FD8A 1JSLA 3FUTA 2GO7A 2XMPA 3ER6A 3QBTA 1K89A 3VPSA 4CKYA 4LEIA 2NP6A 1Q1ZA 2AYYA 2CF5A 2WYVA 3DHEA 1G2OA 3P0HA 2IYXA 3OPMA 1X7XA 3UMCA 5JC1A 4CTJA 5LMUB 4L9AA 4HTFB 3UMSA 2ZYIA 1HE4A 4H0CA 2FOLA 2PXHA 3ESCA 4MVJP 5ALEA 2AFHA 1D6SA 1KO4A 4CL3A 3T9MA 1GGNA 1NM5A 3G1UA 3IA2A 2A9PA 4ER0A 3T5PA 4CI9A 3Q10A 3ZEAA