4UBQA

Crystal structure of imp-2 metallo-beta-lactamase from acinetobacter spp.
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
218
structure length
218
Chain Sequence
b'LPDLKIEKLEEGVYVHTSFEEVNGWGVVSKHGLVVLVNTDAYLIDTPFTATDTEKLVNWFVERGYKIKGTISSHFHSDSTGGIEWLNSQSIPTYASELTNELLKKDGKVQAKNSFSGVSYWLVKNKIEVFYPGPGHTQDNVVVWLPEKKILFGGCFVKPDGLGNLGDANLEAWPKSAKILMSKYVKAKLVVSSHSEIGDASLLKRTWEQAVKGLNESK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
molecule tags Hydrolase
source organism Acinetobacter baumannii
publication title Crystal structure of IMP-2 metallo-beta-lactamase from Acinetobacter spp.: comparison of active-site loop structures between IMP-1 and IMP-2.
pubmed doi rcsb
total genus 66
structure length 218
sequence length 218
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4ubqA00
3Q6VA 2A7MA 1MQOA 2OHJA 2Q0IA 2BG6A 4AWYB 4C1HA 5A87A 2FU9A 5AHOA 2DOOA 4Z7RA 2FHXA 4EXYA 4EYFA 1DD6A 5ACWA 4ZNBA 3TP9A 4Z60A 3FCZA 4TZEA 1X8GA 4C1DA 3S0ZA 5ACPA 3IEMA 3ZNBA 5FQBA 5ACQA 5LMCA 2XR1A 4RM5A 3X2XA 2GCUA 1Y44A 4TZFA 4D1TA 4F6ZA 2BG2A 4UWPB 5AXRA 1SMLA 1L9YA 5FQCA 5K0WA 2NYPA 2AIOA 2FM6A 3KNSA 1ZTCA 4UBQA 4DIKA 2QINA 4D1WA 2BGAA 3PG4A 4EFZA 4YSLA 4D1VA 5HIPA 3WXCA 5LCAA 2I7VA 4HKYA 4D1UA 5KILA 2QJSA 3IELA 1X8IA 4TYFA 3PY5A 5LCHA 2M5CA 5ACRA 4RBSA 5HH6A 4UWOB 2OHIA 2YZ3A 5K4KA 1P9EA 4UWRB 4TYTA 5K4MA 2BC2A 5LE1A 2BFKA 4RL0A 4FEKA 4LE6A 5AHRA 2NZFA 3RKKA 2XF4A 1WUPA 2Y8BA 1K07A 1VMEA 5ACSA 5FQAA 5A0TA 4C1FA 4RL2A 3I11A 3F9OA 3SD9A 1WRAA 4AWZA 2P97A 4NQ5A 5AYAA 4GCWA 1WUOA 2I7TA 3T3OA 5LM6A 1WW1A 2YNUA 4V0HA 5AXOA 2FU8A 2GMNA 3ADRA 1BMCA 3KL7A 2E7YA 4J5FA 3VPEA 2BG8A 5A5ZA 3I14A 2YNVA 5EHTA 3SBLA 3AF6A 4JO0A 1ZNBA 2FU7A 4GYUA 3I13A 1BC2A 1X8HA 4NQ4A 2BG8B 5LCFA 4TZBA 3RPCA 1M2XA 1KO2A 5ACUA 5DPXA 2BFLA 1XM8A 2YNVB 2YNWA 2WYMC 4EYLA 4J5HA 3ESHA 5LSCA 4KEPA 2WHGA 5ACXA 1E5DA 3AJ3A 3X30A 2H6AA 1A7TA 1KR3A 4CHLA 4F6HA 2P18A 2WYMA 2BTNA 5ACVA 2Q0JA 4UAMA 2Q9UA 2VW8A 5HH4A 4C1GA 5B15A 3FAIA 3SFPA 4Z5YA 2BIBA 4C09A 1A8TA 3AF5A 2GFJA 3ZWFA 1QH5A 5HIOA 4ZEJA 3PY6A 4BZ3A 5LLDA 2NZEA 2YCBA 2BMIA 2UYXA 4HL2A 4TZ9A 1YCFA 3BK2A 4XWTA 2WRSA 4P62A 3X2YA 4BP0A 3QH8A 1YCHA 5B3RA 5EW0A 1DXKA 5LS3A 2ZZIA 5HISA 4AX0B 1BVTA 2GKLA 1JJEA 2NXAA 3SRXA 4WD6A 3MD7A 3P2UA 3DHCA 5EWAA 4NQ2A 2P4ZA 5HH5A 2Y87A 2ZNBA 3H3EA 4U4LA 2WYLA 5B1UA 4O98A 1YCGA 5K4NA 4NQ6A 4EXSA 2BR6A 5EV6A 4B87A 2BG7A 4ZO2A 4AX1B 5ACTA 3I0VA 2QDSA 2OHHA 3JXPA 3IEKA 5EH9A 1HLKA 3ZR9A 2GFKA 4FR7A 4EY2A 3BC2A 4FSBA 4PVOA 1ZKPA 3X2ZA 2Q42A 2ZWRA 1JJTA 4RAWA 3DH8A 3LVZA 4GYQA 3IE1A 2I7XA 4RAMA 3BK1A 2P1EA 4HL1A 4C1EA 2FU6A 3DHAA 4ZO3A 2QEDA 2BFZA 3A4YA 2Y8AA 5KIKA 2R2DA 1DDKA 2YNTA 4Z6XA 4D02A 4UA4A 3IE0A 2DKFA 3DHBA 2ZO4A 2AZ4A 2FK6A 4Z5ZA 3ZQ4A 3T9MA 5AEBA 4UWSB 2YNTB 3KNRA 3SPUA 3R2UA 4AD9A 4EYBA 3BV6A 4YSBA 2HB9A 5EVBA 1JT1A 2BFZB 3G1PA 3I15A 2QDTA 3RKJA 1VGNA 1QH3A 5IQKA 3IOFA 4XUKA 3IDZA 3T3NA 1KO3A 1VJNA 3IOGA 5A0VA 4DILA 4XWWA 1XTOA 3IE2A 4KEQA 5EV8A 5HIQA 3VQZA 4PVTA 2FHXB 2M5DA 4YSKA 3L6NA 4C1CA 3SW3A 4H0DA 4Z67A 5EVDA 5EVKA 2CBNA
chains in the Genus database with same CATH superfamily
3Q6VA 2A7MA 1MQOA 2OHJA 2Q0IA 2BG6A 4AWYB 4C1HA 5A87A 2FU9A 5AHOA 2DOOA 4Z7RA 2FHXA 4EXYA 4EYFA 1DD6A 5AIJA 5ACWA 4ZNBA 3TP9A 4Z60A 3FCZA 5AJLA 4TZEA 1X8GA 4C1DA 3S0ZA 5ACPA 3IEMA 3ZNBA 5FQBA 5ACQA 2XR1A 5LMCA 4RM5A 3X2XA 2GCUA 1Y44A 4TZFA 4D1TA 4F6ZA 2YHEA 2BG2A 4UWPB 5AXRA 1SMLA 1L9YA 5FQCA 5K0WA 2NYPA 2AIOA 2FM6A 3KNSA 1ZTCA 4UBQA 4DIKA 2QINA 4D1WA 2BGAA 3PG4A 4EFZA 4YSLA 4D1VA 5HIPA 3WXCA 5LCAA 2I7VA 4HKYA 4D1UA 5KILA 2QJSA 3IELA 1X8IA 4TYFA 3PY5A 5LCHA 2M5CA 5ACRA 4RBSA 5HH6A 4UWOB 2OHIA 2YZ3A 5K4KA 1P9EA 4UWRB 4TYTA 5K4MA 2BC2A 5LE1A 2BFKA 4RL0A 4FEKA 4LE6A 5AHRA 2NZFA 3RKKA 2XF4A 1WUPA 2Y8BA 1K07A 1VMEA 5ACSA 5FQAA 5A0TA 4C1FA 4RL2A 3I11A 3F9OA 3SD9A 1WRAA 4AWZA 2P97A 4NQ5A 5AYAA 4GCWA 1WUOA 2I7TA 3T3OA 5LM6A 1WW1A 2YNUA 4V0HA 5AXOA 2FU8A 2GMNA 3ADRA 1BMCA 3KL7A 2E7YA 4J5FA 3VPEA 2BG8A 4AV7A 5A5ZA 3I14A 2YNVA 2CFUA 5EHTA 3SBLA 3AF6A 4JO0A 1ZNBA 2FU7A 4GYUA 3I13A 1BC2A 1X8HA 4NQ4A 2BG8B 5LCFA 4TZBA 3RPCA 1M2XA 1KO2A 5ACUA 5DPXA 2BFLA 1XM8A 2YNVB 2YNWA 2WYMC 4EYLA 4J5HA 3ESHA 5LSCA 4KEPA 2WHGA 5ACXA 1E5DA 3AJ3A 3X30A 2H6AA 1A7TA 1KR3A 4CHLA 4F6HA 2P18A 2WYMA 2BTNA 5ACVA 2Q0JA 4UAMA 2Q9UA 2VW8A 5HH4A 4C1GA 5B15A 3FAIA 3SFPA 4Z5YA 2BIBA 4C09A 1A8TA 3AF5A 2GFJA 3ZWFA 1QH5A 5HIOA 4ZEJA 3PY6A 4BZ3A 5LLDA 2NZEA 2YCBA 2BMIA 2UYXA 4HL2A 4TZ9A 1YCFA 3BK2A 4XWTA 2WRSA 4P62A 3X2YA 4BP0A 3QH8A 1YCHA 5B3RA 5EW0A 1DXKA 5LS3A 2ZZIA 5HISA 4AX0B 1BVTA 2GKLA 1JJEA 2NXAA 3SRXA 4WD6A 3MD7A 3P2UA 3DHCA 5EWAA 4NQ2A 2P4ZA 5HH5A 2Y87A 2ZNBA 3H3EA 4U4LA 2WYLA 5B1UA 4O98A 1YCGA 5K4NA 4NQ6A 4EXSA 2BR6A 5EV6A 4B87A 2CG3A 2BG7A 4ZO2A 4AX1B 5ACTA 3I0VA 2QDSA 2OHHA 3JXPA 3IEKA 5EH9A 1HLKA 3ZR9A 2GFKA 4PDXA 4FR7A 4EY2A 3BC2A 4FSBA 4PVOA 1ZKPA 3X2ZA 2Q42A 2ZWRA 1JJTA 4RAWA 3DH8A 3LVZA 4GYQA 2CG2A 3IE1A 2I7XA 4RAMA 3BK1A 2P1EA 4HL1A 4C1EA 2FU6A 5A23A 3DHAA 4ZO3A 2QEDA 2BFZA 3A4YA 2Y8AA 5KIKA 2R2DA 1DDKA 2YNTA 4Z6XA 4D02A 4UA4A 3IE0A 2DKFA 3DHBA 2ZO4A 2AZ4A 2FK6A 4Z5ZA 3ZQ4A 3T9MA 5AEBA 4UWSB 2YNTB 3KNRA 3SPUA 3R2UA 4AD9A 4EYBA 3BV6A 4YSBA 2HB9A 5EVBA 1JT1A 2BFZB 3G1PA 3I15A 2QDTA 3RKJA 1VGNA 1QH3A 5IQKA 3IOFA 4XUKA 3IDZA 3T3NA 1KO3A 1VJNA 2CFZA 3IOGA 5A0VA 4DILA 4XWWA 1XTOA 3IE2A 4KEQA 5EV8A 5HIQA 3VQZA 4NURA 4PVTA 4AXHA 2FHXB 2M5DA 4YSKA 3L6NA 4C1CA 3SW3A 4H0DA 4Z67A 5EVDA 5EVKA 2CBNA
chains in the Genus database with same CATH topology
3Q6VA 2A7MA 1MQOA 2OHJA 2Q0IA 2BG6A 4AWYB 4C1HA 5A87A 2FU9A 5AHOA 2DOOA 4Z7RA 2FHXA 4EXYA 4EYFA 1DD6A 5ACWA 4ZNBA 3TP9A 4Z60A 3FCZA 4TZEA 1X8GA 4C1DA 3S0ZA 5ACPA 3IEMA 3ZNBA 5FQBA 5ACQA 5LMCA 2XR1A 4RM5A 3X2XA 2GCUA 1Y44A 4TZFA 4D1TA 4F6ZA 2BG2A 4UWPB 5AXRA 1SMLA 1L9YA 5FQCA 5K0WA 2NYPA 2AIOA 2FM6A 3KNSA 1ZTCA 4UBQA 4DIKA 2QINA 4D1WA 2BGAA 3PG4A 4EFZA 4YSLA 4D1VA 5HIPA 3WXCA 5LCAA 2I7VA 4HKYA 4D1UA 5KILA 2QJSA 3IELA 1X8IA 4TYFA 3PY5A 5LCHA 2M5CA 5ACRA 4RBSA 5HH6A 4UWOB 2OHIA 2YZ3A 5K4KA 1P9EA 4UWRB 4TYTA 5K4MA 2BC2A 5LE1A 2BFKA 4RL0A 4FEKA 4LE6A 5AHRA 2NZFA 3RKKA 2XF4A 1WUPA 2Y8BA 1K07A 1VMEA 5ACSA 5FQAA 5A0TA 4C1FA 4RL2A 3I11A 3F9OA 3SD9A 1WRAA 4AWZA 2P97A 4NQ5A 5AYAA 4GCWA 1WUOA 2I7TA 3T3OA 5LM6A 1WW1A 2YNUA 4V0HA 5AXOA 2FU8A 2GMNA 3ADRA 1BMCA 3KL7A 2E7YA 4J5FA 3VPEA 2BG8A 5A5ZA 3I14A 2YNVA 5EHTA 3SBLA 3AF6A 4JO0A 1ZNBA 2FU7A 4GYUA 3I13A 1BC2A 1X8HA 4NQ4A 2BG8B 5LCFA 4TZBA 3RPCA 1M2XA 1KO2A 5ACUA 5DPXA 2BFLA 1XM8A 2YNVB 2YNWA 2WYMC 4EYLA 4J5HA 3ESHA 5LSCA 4KEPA 2WHGA 5ACXA 1E5DA 3AJ3A 3X30A 2H6AA 1A7TA 1KR3A 4CHLA 4F6HA 2P18A 2WYMA 2BTNA 5ACVA 2Q0JA 4UAMA 2Q9UA 2VW8A 5HH4A 4C1GA 5B15A 3FAIA 3SFPA 4Z5YA 2BIBA 4C09A 1A8TA 3AF5A 2GFJA 3ZWFA 1QH5A 5HIOA 4ZEJA 3PY6A 4BZ3A 5LLDA 2NZEA 2YCBA 2BMIA 2UYXA 4HL2A 4TZ9A 1YCFA 3BK2A 4XWTA 2WRSA 4P62A 3X2YA 4BP0A 3QH8A 1YCHA 5B3RA 5EW0A 1DXKA 5LS3A 2ZZIA 5HISA 4AX0B 1BVTA 2GKLA 1JJEA 2NXAA 3SRXA 4WD6A 3MD7A 3P2UA 3DHCA 5EWAA 4NQ2A 2P4ZA 5HH5A 2Y87A 2ZNBA 3H3EA 4U4LA 2WYLA 5B1UA 4O98A 1YCGA 5K4NA 4NQ6A 4EXSA 2BR6A 5EV6A 4B87A 2BG7A 4ZO2A 4AX1B 5ACTA 3I0VA 2QDSA 2OHHA 3JXPA 3IEKA 5EH9A 1HLKA 3ZR9A 2GFKA 4FR7A 4EY2A 3BC2A 4FSBA 4PVOA 1ZKPA 3X2ZA 2Q42A 2ZWRA 1JJTA 4RAWA 3DH8A 3LVZA 4GYQA 3IE1A 2I7XA 4RAMA 3BK1A 2P1EA 4HL1A 4C1EA 2FU6A 3DHAA 4ZO3A 2QEDA 2BFZA 3A4YA 2Y8AA 5KIKA 2R2DA 1DDKA 2YNTA 4Z6XA 4D02A 4UA4A 3IE0A 2DKFA 3DHBA 2ZO4A 2AZ4A 2FK6A 4Z5ZA 3ZQ4A 3T9MA 5AEBA 4UWSB 2YNTB 3KNRA 3SPUA 3R2UA 4AD9A 4EYBA 3BV6A 4YSBA 2HB9A 5EVBA 1JT1A 2BFZB 3G1PA 3I15A 2QDTA 3RKJA 1VGNA 1QH3A 5IQKA 3IOFA 4XUKA 3IDZA 3T3NA 1KO3A 1VJNA 3IOGA 5A0VA 4DILA 4XWWA 1XTOA 3IE2A 4KEQA 5EV8A 5HIQA 3VQZA 4PVTA 2FHXB 2M5DA 4YSKA 3L6NA 4C1CA 3SW3A 4H0DA 4Z67A 5EVDA 5EVKA 2CBNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q6V A;  2A7M A;  1MQO A;  2OHJ A;  2Q0I A;  2BG6 A;  4AWY B;  4C1H A;  5A87 A;  2FU9 A;  5AHO A;  2DOO A;  4Z7R A;  2FHX A;  4EXY A;  4EYF A;  1DD6 A;  5ACW A;  4ZNB A;  3TP9 A;  4Z60 A;  3FCZ A;  4TZE A;  1X8G A;  4C1D A;  3S0Z A;  5ACP A;  3IEM A;  3ZNB A;  5FQB A;  5ACQ A;  5LMC A;  2XR1 A;  4RM5 A;  3X2X A;  2GCU A;  1Y44 A;  4TZF A;  4D1T A;  4F6Z A;  2BG2 A;  4UWP B;  5AXR A;  1SML A;  1L9Y A;  5FQC A;  5K0W A;  2NYP A;  2AIO A;  2FM6 A;  3KNS A;  1ZTC A;  4UBQ A;  4DIK A;  2QIN A;  4D1W A;  2BGA A;  3PG4 A;  4EFZ A;  4YSL A;  4D1V A;  5HIP A;  3WXC A;  5LCA A;  2I7V A;  4HKY A;  4D1U A;  5KIL A;  2QJS A;  3IEL A;  1X8I A;  4TYF A;  3PY5 A;  5LCH A;  2M5C A;  5ACR A;  4RBS A;  5HH6 A;  4UWO B;  2OHI A;  2YZ3 A;  5K4K A;  1P9E A;  4UWR B;  4TYT A;  5K4M A;  2BC2 A;  5LE1 A;  2BFK A;  4RL0 A;  4FEK A;  4LE6 A;  5AHR A;  2NZF A;  3RKK A;  2XF4 A;  1WUP A;  2Y8B A;  1K07 A;  1VME A;  5ACS A;  5FQA A;  5A0T A;  4C1F A;  4RL2 A;  3I11 A;  3F9O A;  3SD9 A;  1WRA A;  4AWZ A;  2P97 A;  4NQ5 A;  5AYA A;  4GCW A;  1WUO A;  2I7T A;  3T3O A;  5LM6 A;  1WW1 A;  2YNU A;  4V0H A;  5AXO A;  2FU8 A;  2GMN A;  3ADR A;  1BMC A;  3KL7 A;  2E7Y A;  4J5F A;  3VPE A;  2BG8 A;  5A5Z A;  3I14 A;  2YNV A;  5EHT A;  3SBL A;  3AF6 A;  4JO0 A;  1ZNB A;  2FU7 A;  4GYU A;  3I13 A;  1BC2 A;  1X8H A;  4NQ4 A;  2BG8 B;  5LCF A;  4TZB A;  3RPC A;  1M2X A;  1KO2 A;  5ACU A;  5DPX A;  2BFL A;  1XM8 A;  2YNV B;  2YNW A;  2WYM C;  4EYL A;  4J5H A;  3ESH A;  5LSC A;  4KEP A;  2WHG A;  5ACX A;  1E5D A;  3AJ3 A;  3X30 A;  2H6A A;  1A7T A;  1KR3 A;  4CHL A;  4F6H A;  2P18 A;  2WYM A;  2BTN A;  5ACV A;  2Q0J A;  4UAM A;  2Q9U A;  2VW8 A;  5HH4 A;  4C1G A;  5B15 A;  3FAI A;  3SFP A;  4Z5Y A;  2BIB A;  4C09 A;  1A8T A;  3AF5 A;  2GFJ A;  3ZWF A;  1QH5 A;  5HIO A;  4ZEJ A;  3PY6 A;  4BZ3 A;  5LLD A;  2NZE A;  2YCB A;  2BMI A;  2UYX A;  4HL2 A;  4TZ9 A;  1YCF A;  3BK2 A;  4XWT A;  2WRS A;  4P62 A;  3X2Y A;  4BP0 A;  3QH8 A;  1YCH A;  5B3R A;  5EW0 A;  1DXK A;  5LS3 A;  2ZZI A;  5HIS A;  4AX0 B;  1BVT A;  2GKL A;  1JJE A;  2NXA A;  3SRX A;  4WD6 A;  3MD7 A;  3P2U A;  3DHC A;  5EWA A;  4NQ2 A;  2P4Z A;  5HH5 A;  2Y87 A;  2ZNB A;  3H3E A;  4U4L A;  2WYL A;  5B1U A;  4O98 A;  1YCG A;  5K4N A;  4NQ6 A;  4EXS A;  2BR6 A;  5EV6 A;  4B87 A;  2BG7 A;  4ZO2 A;  4AX1 B;  5ACT A;  3I0V A;  2QDS A;  2OHH A;  3JXP A;  3IEK A;  5EH9 A;  1HLK A;  3ZR9 A;  2GFK A;  4FR7 A;  4EY2 A;  3BC2 A;  4FSB A;  4PVO A;  1ZKP A;  3X2Z A;  2Q42 A;  2ZWR A;  1JJT A;  4RAW A;  3DH8 A;  3LVZ A;  4GYQ A;  3IE1 A;  2I7X A;  4RAM A;  3BK1 A;  2P1E A;  4HL1 A;  4C1E A;  2FU6 A;  3DHA A;  4ZO3 A;  2QED A;  2BFZ A;  3A4Y A;  2Y8A A;  5KIK A;  2R2D A;  1DDK A;  2YNT A;  4Z6X A;  4D02 A;  4UA4 A;  3IE0 A;  2DKF A;  3DHB A;  2ZO4 A;  2AZ4 A;  2FK6 A;  4Z5Z A;  3ZQ4 A;  3T9M A;  5AEB A;  4UWS B;  2YNT B;  3KNR A;  3SPU A;  3R2U A;  4AD9 A;  4EYB A;  3BV6 A;  4YSB A;  2HB9 A;  5EVB A;  1JT1 A;  2BFZ B;  3G1P A;  3I15 A;  2QDT A;  3RKJ A;  1VGN A;  1QH3 A;  5IQK A;  3IOF A;  4XUK A;  3IDZ A;  3T3N A;  1KO3 A;  1VJN A;  3IOG A;  5A0V A;  4DIL A;  4XWW A;  1XTO A;  3IE2 A;  4KEQ A;  5EV8 A;  5HIQ A;  3VQZ A;  4PVT A;  2FHX B;  2M5D A;  4YSK A;  3L6N A;  4C1C A;  3SW3 A;  4H0D A;  4Z67 A;  5EVD A;  5EVK A;  2CBN A; 
#chains in the Genus database with same CATH topology
 3Q6V A;  2A7M A;  1MQO A;  2OHJ A;  2Q0I A;  2BG6 A;  4AWY B;  4C1H A;  5A87 A;  2FU9 A;  5AHO A;  2DOO A;  4Z7R A;  2FHX A;  4EXY A;  4EYF A;  1DD6 A;  5AIJ A;  5ACW A;  4ZNB A;  3TP9 A;  4Z60 A;  3FCZ A;  5AJL A;  4TZE A;  1X8G A;  4C1D A;  3S0Z A;  5ACP A;  3IEM A;  3ZNB A;  5FQB A;  5ACQ A;  2XR1 A;  5LMC A;  4RM5 A;  3X2X A;  2GCU A;  1Y44 A;  4TZF A;  4D1T A;  4F6Z A;  2YHE A;  2BG2 A;  4UWP B;  5AXR A;  1SML A;  1L9Y A;  5FQC A;  5K0W A;  2NYP A;  2AIO A;  2FM6 A;  3KNS A;  1ZTC A;  4UBQ A;  4DIK A;  2QIN A;  4D1W A;  2BGA A;  3PG4 A;  4EFZ A;  4YSL A;  4D1V A;  5HIP A;  3WXC A;  5LCA A;  2I7V A;  4HKY A;  4D1U A;  5KIL A;  2QJS A;  3IEL A;  1X8I A;  4TYF A;  3PY5 A;  5LCH A;  2M5C A;  5ACR A;  4RBS A;  5HH6 A;  4UWO B;  2OHI A;  2YZ3 A;  5K4K A;  1P9E A;  4UWR B;  4TYT A;  5K4M A;  2BC2 A;  5LE1 A;  2BFK A;  4RL0 A;  4FEK A;  4LE6 A;  5AHR A;  2NZF A;  3RKK A;  2XF4 A;  1WUP A;  2Y8B A;  1K07 A;  1VME A;  5ACS A;  5FQA A;  5A0T A;  4C1F A;  4RL2 A;  3I11 A;  3F9O A;  3SD9 A;  1WRA A;  4AWZ A;  2P97 A;  4NQ5 A;  5AYA A;  4GCW A;  1WUO A;  2I7T A;  3T3O A;  5LM6 A;  1WW1 A;  2YNU A;  4V0H A;  5AXO A;  2FU8 A;  2GMN A;  3ADR A;  1BMC A;  3KL7 A;  2E7Y A;  4J5F A;  3VPE A;  2BG8 A;  4AV7 A;  5A5Z A;  3I14 A;  2YNV A;  2CFU A;  5EHT A;  3SBL A;  3AF6 A;  4JO0 A;  1ZNB A;  2FU7 A;  4GYU A;  3I13 A;  1BC2 A;  1X8H A;  4NQ4 A;  2BG8 B;  5LCF A;  4TZB A;  3RPC A;  1M2X A;  1KO2 A;  5ACU A;  5DPX A;  2BFL A;  1XM8 A;  2YNV B;  2YNW A;  2WYM C;  4EYL A;  4J5H A;  3ESH A;  5LSC A;  4KEP A;  2WHG A;  5ACX A;  1E5D A;  3AJ3 A;  3X30 A;  2H6A A;  1A7T A;  1KR3 A;  4CHL A;  4F6H A;  2P18 A;  2WYM A;  2BTN A;  5ACV A;  2Q0J A;  4UAM A;  2Q9U A;  2VW8 A;  5HH4 A;  4C1G A;  5B15 A;  3FAI A;  3SFP A;  4Z5Y A;  2BIB A;  4C09 A;  1A8T A;  3AF5 A;  2GFJ A;  3ZWF A;  1QH5 A;  5HIO A;  4ZEJ A;  3PY6 A;  4BZ3 A;  5LLD A;  2NZE A;  2YCB A;  2BMI A;  2UYX A;  4HL2 A;  4TZ9 A;  1YCF A;  3BK2 A;  4XWT A;  2WRS A;  4P62 A;  3X2Y A;  4BP0 A;  3QH8 A;  1YCH A;  5B3R A;  5EW0 A;  1DXK A;  5LS3 A;  2ZZI A;  5HIS A;  4AX0 B;  1BVT A;  2GKL A;  1JJE A;  2NXA A;  3SRX A;  4WD6 A;  3MD7 A;  3P2U A;  3DHC A;  5EWA A;  4NQ2 A;  2P4Z A;  5HH5 A;  2Y87 A;  2ZNB A;  3H3E A;  4U4L A;  2WYL A;  5B1U A;  4O98 A;  1YCG A;  5K4N A;  4NQ6 A;  4EXS A;  2BR6 A;  5EV6 A;  4B87 A;  2CG3 A;  2BG7 A;  4ZO2 A;  4AX1 B;  5ACT A;  3I0V A;  2QDS A;  2OHH A;  3JXP A;  3IEK A;  5EH9 A;  1HLK A;  3ZR9 A;  2GFK A;  4PDX A;  4FR7 A;  4EY2 A;  3BC2 A;  4FSB A;  4PVO A;  1ZKP A;  3X2Z A;  2Q42 A;  2ZWR A;  1JJT A;  4RAW A;  3DH8 A;  3LVZ A;  4GYQ A;  2CG2 A;  3IE1 A;  2I7X A;  4RAM A;  3BK1 A;  2P1E A;  4HL1 A;  4C1E A;  2FU6 A;  5A23 A;  3DHA A;  4ZO3 A;  2QED A;  2BFZ A;  3A4Y A;  2Y8A A;  5KIK A;  2R2D A;  1DDK A;  2YNT A;  4Z6X A;  4D02 A;  4UA4 A;  3IE0 A;  2DKF A;  3DHB A;  2ZO4 A;  2AZ4 A;  2FK6 A;  4Z5Z A;  3ZQ4 A;  3T9M A;  5AEB A;  4UWS B;  2YNT B;  3KNR A;  3SPU A;  3R2U A;  4AD9 A;  4EYB A;  3BV6 A;  4YSB A;  2HB9 A;  5EVB A;  1JT1 A;  2BFZ B;  3G1P A;  3I15 A;  2QDT A;  3RKJ A;  1VGN A;  1QH3 A;  5IQK A;  3IOF A;  4XUK A;  3IDZ A;  3T3N A;  1KO3 A;  1VJN A;  2CFZ A;  3IOG A;  5A0V A;  4DIL A;  4XWW A;  1XTO A;  3IE2 A;  4KEQ A;  5EV8 A;  5HIQ A;  3VQZ A;  4NUR A;  4PVT A;  4AXH A;  2FHX B;  2M5D A;  4YSK A;  3L6N A;  4C1C A;  3SW3 A;  4H0D A;  4Z67 A;  5EVD A;  5EVK A;  2CBN A; 
#chains in the Genus database with same CATH homology
 3Q6V A;  2A7M A;  1MQO A;  2OHJ A;  2Q0I A;  2BG6 A;  4AWY B;  4C1H A;  5A87 A;  2FU9 A;  5AHO A;  2DOO A;  4Z7R A;  2FHX A;  4EXY A;  4EYF A;  1DD6 A;  5ACW A;  4ZNB A;  3TP9 A;  4Z60 A;  3FCZ A;  4TZE A;  1X8G A;  4C1D A;  3S0Z A;  5ACP A;  3IEM A;  3ZNB A;  5FQB A;  5ACQ A;  5LMC A;  2XR1 A;  4RM5 A;  3X2X A;  2GCU A;  1Y44 A;  4TZF A;  4D1T A;  4F6Z A;  2BG2 A;  4UWP B;  5AXR A;  1SML A;  1L9Y A;  5FQC A;  5K0W A;  2NYP A;  2AIO A;  2FM6 A;  3KNS A;  1ZTC A;  4UBQ A;  4DIK A;  2QIN A;  4D1W A;  2BGA A;  3PG4 A;  4EFZ A;  4YSL A;  4D1V A;  5HIP A;  3WXC A;  5LCA A;  2I7V A;  4HKY A;  4D1U A;  5KIL A;  2QJS A;  3IEL A;  1X8I A;  4TYF A;  3PY5 A;  5LCH A;  2M5C A;  5ACR A;  4RBS A;  5HH6 A;  4UWO B;  2OHI A;  2YZ3 A;  5K4K A;  1P9E A;  4UWR B;  4TYT A;  5K4M A;  2BC2 A;  5LE1 A;  2BFK A;  4RL0 A;  4FEK A;  4LE6 A;  5AHR A;  2NZF A;  3RKK A;  2XF4 A;  1WUP A;  2Y8B A;  1K07 A;  1VME A;  5ACS A;  5FQA A;  5A0T A;  4C1F A;  4RL2 A;  3I11 A;  3F9O A;  3SD9 A;  1WRA A;  4AWZ A;  2P97 A;  4NQ5 A;  5AYA A;  4GCW A;  1WUO A;  2I7T A;  3T3O A;  5LM6 A;  1WW1 A;  2YNU A;  4V0H A;  5AXO A;  2FU8 A;  2GMN A;  3ADR A;  1BMC A;  3KL7 A;  2E7Y A;  4J5F A;  3VPE A;  2BG8 A;  5A5Z A;  3I14 A;  2YNV A;  5EHT A;  3SBL A;  3AF6 A;  4JO0 A;  1ZNB A;  2FU7 A;  4GYU A;  3I13 A;  1BC2 A;  1X8H A;  4NQ4 A;  2BG8 B;  5LCF A;  4TZB A;  3RPC A;  1M2X A;  1KO2 A;  5ACU A;  5DPX A;  2BFL A;  1XM8 A;  2YNV B;  2YNW A;  2WYM C;  4EYL A;  4J5H A;  3ESH A;  5LSC A;  4KEP A;  2WHG A;  5ACX A;  1E5D A;  3AJ3 A;  3X30 A;  2H6A A;  1A7T A;  1KR3 A;  4CHL A;  4F6H A;  2P18 A;  2WYM A;  2BTN A;  5ACV A;  2Q0J A;  4UAM A;  2Q9U A;  2VW8 A;  5HH4 A;  4C1G A;  5B15 A;  3FAI A;  3SFP A;  4Z5Y A;  2BIB A;  4C09 A;  1A8T A;  3AF5 A;  2GFJ A;  3ZWF A;  1QH5 A;  5HIO A;  4ZEJ A;  3PY6 A;  4BZ3 A;  5LLD A;  2NZE A;  2YCB A;  2BMI A;  2UYX A;  4HL2 A;  4TZ9 A;  1YCF A;  3BK2 A;  4XWT A;  2WRS A;  4P62 A;  3X2Y A;  4BP0 A;  3QH8 A;  1YCH A;  5B3R A;  5EW0 A;  1DXK A;  5LS3 A;  2ZZI A;  5HIS A;  4AX0 B;  1BVT A;  2GKL A;  1JJE A;  2NXA A;  3SRX A;  4WD6 A;  3MD7 A;  3P2U A;  3DHC A;  5EWA A;  4NQ2 A;  2P4Z A;  5HH5 A;  2Y87 A;  2ZNB A;  3H3E A;  4U4L A;  2WYL A;  5B1U A;  4O98 A;  1YCG A;  5K4N A;  4NQ6 A;  4EXS A;  2BR6 A;  5EV6 A;  4B87 A;  2BG7 A;  4ZO2 A;  4AX1 B;  5ACT A;  3I0V A;  2QDS A;  2OHH A;  3JXP A;  3IEK A;  5EH9 A;  1HLK A;  3ZR9 A;  2GFK A;  4FR7 A;  4EY2 A;  3BC2 A;  4FSB A;  4PVO A;  1ZKP A;  3X2Z A;  2Q42 A;  2ZWR A;  1JJT A;  4RAW A;  3DH8 A;  3LVZ A;  4GYQ A;  3IE1 A;  2I7X A;  4RAM A;  3BK1 A;  2P1E A;  4HL1 A;  4C1E A;  2FU6 A;  3DHA A;  4ZO3 A;  2QED A;  2BFZ A;  3A4Y A;  2Y8A A;  5KIK A;  2R2D A;  1DDK A;  2YNT A;  4Z6X A;  4D02 A;  4UA4 A;  3IE0 A;  2DKF A;  3DHB A;  2ZO4 A;  2AZ4 A;  2FK6 A;  4Z5Z A;  3ZQ4 A;  3T9M A;  5AEB A;  4UWS B;  2YNT B;  3KNR A;  3SPU A;  3R2U A;  4AD9 A;  4EYB A;  3BV6 A;  4YSB A;  2HB9 A;  5EVB A;  1JT1 A;  2BFZ B;  3G1P A;  3I15 A;  2QDT A;  3RKJ A;  1VGN A;  1QH3 A;  5IQK A;  3IOF A;  4XUK A;  3IDZ A;  3T3N A;  1KO3 A;  1VJN A;  3IOG A;  5A0V A;  4DIL A;  4XWW A;  1XTO A;  3IE2 A;  4KEQ A;  5EV8 A;  5HIQ A;  3VQZ A;  4PVT A;  2FHX B;  2M5D A;  4YSK A;  3L6N A;  4C1C A;  3SW3 A;  4H0D A;  4Z67 A;  5EVD A;  5EVK A;  2CBN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...