4GYUA

Crystal structure of new delhi metallo-beta-lactamase-1 a121f mutant from klebsiella pneumoniae
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
241
structure length
241
Chain Sequence
b'NAIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHFHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase NDM-1
publication title Crystal Structure of New Delhi Metallo-beta-Lactamase-1 A121F mutant from Klebsiella pneumoniae
rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
total genus 73
structure length 241
sequence length 241
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4gyuA00
2BG7A 4ZO2A 2FHXB 4LE6A 4YSLA 4Z60A 2GCUA 5EHTA 3SBLA 2WYMC 2YNUA 2P1EA 2UYXA 4EY2A 3F9OA 5K4KA 2Q9UA 1YCFA 5A87A 2XR1A 3VQZA 2I7VA 2NXAA 2GMNA 4JO0A 4AX0B 1JT1A 2OHHA 3VPEA 5ACUA 2Y8BA 4DILA 1SMLA 2WYLA 2BG6A 5LCHA 2YNVA 3L6NA 1M2XA 3RKKA 5LS3A 4KEPA 3SPUA 3MD7A 4XUKA 3X2ZA 3H3EA 3JXPA 2OHIA 4GYQA 5HIPA 2FU8A 2AZ4A 1VJNA 3IELA 4UWSB 3QH8A 5ACRA 4ZO3A 2M5DA 3R2UA 3IEKA 4AWZA 5EW0A 2FU9A 5EWAA 1WW1A 2Q0JA 3ADRA 4UBQA 2I7XA 2Y8AA 2NZEA 4NQ4A 2YCBA 4O98A 2I7TA 4BZ3A 4J5FA 1HLKA 5A0TA 3S0ZA 3ESHA 3P2UA 5EH9A 1ZKPA 4FEKA 3BV6A 1P9EA 1KO3A 2FU6A 5K4NA 3SFPA 3DHCA 3SW3A 3I14A 2QJSA 3AF6A 4C1FA 4TZFA 5HISA 1WRAA 3A4YA 2BFLA 3IE2A 2YNVB 4UWPB 5ACTA 4Z7RA 3BC2A 5LM6A 3I13A 4PVTA 3SRXA 2Q0IA 3RKJA 2YNWA 1A8TA 2BGAA 4KEQA 4UWRB 4C1DA 4UAMA 4GCWA 5EVKA 3IE0A 3I15A 4ZEJA 4H0DA 5EV6A 5ACPA 4AWYB 4RL2A 5K0WA 3T3NA 3PY5A 4V0HA 4D1UA 4C09A 4B87A 1DXKA 4AX1B 5LE1A 5HH6A 2H6AA 4RM5A 5A0VA 2BFKA 2WRSA 2Q42A 4CHLA 3X2YA 5HH4A 4Z5YA 3FCZA 5LLDA 5LCFA 5K4MA 4D1VA 1YCHA 4J5HA 5EVDA 4BP0A 4Z5ZA 1E5DA 3FAIA 5AHOA 1WUOA 2GFKA 3PG4A 2BG8A 5B15A 2WYMA 4F6ZA 4FSBA 5AXOA 2A7MA 1KR3A 2DKFA 1ZTCA 2XF4A 3IDZA 3Q6VA 3X2XA 4UA4A 2QINA 3IOFA 2M5CA 4U4LA 2QDSA 1X8HA 3X30A 5KILA 4UWOB 4RBSA 3LVZA 4WD6A 1QH5A 3KNSA 1MQOA 4PVOA 3PY6A 2Y87A 5ACSA 4NQ6A 4EXSA 2BG2A 5EV8A 4F6HA 4HL1A 2NZFA 5A5ZA 4Z67A 3T3OA 2HB9A 2YZ3A 4C1GA 2BC2A 4RL0A 5KIKA 2QDTA 4EYFA 1QH3A 3T9MA 4C1HA 5HIOA 5IQKA 3DHAA 5AHRA 5B1UA 2BMIA 4TZEA 3KL7A 4AD9A 4EXYA 2WHGA 3BK2A 4HKYA 1K07A 1A7TA 3ZR9A 5ACWA 3DH8A 2QEDA 5AXRA 2CBNA 2BG8B 4YSKA 2BIBA 4DIKA 5EVBA 2ZZIA 4C1EA 2BFZA 2BR6A 2NYPA 2ZNBA 2E7YA 4D1WA 1X8IA 3DHBA 1XM8A 1ZNBA 2P4ZA 4TZ9A 4YSBA 5ACVA 5FQCA 1DDKA 2YNTA 1DD6A 1YCGA 2FK6A 3G1PA 2OHJA 5DPXA 3RPCA 1VMEA 2GFJA 3AJ3A 3BK1A 2P18A 5HIQA 2FHXA 4P62A 4FR7A 5FQBA 1JJTA 3SD9A 3KNRA 4EYLA 3I0VA 2AIOA 2VW8A 5LSCA 4NQ2A 2ZO4A 3ZNBA 2R2DA 3ZWFA 1L9YA 1BVTA 5LCAA 5FQAA 1KO2A 2BTNA 5AYAA 3IOGA 4TZBA 2GKLA 2FU7A 3TP9A 4TYFA 3WXCA 1XTOA 3AF5A 1Y44A 4D1TA 4GYUA 4XWWA 4ZNBA 3IEMA 1JJEA 4EYBA 5HH5A 1WUPA 2BFZB 2ZWRA 5ACQA 4C1CA 4Z6XA 5LMCA 4NQ5A 4HL2A 5AEBA 1VGNA 3I11A 2YNTB 1BMCA 3ZQ4A 4TYTA 1BC2A 4RAWA 4RAMA 3IE1A 4EFZA 1X8GA 4D02A 4XWTA 5B3RA 2DOOA 2P97A 2FM6A 5ACXA
chains in the Genus database with same CATH superfamily
2BG7A 4ZO2A 2FHXB 4LE6A 4YSLA 4Z60A 2GCUA 5EHTA 3SBLA 2WYMC 2YNUA 2P1EA 2UYXA 4EY2A 3F9OA 5K4KA 2Q9UA 1YCFA 5A87A 2XR1A 3VQZA 2I7VA 2NXAA 2GMNA 4JO0A 4AX0B 1JT1A 2OHHA 3VPEA 5ACUA 2Y8BA 4DILA 1SMLA 2WYLA 2BG6A 5LCHA 2YNVA 3L6NA 1M2XA 3RKKA 5LS3A 4KEPA 3SPUA 3MD7A 4XUKA 3X2ZA 3H3EA 3JXPA 2OHIA 4GYQA 5HIPA 2FU8A 2AZ4A 1VJNA 3IELA 4UWSB 3QH8A 5ACRA 4ZO3A 2M5DA 3R2UA 3IEKA 4AWZA 5EW0A 2FU9A 5EWAA 1WW1A 2Q0JA 3ADRA 4UBQA 2I7XA 2Y8AA 2NZEA 4NQ4A 2YCBA 4O98A 2I7TA 4BZ3A 4J5FA 1HLKA 5A0TA 3S0ZA 3ESHA 3P2UA 5EH9A 1ZKPA 4FEKA 3BV6A 1P9EA 1KO3A 2FU6A 5K4NA 3SFPA 3DHCA 3SW3A 3I14A 2QJSA 3AF6A 4C1FA 5AIJA 4TZFA 5HISA 2CFZA 1WRAA 3A4YA 2BFLA 3IE2A 2YNVB 4UWPB 5ACTA 4Z7RA 3BC2A 5LM6A 3I13A 4PVTA 3SRXA 2Q0IA 3RKJA 2YNWA 1A8TA 2BGAA 4KEQA 4UWRB 4C1DA 4UAMA 4GCWA 5EVKA 3IE0A 3I15A 4ZEJA 4H0DA 5EV6A 5ACPA 4AWYB 4RL2A 5K0WA 3T3NA 3PY5A 4V0HA 5A23A 4D1UA 4C09A 4B87A 1DXKA 4AX1B 5LE1A 5HH6A 2H6AA 4RM5A 5A0VA 2BFKA 2WRSA 4AV7A 2Q42A 4CHLA 3X2YA 5HH4A 4Z5YA 3FCZA 5LLDA 5LCFA 5K4MA 4D1VA 1YCHA 4J5HA 5EVDA 4BP0A 4Z5ZA 1E5DA 3FAIA 5AHOA 1WUOA 2GFKA 3PG4A 2BG8A 5B15A 2WYMA 4F6ZA 4FSBA 5AXOA 2A7MA 1KR3A 2DKFA 1ZTCA 2XF4A 3IDZA 3Q6VA 3X2XA 2YHEA 4UA4A 2QINA 3IOFA 2CG2A 2M5CA 4U4LA 2QDSA 1X8HA 3X30A 5KILA 4UWOB 4RBSA 3LVZA 4WD6A 1QH5A 3KNSA 1MQOA 4PVOA 3PY6A 2Y87A 5ACSA 4NQ6A 4EXSA 2BG2A 5EV8A 4F6HA 4HL1A 2NZFA 5A5ZA 4Z67A 3T3OA 2HB9A 2YZ3A 4C1GA 2BC2A 4RL0A 5KIKA 2QDTA 4EYFA 1QH3A 3T9MA 4C1HA 5HIOA 5IQKA 3DHAA 5AHRA 5B1UA 2BMIA 4TZEA 3KL7A 4AD9A 4EXYA 2WHGA 3BK2A 4HKYA 1K07A 1A7TA 3ZR9A 5ACWA 3DH8A 2QEDA 5AXRA 2CBNA 2BG8B 4YSKA 2BIBA 5EVBA 4DIKA 2ZZIA 4C1EA 2BFZA 2BR6A 2NYPA 2ZNBA 2E7YA 4D1WA 5AJLA 1X8IA 3DHBA 1XM8A 1ZNBA 2P4ZA 4TZ9A 4YSBA 5ACVA 5FQCA 1DDKA 2YNTA 1DD6A 1YCGA 2FK6A 3G1PA 4AXHA 2OHJA 5DPXA 3RPCA 4PDXA 1VMEA 2GFJA 2CFUA 3AJ3A 3BK1A 2P18A 5HIQA 2FHXA 4P62A 4FR7A 5FQBA 1JJTA 3SD9A 3KNRA 4EYLA 3I0VA 2AIOA 2VW8A 5LSCA 4NQ2A 2ZO4A 3ZNBA 2R2DA 3ZWFA 1L9YA 1BVTA 5LCAA 5FQAA 1KO2A 2BTNA 5AYAA 3IOGA 4TZBA 2FU7A 2GKLA 3WXCA 4TYFA 2CG3A 3TP9A 1XTOA 3AF5A 1Y44A 4D1TA 4GYUA 4XWWA 4ZNBA 3IEMA 1JJEA 4EYBA 5HH5A 1WUPA 2BFZB 2ZWRA 5ACQA 4C1CA 4Z6XA 5LMCA 4NURA 4NQ5A 4HL2A 5AEBA 1VGNA 3I11A 2YNTB 1BMCA 3ZQ4A 4TYTA 1BC2A 4RAWA 4RAMA 3IE1A 4EFZA 1X8GA 4D02A 4XWTA 5B3RA 2DOOA 2P97A 2FM6A 5ACXA
chains in the Genus database with same CATH topology
2BG7A 4ZO2A 2FHXB 4LE6A 4YSLA 4Z60A 2GCUA 5EHTA 3SBLA 2WYMC 2YNUA 2P1EA 2UYXA 4EY2A 3F9OA 5K4KA 2Q9UA 1YCFA 5A87A 2XR1A 3VQZA 2I7VA 2NXAA 2GMNA 4JO0A 4AX0B 1JT1A 2OHHA 3VPEA 5ACUA 2Y8BA 4DILA 1SMLA 2WYLA 2BG6A 5LCHA 2YNVA 3L6NA 1M2XA 3RKKA 5LS3A 4KEPA 3SPUA 3MD7A 4XUKA 3X2ZA 3H3EA 3JXPA 2OHIA 4GYQA 5HIPA 2FU8A 2AZ4A 1VJNA 3IELA 4UWSB 3QH8A 5ACRA 4ZO3A 2M5DA 3R2UA 3IEKA 4AWZA 5EW0A 2FU9A 5EWAA 1WW1A 2Q0JA 3ADRA 4UBQA 2I7XA 2Y8AA 2NZEA 4NQ4A 2YCBA 4O98A 2I7TA 4BZ3A 4J5FA 1HLKA 5A0TA 3S0ZA 3ESHA 3P2UA 5EH9A 1ZKPA 4FEKA 3BV6A 1P9EA 1KO3A 2FU6A 5K4NA 3SFPA 3DHCA 3SW3A 3I14A 2QJSA 3AF6A 4C1FA 4TZFA 5HISA 1WRAA 3A4YA 2BFLA 3IE2A 2YNVB 4UWPB 5ACTA 4Z7RA 3BC2A 5LM6A 3I13A 4PVTA 3SRXA 2Q0IA 3RKJA 2YNWA 1A8TA 2BGAA 4KEQA 4UWRB 4C1DA 4UAMA 4GCWA 5EVKA 3IE0A 3I15A 4ZEJA 4H0DA 5EV6A 5ACPA 4AWYB 4RL2A 5K0WA 3T3NA 3PY5A 4V0HA 4D1UA 4C09A 4B87A 1DXKA 4AX1B 5LE1A 5HH6A 2H6AA 4RM5A 5A0VA 2BFKA 2WRSA 2Q42A 4CHLA 3X2YA 5HH4A 4Z5YA 3FCZA 5LLDA 5LCFA 5K4MA 4D1VA 1YCHA 4J5HA 5EVDA 4BP0A 4Z5ZA 1E5DA 3FAIA 5AHOA 1WUOA 2GFKA 3PG4A 2BG8A 5B15A 2WYMA 4F6ZA 4FSBA 5AXOA 2A7MA 1KR3A 2DKFA 1ZTCA 2XF4A 3IDZA 3Q6VA 3X2XA 4UA4A 2QINA 3IOFA 2M5CA 4U4LA 2QDSA 1X8HA 3X30A 5KILA 4UWOB 4RBSA 3LVZA 4WD6A 1QH5A 3KNSA 1MQOA 4PVOA 3PY6A 2Y87A 5ACSA 4NQ6A 4EXSA 2BG2A 5EV8A 4F6HA 4HL1A 2NZFA 5A5ZA 4Z67A 3T3OA 2HB9A 2YZ3A 4C1GA 2BC2A 4RL0A 5KIKA 2QDTA 4EYFA 1QH3A 3T9MA 4C1HA 5HIOA 5IQKA 3DHAA 5AHRA 5B1UA 2BMIA 4TZEA 3KL7A 4AD9A 4EXYA 2WHGA 3BK2A 4HKYA 1K07A 1A7TA 3ZR9A 5ACWA 3DH8A 2QEDA 5AXRA 2CBNA 2BG8B 4YSKA 2BIBA 4DIKA 5EVBA 2ZZIA 4C1EA 2BFZA 2BR6A 2NYPA 2ZNBA 2E7YA 4D1WA 1X8IA 3DHBA 1XM8A 1ZNBA 2P4ZA 4TZ9A 4YSBA 5ACVA 5FQCA 1DDKA 2YNTA 1DD6A 1YCGA 2FK6A 3G1PA 2OHJA 5DPXA 3RPCA 1VMEA 2GFJA 3AJ3A 3BK1A 2P18A 5HIQA 2FHXA 4P62A 4FR7A 5FQBA 1JJTA 3SD9A 3KNRA 4EYLA 3I0VA 2AIOA 2VW8A 5LSCA 4NQ2A 2ZO4A 3ZNBA 2R2DA 3ZWFA 1L9YA 1BVTA 5LCAA 5FQAA 1KO2A 2BTNA 5AYAA 3IOGA 4TZBA 2GKLA 2FU7A 3TP9A 4TYFA 3WXCA 1XTOA 3AF5A 1Y44A 4D1TA 4GYUA 4XWWA 4ZNBA 3IEMA 1JJEA 4EYBA 5HH5A 1WUPA 2BFZB 2ZWRA 5ACQA 4C1CA 4Z6XA 5LMCA 4NQ5A 4HL2A 5AEBA 1VGNA 3I11A 2YNTB 1BMCA 3ZQ4A 4TYTA 1BC2A 4RAWA 4RAMA 3IE1A 4EFZA 1X8GA 4D02A 4XWTA 5B3RA 2DOOA 2P97A 2FM6A 5ACXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BG7 A;  4ZO2 A;  2FHX B;  4LE6 A;  4YSL A;  4Z60 A;  2GCU A;  5EHT A;  3SBL A;  2WYM C;  2YNU A;  2P1E A;  2UYX A;  4EY2 A;  3F9O A;  5K4K A;  2Q9U A;  1YCF A;  5A87 A;  2XR1 A;  3VQZ A;  2I7V A;  2NXA A;  2GMN A;  4JO0 A;  4AX0 B;  1JT1 A;  2OHH A;  3VPE A;  5ACU A;  2Y8B A;  4DIL A;  1SML A;  2WYL A;  2BG6 A;  5LCH A;  2YNV A;  3L6N A;  1M2X A;  3RKK A;  5LS3 A;  4KEP A;  3SPU A;  3MD7 A;  4XUK A;  3X2Z A;  3H3E A;  3JXP A;  2OHI A;  4GYQ A;  5HIP A;  2FU8 A;  2AZ4 A;  1VJN A;  3IEL A;  4UWS B;  3QH8 A;  5ACR A;  4ZO3 A;  2M5D A;  3R2U A;  3IEK A;  4AWZ A;  5EW0 A;  2FU9 A;  5EWA A;  1WW1 A;  2Q0J A;  3ADR A;  4UBQ A;  2I7X A;  2Y8A A;  2NZE A;  4NQ4 A;  2YCB A;  4O98 A;  2I7T A;  4BZ3 A;  4J5F A;  1HLK A;  5A0T A;  3S0Z A;  3ESH A;  3P2U A;  5EH9 A;  1ZKP A;  4FEK A;  3BV6 A;  1P9E A;  1KO3 A;  2FU6 A;  5K4N A;  3SFP A;  3DHC A;  3SW3 A;  3I14 A;  2QJS A;  3AF6 A;  4C1F A;  4TZF A;  5HIS A;  1WRA A;  3A4Y A;  2BFL A;  3IE2 A;  2YNV B;  4UWP B;  5ACT A;  4Z7R A;  3BC2 A;  5LM6 A;  3I13 A;  4PVT A;  3SRX A;  2Q0I A;  3RKJ A;  2YNW A;  1A8T A;  2BGA A;  4KEQ A;  4UWR B;  4C1D A;  4UAM A;  4GCW A;  5EVK A;  3IE0 A;  3I15 A;  4ZEJ A;  4H0D A;  5EV6 A;  5ACP A;  4AWY B;  4RL2 A;  5K0W A;  3T3N A;  3PY5 A;  4V0H A;  4D1U A;  4C09 A;  4B87 A;  1DXK A;  4AX1 B;  5LE1 A;  5HH6 A;  2H6A A;  4RM5 A;  5A0V A;  2BFK A;  2WRS A;  2Q42 A;  4CHL A;  3X2Y A;  5HH4 A;  4Z5Y A;  3FCZ A;  5LLD A;  5LCF A;  5K4M A;  4D1V A;  1YCH A;  4J5H A;  5EVD A;  4BP0 A;  4Z5Z A;  1E5D A;  3FAI A;  5AHO A;  1WUO A;  2GFK A;  3PG4 A;  2BG8 A;  5B15 A;  2WYM A;  4F6Z A;  4FSB A;  5AXO A;  2A7M A;  1KR3 A;  2DKF A;  1ZTC A;  2XF4 A;  3IDZ A;  3Q6V A;  3X2X A;  4UA4 A;  2QIN A;  3IOF A;  2M5C A;  4U4L A;  2QDS A;  1X8H A;  3X30 A;  5KIL A;  4UWO B;  4RBS A;  3LVZ A;  4WD6 A;  1QH5 A;  3KNS A;  1MQO A;  4PVO A;  3PY6 A;  2Y87 A;  5ACS A;  4NQ6 A;  4EXS A;  2BG2 A;  5EV8 A;  4F6H A;  4HL1 A;  2NZF A;  5A5Z A;  4Z67 A;  3T3O A;  2HB9 A;  2YZ3 A;  4C1G A;  2BC2 A;  4RL0 A;  5KIK A;  2QDT A;  4EYF A;  1QH3 A;  3T9M A;  4C1H A;  5HIO A;  5IQK A;  3DHA A;  5AHR A;  5B1U A;  2BMI A;  4TZE A;  3KL7 A;  4AD9 A;  4EXY A;  2WHG A;  3BK2 A;  4HKY A;  1K07 A;  1A7T A;  3ZR9 A;  5ACW A;  3DH8 A;  2QED A;  5AXR A;  2CBN A;  2BG8 B;  4YSK A;  2BIB A;  4DIK A;  5EVB A;  2ZZI A;  4C1E A;  2BFZ A;  2BR6 A;  2NYP A;  2ZNB A;  2E7Y A;  4D1W A;  1X8I A;  3DHB A;  1XM8 A;  1ZNB A;  2P4Z A;  4TZ9 A;  4YSB A;  5ACV A;  5FQC A;  1DDK A;  2YNT A;  1DD6 A;  1YCG A;  2FK6 A;  3G1P A;  2OHJ A;  5DPX A;  3RPC A;  1VME A;  2GFJ A;  3AJ3 A;  3BK1 A;  2P18 A;  5HIQ A;  2FHX A;  4P62 A;  4FR7 A;  5FQB A;  1JJT A;  3SD9 A;  3KNR A;  4EYL A;  3I0V A;  2AIO A;  2VW8 A;  5LSC A;  4NQ2 A;  2ZO4 A;  3ZNB A;  2R2D A;  3ZWF A;  1L9Y A;  1BVT A;  5LCA A;  5FQA A;  1KO2 A;  2BTN A;  5AYA A;  3IOG A;  4TZB A;  2GKL A;  2FU7 A;  3TP9 A;  4TYF A;  3WXC A;  1XTO A;  3AF5 A;  1Y44 A;  4D1T A;  4GYU A;  4XWW A;  4ZNB A;  3IEM A;  1JJE A;  4EYB A;  5HH5 A;  1WUP A;  2BFZ B;  2ZWR A;  5ACQ A;  4C1C A;  4Z6X A;  5LMC A;  4NQ5 A;  4HL2 A;  5AEB A;  1VGN A;  3I11 A;  2YNT B;  1BMC A;  3ZQ4 A;  4TYT A;  1BC2 A;  4RAW A;  4RAM A;  3IE1 A;  4EFZ A;  1X8G A;  4D02 A;  4XWT A;  5B3R A;  2DOO A;  2P97 A;  2FM6 A;  5ACX A; 
#chains in the Genus database with same CATH topology
 2BG7 A;  4ZO2 A;  2FHX B;  4LE6 A;  4YSL A;  4Z60 A;  2GCU A;  5EHT A;  3SBL A;  2WYM C;  2YNU A;  2P1E A;  2UYX A;  4EY2 A;  3F9O A;  5K4K A;  2Q9U A;  1YCF A;  5A87 A;  2XR1 A;  3VQZ A;  2I7V A;  2NXA A;  2GMN A;  4JO0 A;  4AX0 B;  1JT1 A;  2OHH A;  3VPE A;  5ACU A;  2Y8B A;  4DIL A;  1SML A;  2WYL A;  2BG6 A;  5LCH A;  2YNV A;  3L6N A;  1M2X A;  3RKK A;  5LS3 A;  4KEP A;  3SPU A;  3MD7 A;  4XUK A;  3X2Z A;  3H3E A;  3JXP A;  2OHI A;  4GYQ A;  5HIP A;  2FU8 A;  2AZ4 A;  1VJN A;  3IEL A;  4UWS B;  3QH8 A;  5ACR A;  4ZO3 A;  2M5D A;  3R2U A;  3IEK A;  4AWZ A;  5EW0 A;  2FU9 A;  5EWA A;  1WW1 A;  2Q0J A;  3ADR A;  4UBQ A;  2I7X A;  2Y8A A;  2NZE A;  4NQ4 A;  2YCB A;  4O98 A;  2I7T A;  4BZ3 A;  4J5F A;  1HLK A;  5A0T A;  3S0Z A;  3ESH A;  3P2U A;  5EH9 A;  1ZKP A;  4FEK A;  3BV6 A;  1P9E A;  1KO3 A;  2FU6 A;  5K4N A;  3SFP A;  3DHC A;  3SW3 A;  3I14 A;  2QJS A;  3AF6 A;  4C1F A;  5AIJ A;  4TZF A;  5HIS A;  2CFZ A;  1WRA A;  3A4Y A;  2BFL A;  3IE2 A;  2YNV B;  4UWP B;  5ACT A;  4Z7R A;  3BC2 A;  5LM6 A;  3I13 A;  4PVT A;  3SRX A;  2Q0I A;  3RKJ A;  2YNW A;  1A8T A;  2BGA A;  4KEQ A;  4UWR B;  4C1D A;  4UAM A;  4GCW A;  5EVK A;  3IE0 A;  3I15 A;  4ZEJ A;  4H0D A;  5EV6 A;  5ACP A;  4AWY B;  4RL2 A;  5K0W A;  3T3N A;  3PY5 A;  4V0H A;  5A23 A;  4D1U A;  4C09 A;  4B87 A;  1DXK A;  4AX1 B;  5LE1 A;  5HH6 A;  2H6A A;  4RM5 A;  5A0V A;  2BFK A;  2WRS A;  4AV7 A;  2Q42 A;  4CHL A;  3X2Y A;  5HH4 A;  4Z5Y A;  3FCZ A;  5LLD A;  5LCF A;  5K4M A;  4D1V A;  1YCH A;  4J5H A;  5EVD A;  4BP0 A;  4Z5Z A;  1E5D A;  3FAI A;  5AHO A;  1WUO A;  2GFK A;  3PG4 A;  2BG8 A;  5B15 A;  2WYM A;  4F6Z A;  4FSB A;  5AXO A;  2A7M A;  1KR3 A;  2DKF A;  1ZTC A;  2XF4 A;  3IDZ A;  3Q6V A;  3X2X A;  2YHE A;  4UA4 A;  2QIN A;  3IOF A;  2CG2 A;  2M5C A;  4U4L A;  2QDS A;  1X8H A;  3X30 A;  5KIL A;  4UWO B;  4RBS A;  3LVZ A;  4WD6 A;  1QH5 A;  3KNS A;  1MQO A;  4PVO A;  3PY6 A;  2Y87 A;  5ACS A;  4NQ6 A;  4EXS A;  2BG2 A;  5EV8 A;  4F6H A;  4HL1 A;  2NZF A;  5A5Z A;  4Z67 A;  3T3O A;  2HB9 A;  2YZ3 A;  4C1G A;  2BC2 A;  4RL0 A;  5KIK A;  2QDT A;  4EYF A;  1QH3 A;  3T9M A;  4C1H A;  5HIO A;  5IQK A;  3DHA A;  5AHR A;  5B1U A;  2BMI A;  4TZE A;  3KL7 A;  4AD9 A;  4EXY A;  2WHG A;  3BK2 A;  4HKY A;  1K07 A;  1A7T A;  3ZR9 A;  5ACW A;  3DH8 A;  2QED A;  5AXR A;  2CBN A;  2BG8 B;  4YSK A;  2BIB A;  5EVB A;  4DIK A;  2ZZI A;  4C1E A;  2BFZ A;  2BR6 A;  2NYP A;  2ZNB A;  2E7Y A;  4D1W A;  5AJL A;  1X8I A;  3DHB A;  1XM8 A;  1ZNB A;  2P4Z A;  4TZ9 A;  4YSB A;  5ACV A;  5FQC A;  1DDK A;  2YNT A;  1DD6 A;  1YCG A;  2FK6 A;  3G1P A;  4AXH A;  2OHJ A;  5DPX A;  3RPC A;  4PDX A;  1VME A;  2GFJ A;  2CFU A;  3AJ3 A;  3BK1 A;  2P18 A;  5HIQ A;  2FHX A;  4P62 A;  4FR7 A;  5FQB A;  1JJT A;  3SD9 A;  3KNR A;  4EYL A;  3I0V A;  2AIO A;  2VW8 A;  5LSC A;  4NQ2 A;  2ZO4 A;  3ZNB A;  2R2D A;  3ZWF A;  1L9Y A;  1BVT A;  5LCA A;  5FQA A;  1KO2 A;  2BTN A;  5AYA A;  3IOG A;  4TZB A;  2FU7 A;  2GKL A;  3WXC A;  4TYF A;  2CG3 A;  3TP9 A;  1XTO A;  3AF5 A;  1Y44 A;  4D1T A;  4GYU A;  4XWW A;  4ZNB A;  3IEM A;  1JJE A;  4EYB A;  5HH5 A;  1WUP A;  2BFZ B;  2ZWR A;  5ACQ A;  4C1C A;  4Z6X A;  5LMC A;  4NUR A;  4NQ5 A;  4HL2 A;  5AEB A;  1VGN A;  3I11 A;  2YNT B;  1BMC A;  3ZQ4 A;  4TYT A;  1BC2 A;  4RAW A;  4RAM A;  3IE1 A;  4EFZ A;  1X8G A;  4D02 A;  4XWT A;  5B3R A;  2DOO A;  2P97 A;  2FM6 A;  5ACX A; 
#chains in the Genus database with same CATH homology
 2BG7 A;  4ZO2 A;  2FHX B;  4LE6 A;  4YSL A;  4Z60 A;  2GCU A;  5EHT A;  3SBL A;  2WYM C;  2YNU A;  2P1E A;  2UYX A;  4EY2 A;  3F9O A;  5K4K A;  2Q9U A;  1YCF A;  5A87 A;  2XR1 A;  3VQZ A;  2I7V A;  2NXA A;  2GMN A;  4JO0 A;  4AX0 B;  1JT1 A;  2OHH A;  3VPE A;  5ACU A;  2Y8B A;  4DIL A;  1SML A;  2WYL A;  2BG6 A;  5LCH A;  2YNV A;  3L6N A;  1M2X A;  3RKK A;  5LS3 A;  4KEP A;  3SPU A;  3MD7 A;  4XUK A;  3X2Z A;  3H3E A;  3JXP A;  2OHI A;  4GYQ A;  5HIP A;  2FU8 A;  2AZ4 A;  1VJN A;  3IEL A;  4UWS B;  3QH8 A;  5ACR A;  4ZO3 A;  2M5D A;  3R2U A;  3IEK A;  4AWZ A;  5EW0 A;  2FU9 A;  5EWA A;  1WW1 A;  2Q0J A;  3ADR A;  4UBQ A;  2I7X A;  2Y8A A;  2NZE A;  4NQ4 A;  2YCB A;  4O98 A;  2I7T A;  4BZ3 A;  4J5F A;  1HLK A;  5A0T A;  3S0Z A;  3ESH A;  3P2U A;  5EH9 A;  1ZKP A;  4FEK A;  3BV6 A;  1P9E A;  1KO3 A;  2FU6 A;  5K4N A;  3SFP A;  3DHC A;  3SW3 A;  3I14 A;  2QJS A;  3AF6 A;  4C1F A;  4TZF A;  5HIS A;  1WRA A;  3A4Y A;  2BFL A;  3IE2 A;  2YNV B;  4UWP B;  5ACT A;  4Z7R A;  3BC2 A;  5LM6 A;  3I13 A;  4PVT A;  3SRX A;  2Q0I A;  3RKJ A;  2YNW A;  1A8T A;  2BGA A;  4KEQ A;  4UWR B;  4C1D A;  4UAM A;  4GCW A;  5EVK A;  3IE0 A;  3I15 A;  4ZEJ A;  4H0D A;  5EV6 A;  5ACP A;  4AWY B;  4RL2 A;  5K0W A;  3T3N A;  3PY5 A;  4V0H A;  4D1U A;  4C09 A;  4B87 A;  1DXK A;  4AX1 B;  5LE1 A;  5HH6 A;  2H6A A;  4RM5 A;  5A0V A;  2BFK A;  2WRS A;  2Q42 A;  4CHL A;  3X2Y A;  5HH4 A;  4Z5Y A;  3FCZ A;  5LLD A;  5LCF A;  5K4M A;  4D1V A;  1YCH A;  4J5H A;  5EVD A;  4BP0 A;  4Z5Z A;  1E5D A;  3FAI A;  5AHO A;  1WUO A;  2GFK A;  3PG4 A;  2BG8 A;  5B15 A;  2WYM A;  4F6Z A;  4FSB A;  5AXO A;  2A7M A;  1KR3 A;  2DKF A;  1ZTC A;  2XF4 A;  3IDZ A;  3Q6V A;  3X2X A;  4UA4 A;  2QIN A;  3IOF A;  2M5C A;  4U4L A;  2QDS A;  1X8H A;  3X30 A;  5KIL A;  4UWO B;  4RBS A;  3LVZ A;  4WD6 A;  1QH5 A;  3KNS A;  1MQO A;  4PVO A;  3PY6 A;  2Y87 A;  5ACS A;  4NQ6 A;  4EXS A;  2BG2 A;  5EV8 A;  4F6H A;  4HL1 A;  2NZF A;  5A5Z A;  4Z67 A;  3T3O A;  2HB9 A;  2YZ3 A;  4C1G A;  2BC2 A;  4RL0 A;  5KIK A;  2QDT A;  4EYF A;  1QH3 A;  3T9M A;  4C1H A;  5HIO A;  5IQK A;  3DHA A;  5AHR A;  5B1U A;  2BMI A;  4TZE A;  3KL7 A;  4AD9 A;  4EXY A;  2WHG A;  3BK2 A;  4HKY A;  1K07 A;  1A7T A;  3ZR9 A;  5ACW A;  3DH8 A;  2QED A;  5AXR A;  2CBN A;  2BG8 B;  4YSK A;  2BIB A;  4DIK A;  5EVB A;  2ZZI A;  4C1E A;  2BFZ A;  2BR6 A;  2NYP A;  2ZNB A;  2E7Y A;  4D1W A;  1X8I A;  3DHB A;  1XM8 A;  1ZNB A;  2P4Z A;  4TZ9 A;  4YSB A;  5ACV A;  5FQC A;  1DDK A;  2YNT A;  1DD6 A;  1YCG A;  2FK6 A;  3G1P A;  2OHJ A;  5DPX A;  3RPC A;  1VME A;  2GFJ A;  3AJ3 A;  3BK1 A;  2P18 A;  5HIQ A;  2FHX A;  4P62 A;  4FR7 A;  5FQB A;  1JJT A;  3SD9 A;  3KNR A;  4EYL A;  3I0V A;  2AIO A;  2VW8 A;  5LSC A;  4NQ2 A;  2ZO4 A;  3ZNB A;  2R2D A;  3ZWF A;  1L9Y A;  1BVT A;  5LCA A;  5FQA A;  1KO2 A;  2BTN A;  5AYA A;  3IOG A;  4TZB A;  2GKL A;  2FU7 A;  3TP9 A;  4TYF A;  3WXC A;  1XTO A;  3AF5 A;  1Y44 A;  4D1T A;  4GYU A;  4XWW A;  4ZNB A;  3IEM A;  1JJE A;  4EYB A;  5HH5 A;  1WUP A;  2BFZ B;  2ZWR A;  5ACQ A;  4C1C A;  4Z6X A;  5LMC A;  4NQ5 A;  4HL2 A;  5AEB A;  1VGN A;  3I11 A;  2YNT B;  1BMC A;  3ZQ4 A;  4TYT A;  1BC2 A;  4RAW A;  4RAM A;  3IE1 A;  4EFZ A;  1X8G A;  4D02 A;  4XWT A;  5B3R A;  2DOO A;  2P97 A;  2FM6 A;  5ACX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...