4GYUA

Crystal structure of new delhi metallo-beta-lactamase-1 a121f mutant from klebsiella pneumoniae
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
241
structure length
241
Chain Sequence
NAIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHFHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of New Delhi Metallo-beta-Lactamase-1 A121F mutant from Klebsiella pneumoniae
rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
molecule keywords Beta-lactamase NDM-1
total genus 73
structure length 241
sequence length 241
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4gyuA00
4C1GA 2FU8A 4Z67A 2FU7A 4C1HA 2P97A 4UAMA 2YNVB 1HLKA 4C1FA 2ZZIA 4AWZA 2BFLA 2GKLA 2Y8BA 4CHLA 4Z5ZA 2I7TA 2P18A 1WUOA 3T9MA 1BMCA 4BP0A 2YNVA 2M5DA 3DHAA 3A4YA 3ZQ4A 3BK1A 5LS3A 5HIQA 4F6ZA 5ACXA 2BIBA 1X8HA 2BGAA 2XF4A 2BG8B 1ZTCA 3I14A 5LSCA 3ZNBA 3ADRA 2OHIA 1KR3A 4Z60A 5K4NA 4PVTA 2NZFA 5ACSA 3AJ3A 2QEDA 3LVZA 1VGNA 3IOFA 4Z5YA 5ACWA 3KNRA 1BVTA 2BC2A 2P1EA 4TZBA 4EFZA 2BR6A 5ACRA 2QJSA 2QDTA 2YZ3A 4UWSB 2FHXB 4D1VA 1VJNA 3F9OA 4KEQA 2YNTB 4P62A 4HKYA 4WD6A 2M5CA 2BFZA 2QDSA 4TZEA 4D1TA 1VMEA 1X8GA 5EVKA 1SMLA 3S0ZA 2FHXA 5K4MA 4ZO2A 4Z6XA 5FQCA 5EVBA 1DDKA 3ZR9A 5ACQA 2ZO4A 4DIKA 3IE1A 4TZ9A 2BTNA 3T3NA 4EYFA 4C1EA 5AHRA 2XR1A 1ZNBA 2WYMA 5EVDA 2FM6A 4EXYA 5ACVA 3BC2A 4UBQA 5EV8A 3TP9A 4RAMA 1KO3A 3SD9A 3X2YA 3VPEA 4F6HA 5AHOA 1KO2A 1XTOA 4YSKA 5B3RA 1YCGA 5LE1A 1WW1A 5AYAA 1QH3A 1Y44A 4J5HA 4H0DA 1XM8A 3DHCA 2BG8A 2VW8A 3SBLA 2BMIA 2FU6A 2DKFA 1X8IA 4PVOA 3X2ZA 2I7XA 2I7VA 2Q9UA 3SFPA 2AIOA 5IQKA 3I13A 5EH9A 1P9EA 2YNWA 2AZ4A 2FU9A 5LMCA 3FCZA 5B15A 3FAIA 3IELA 2GMNA 2R2DA 3H3EA 2GFJA 1A8TA 4UWRB 5EV6A 3X2XA 1DD6A 4O98A 4EYBA 2BG2A 5EHTA 1DXKA 1WUPA 4J5FA 3IEKA 4RL0A 3ZWFA 3QH8A 5LCFA 2BG6A 4TYFA 2WRSA 4AWYB 1QH5A 1WRAA 2H6AA 4UWOB 2ZNBA 3KNSA 4C1CA 5DPXA 4D1WA 4NQ6A 1JT1A 2WHGA 4UWPB 3PG4A 3SPUA 5LLDA 2FK6A 5HIOA 3PY6A 5A0TA 5K0WA 3SRXA 2OHHA 4TZFA 2WYLA 3RKJA 3WXCA 2HB9A 2Y8AA 4EYLA 2NXAA 3L6NA 3IEMA 3G1PA 5FQBA 2GFKA 2UYXA 1L9YA 1YCFA 4ZO3A 4XWTA 2CBNA 3RPCA 2ZWRA 4V0HA 3RKKA 5AXRA 3IDZA 3I0VA 3ESHA 4ZEJA 1JJTA 5A87A 3R2UA 1K07A 4GYUA 3AF6A 3I11A 4GYQA 4DILA 4D1UA 3IE2A 4HL1A 5KIKA 3VQZA 2YNUA 5EW0A 4HL2A 4NQ4A 4YSLA 3T3OA 4TYTA 2NYPA 2P4ZA 4ZNBA 4AX1B 3P2UA 5HIPA 5A5ZA 2WYMC 2A7MA 3SW3A 1JJEA 5LCAA 2GCUA 4FSBA 3JXPA 5FQAA 2YCBA 5LCHA 4Z7RA 4D02A 2DOOA 2BFKA 3KL7A 3IOGA 1YCHA 4C1DA 1ZKPA 2E7YA 4EXSA 1MQOA 5EWAA 5AEBA 5K4KA 4GCWA 4B87A 5HH6A 4AX0B 4AD9A 4YSBA 2NZEA 2Q0JA 4C09A 5B1UA 5LM6A 5ACPA 2Q42A 2Y87A 3BK2A 4FR7A 3DHBA 5HH5A 4NQ2A 3Q6VA 2QINA 4UA4A 2YNTA 5KILA 2BG7A 2Q0IA 3PY5A 5ACTA 1BC2A 2BFZB 4EY2A 3MD7A 4RM5A 2OHJA 1A7TA 3DH8A 4RBSA 5AXOA 4FEKA 5ACUA 4JO0A 3BV6A 3IE0A 3I15A 5HISA 4RAWA 4BZ3A 4XWWA 4XUKA 1M2XA 1E5DA 3AF5A 4NQ5A 4RL2A 4U4LA 3X30A 4LE6A 5HH4A 5A0VA 4KEPA
chains in the Genus database with same CATH superfamily
4C1GA 2FU8A 4Z67A 2FU7A 4C1HA 2P97A 4UAMA 2YNVB 1HLKA 4C1FA 2ZZIA 4AWZA 5A23A 2BFLA 2GKLA 2Y8BA 4CHLA 4Z5ZA 2I7TA 2P18A 1WUOA 3T9MA 1BMCA 4BP0A 2YNVA 2M5DA 3DHAA 3A4YA 3ZQ4A 3BK1A 5LS3A 5HIQA 4F6ZA 5ACXA 2BIBA 1X8HA 2BGAA 2XF4A 2BG8B 1ZTCA 3I14A 5LSCA 3ZNBA 3ADRA 2OHIA 1KR3A 4Z60A 5K4NA 4PVTA 2NZFA 5ACSA 3AJ3A 2QEDA 3LVZA 1VGNA 3IOFA 4Z5YA 5ACWA 3KNRA 1BVTA 4AXHA 2BC2A 2P1EA 4TZBA 4EFZA 2BR6A 5ACRA 2QJSA 2QDTA 2YZ3A 4UWSB 2FHXB 4D1VA 1VJNA 3F9OA 4KEQA 2YNTB 4P62A 4HKYA 4WD6A 2CFZA 2M5CA 2BFZA 2QDSA 4TZEA 4D1TA 1VMEA 1X8GA 5EVKA 1SMLA 3S0ZA 2FHXA 5K4MA 4ZO2A 4Z6XA 5FQCA 5EVBA 1DDKA 3ZR9A 5ACQA 2ZO4A 4DIKA 3IE1A 4TZ9A 2BTNA 3T3NA 4EYFA 4C1EA 5AHRA 2XR1A 1ZNBA 2WYMA 5EVDA 2FM6A 4EXYA 5ACVA 3BC2A 4PDXA 4UBQA 5EV8A 3TP9A 4RAMA 1KO3A 3SD9A 3X2YA 3VPEA 4F6HA 5AHOA 1KO2A 1XTOA 4YSKA 5B3RA 1YCGA 5LE1A 1WW1A 5AYAA 1QH3A 1Y44A 4J5HA 4H0DA 1XM8A 3DHCA 2BG8A 2VW8A 3SBLA 2BMIA 2FU6A 2DKFA 1X8IA 4PVOA 3X2ZA 2I7XA 2I7VA 2Q9UA 3SFPA 2AIOA 5IQKA 3I13A 5EH9A 1P9EA 2YNWA 2AZ4A 2FU9A 5LMCA 3FCZA 5B15A 3FAIA 3IELA 2GMNA 2R2DA 3H3EA 2GFJA 1A8TA 4UWRB 5EV6A 2YHEA 3X2XA 1DD6A 4O98A 4EYBA 2BG2A 5EHTA 1DXKA 1WUPA 4J5FA 3IEKA 4RL0A 3ZWFA 3QH8A 5LCFA 5AJLA 2BG6A 4TYFA 2WRSA 2CG2A 4NURA 4AWYB 1QH5A 1WRAA 2H6AA 4UWOB 2ZNBA 3KNSA 4C1CA 5DPXA 4D1WA 4NQ6A 1JT1A 2WHGA 4UWPB 3PG4A 3SPUA 5LLDA 2FK6A 5HIOA 3PY6A 5A0TA 5K0WA 3SRXA 2OHHA 4TZFA 2WYLA 3RKJA 3WXCA 2HB9A 2Y8AA 4EYLA 2NXAA 3L6NA 3IEMA 3G1PA 5FQBA 2GFKA 2UYXA 1L9YA 1YCFA 4ZO3A 4XWTA 2CBNA 3RPCA 2ZWRA 4V0HA 3RKKA 5AXRA 3IDZA 3I0VA 3ESHA 4ZEJA 1JJTA 5A87A 3R2UA 1K07A 4GYUA 3AF6A 3I11A 4GYQA 4DILA 4D1UA 3IE2A 4HL1A 5KIKA 3VQZA 2YNUA 5EW0A 4HL2A 4NQ4A 4YSLA 3T3OA 4TYTA 2NYPA 2P4ZA 4ZNBA 4AX1B 3P2UA 5AIJA 5HIPA 5A5ZA 2WYMC 2A7MA 3SW3A 1JJEA 5LCAA 2GCUA 4FSBA 3JXPA 5FQAA 2YCBA 5LCHA 4Z7RA 4D02A 2DOOA 2BFKA 3KL7A 3IOGA 1YCHA 4C1DA 1ZKPA 2E7YA 4AV7A 4EXSA 1MQOA 5EWAA 5AEBA 5K4KA 4GCWA 4B87A 5HH6A 4AX0B 4AD9A 4YSBA 2NZEA 2Q0JA 4C09A 5B1UA 5LM6A 5ACPA 2Q42A 2Y87A 3BK2A 4FR7A 3DHBA 5HH5A 4NQ2A 3Q6VA 2QINA 4UA4A 2YNTA 5KILA 2BG7A 2Q0IA 3PY5A 5ACTA 1BC2A 2BFZB 4EY2A 3MD7A 4RM5A 2OHJA 1A7TA 2CG3A 3DH8A 4RBSA 5AXOA 4FEKA 2CFUA 5ACUA 4JO0A 3BV6A 3IE0A 3I15A 5HISA 4RAWA 4BZ3A 4XWWA 4XUKA 1M2XA 1E5DA 3AF5A 4NQ5A 4RL2A 4U4LA 3X30A 4LE6A 5HH4A 5A0VA 4KEPA
chains in the Genus database with same CATH topology
4C1GA 2FU8A 4Z67A 2FU7A 4C1HA 2P97A 4UAMA 2YNVB 1HLKA 4C1FA 2ZZIA 4AWZA 2BFLA 2GKLA 2Y8BA 4CHLA 4Z5ZA 2I7TA 2P18A 1WUOA 3T9MA 1BMCA 4BP0A 2YNVA 2M5DA 3DHAA 3A4YA 3ZQ4A 3BK1A 5LS3A 5HIQA 4F6ZA 5ACXA 2BIBA 1X8HA 2BGAA 2XF4A 2BG8B 1ZTCA 3I14A 5LSCA 3ZNBA 3ADRA 2OHIA 1KR3A 4Z60A 5K4NA 4PVTA 2NZFA 5ACSA 3AJ3A 2QEDA 3LVZA 1VGNA 3IOFA 4Z5YA 5ACWA 3KNRA 1BVTA 2BC2A 2P1EA 4TZBA 4EFZA 2BR6A 5ACRA 2QJSA 2QDTA 2YZ3A 4UWSB 2FHXB 4D1VA 1VJNA 3F9OA 4KEQA 2YNTB 4P62A 4HKYA 4WD6A 2M5CA 2BFZA 2QDSA 4TZEA 4D1TA 1VMEA 1X8GA 5EVKA 1SMLA 3S0ZA 2FHXA 5K4MA 4ZO2A 4Z6XA 5FQCA 5EVBA 1DDKA 3ZR9A 5ACQA 2ZO4A 4DIKA 3IE1A 4TZ9A 2BTNA 3T3NA 4EYFA 4C1EA 5AHRA 2XR1A 1ZNBA 2WYMA 5EVDA 2FM6A 4EXYA 5ACVA 3BC2A 4UBQA 5EV8A 3TP9A 4RAMA 1KO3A 3SD9A 3X2YA 3VPEA 4F6HA 5AHOA 1KO2A 1XTOA 4YSKA 5B3RA 1YCGA 5LE1A 1WW1A 5AYAA 1QH3A 1Y44A 4J5HA 4H0DA 1XM8A 3DHCA 2BG8A 2VW8A 3SBLA 2BMIA 2FU6A 2DKFA 1X8IA 4PVOA 3X2ZA 2I7XA 2I7VA 2Q9UA 3SFPA 2AIOA 5IQKA 3I13A 5EH9A 1P9EA 2YNWA 2AZ4A 2FU9A 5LMCA 3FCZA 5B15A 3FAIA 3IELA 2GMNA 2R2DA 3H3EA 2GFJA 1A8TA 4UWRB 5EV6A 3X2XA 1DD6A 4O98A 4EYBA 2BG2A 5EHTA 1DXKA 1WUPA 4J5FA 3IEKA 4RL0A 3ZWFA 3QH8A 5LCFA 2BG6A 4TYFA 2WRSA 4AWYB 1QH5A 1WRAA 2H6AA 4UWOB 2ZNBA 3KNSA 4C1CA 5DPXA 4D1WA 4NQ6A 1JT1A 2WHGA 4UWPB 3PG4A 3SPUA 5LLDA 2FK6A 5HIOA 3PY6A 5A0TA 5K0WA 3SRXA 2OHHA 4TZFA 2WYLA 3RKJA 3WXCA 2HB9A 2Y8AA 4EYLA 2NXAA 3L6NA 3IEMA 3G1PA 5FQBA 2GFKA 2UYXA 1L9YA 1YCFA 4ZO3A 4XWTA 2CBNA 3RPCA 2ZWRA 4V0HA 3RKKA 5AXRA 3IDZA 3I0VA 3ESHA 4ZEJA 1JJTA 5A87A 3R2UA 1K07A 4GYUA 3AF6A 3I11A 4GYQA 4DILA 4D1UA 3IE2A 4HL1A 5KIKA 3VQZA 2YNUA 5EW0A 4HL2A 4NQ4A 4YSLA 3T3OA 4TYTA 2NYPA 2P4ZA 4ZNBA 4AX1B 3P2UA 5HIPA 5A5ZA 2WYMC 2A7MA 3SW3A 1JJEA 5LCAA 2GCUA 4FSBA 3JXPA 5FQAA 2YCBA 5LCHA 4Z7RA 4D02A 2DOOA 2BFKA 3KL7A 3IOGA 1YCHA 4C1DA 1ZKPA 2E7YA 4EXSA 1MQOA 5EWAA 5AEBA 5K4KA 4GCWA 4B87A 5HH6A 4AX0B 4AD9A 4YSBA 2NZEA 2Q0JA 4C09A 5B1UA 5LM6A 5ACPA 2Q42A 2Y87A 3BK2A 4FR7A 3DHBA 5HH5A 4NQ2A 3Q6VA 2QINA 4UA4A 2YNTA 5KILA 2BG7A 2Q0IA 3PY5A 5ACTA 1BC2A 2BFZB 4EY2A 3MD7A 4RM5A 2OHJA 1A7TA 3DH8A 4RBSA 5AXOA 4FEKA 5ACUA 4JO0A 3BV6A 3IE0A 3I15A 5HISA 4RAWA 4BZ3A 4XWWA 4XUKA 1M2XA 1E5DA 3AF5A 4NQ5A 4RL2A 4U4LA 3X30A 4LE6A 5HH4A 5A0VA 4KEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C1G A;  2FU8 A;  4Z67 A;  2FU7 A;  4C1H A;  2P97 A;  4UAM A;  2YNV B;  1HLK A;  4C1F A;  2ZZI A;  4AWZ A;  2BFL A;  2GKL A;  2Y8B A;  4CHL A;  4Z5Z A;  2I7T A;  2P18 A;  1WUO A;  3T9M A;  1BMC A;  4BP0 A;  2YNV A;  2M5D A;  3DHA A;  3A4Y A;  3ZQ4 A;  3BK1 A;  5LS3 A;  5HIQ A;  4F6Z A;  5ACX A;  2BIB A;  1X8H A;  2BGA A;  2XF4 A;  2BG8 B;  1ZTC A;  3I14 A;  5LSC A;  3ZNB A;  3ADR A;  2OHI A;  1KR3 A;  4Z60 A;  5K4N A;  4PVT A;  2NZF A;  5ACS A;  3AJ3 A;  2QED A;  3LVZ A;  1VGN A;  3IOF A;  4Z5Y A;  5ACW A;  3KNR A;  1BVT A;  2BC2 A;  2P1E A;  4TZB A;  4EFZ A;  2BR6 A;  5ACR A;  2QJS A;  2QDT A;  2YZ3 A;  4UWS B;  2FHX B;  4D1V A;  1VJN A;  3F9O A;  4KEQ A;  2YNT B;  4P62 A;  4HKY A;  4WD6 A;  2M5C A;  2BFZ A;  2QDS A;  4TZE A;  4D1T A;  1VME A;  1X8G A;  5EVK A;  1SML A;  3S0Z A;  2FHX A;  5K4M A;  4ZO2 A;  4Z6X A;  5FQC A;  5EVB A;  1DDK A;  3ZR9 A;  5ACQ A;  2ZO4 A;  4DIK A;  3IE1 A;  4TZ9 A;  2BTN A;  3T3N A;  4EYF A;  4C1E A;  5AHR A;  2XR1 A;  1ZNB A;  2WYM A;  5EVD A;  2FM6 A;  4EXY A;  5ACV A;  3BC2 A;  4UBQ A;  5EV8 A;  3TP9 A;  4RAM A;  1KO3 A;  3SD9 A;  3X2Y A;  3VPE A;  4F6H A;  5AHO A;  1KO2 A;  1XTO A;  4YSK A;  5B3R A;  1YCG A;  5LE1 A;  1WW1 A;  5AYA A;  1QH3 A;  1Y44 A;  4J5H A;  4H0D A;  1XM8 A;  3DHC A;  2BG8 A;  2VW8 A;  3SBL A;  2BMI A;  2FU6 A;  2DKF A;  1X8I A;  4PVO A;  3X2Z A;  2I7X A;  2I7V A;  2Q9U A;  3SFP A;  2AIO A;  5IQK A;  3I13 A;  5EH9 A;  1P9E A;  2YNW A;  2AZ4 A;  2FU9 A;  5LMC A;  3FCZ A;  5B15 A;  3FAI A;  3IEL A;  2GMN A;  2R2D A;  3H3E A;  2GFJ A;  1A8T A;  4UWR B;  5EV6 A;  3X2X A;  1DD6 A;  4O98 A;  4EYB A;  2BG2 A;  5EHT A;  1DXK A;  1WUP A;  4J5F A;  3IEK A;  4RL0 A;  3ZWF A;  3QH8 A;  5LCF A;  2BG6 A;  4TYF A;  2WRS A;  4AWY B;  1QH5 A;  1WRA A;  2H6A A;  4UWO B;  2ZNB A;  3KNS A;  4C1C A;  5DPX A;  4D1W A;  4NQ6 A;  1JT1 A;  2WHG A;  4UWP B;  3PG4 A;  3SPU A;  5LLD A;  2FK6 A;  5HIO A;  3PY6 A;  5A0T A;  5K0W A;  3SRX A;  2OHH A;  4TZF A;  2WYL A;  3RKJ A;  3WXC A;  2HB9 A;  2Y8A A;  4EYL A;  2NXA A;  3L6N A;  3IEM A;  3G1P A;  5FQB A;  2GFK A;  2UYX A;  1L9Y A;  1YCF A;  4ZO3 A;  4XWT A;  2CBN A;  3RPC A;  2ZWR A;  4V0H A;  3RKK A;  5AXR A;  3IDZ A;  3I0V A;  3ESH A;  4ZEJ A;  1JJT A;  5A87 A;  3R2U A;  1K07 A;  4GYU A;  3AF6 A;  3I11 A;  4GYQ A;  4DIL A;  4D1U A;  3IE2 A;  4HL1 A;  5KIK A;  3VQZ A;  2YNU A;  5EW0 A;  4HL2 A;  4NQ4 A;  4YSL A;  3T3O A;  4TYT A;  2NYP A;  2P4Z A;  4ZNB A;  4AX1 B;  3P2U A;  5HIP A;  5A5Z A;  2WYM C;  2A7M A;  3SW3 A;  1JJE A;  5LCA A;  2GCU A;  4FSB A;  3JXP A;  5FQA A;  2YCB A;  5LCH A;  4Z7R A;  4D02 A;  2DOO A;  2BFK A;  3KL7 A;  3IOG A;  1YCH A;  4C1D A;  1ZKP A;  2E7Y A;  4EXS A;  1MQO A;  5EWA A;  5AEB A;  5K4K A;  4GCW A;  4B87 A;  5HH6 A;  4AX0 B;  4AD9 A;  4YSB A;  2NZE A;  2Q0J A;  4C09 A;  5B1U A;  5LM6 A;  5ACP A;  2Q42 A;  2Y87 A;  3BK2 A;  4FR7 A;  3DHB A;  5HH5 A;  4NQ2 A;  3Q6V A;  2QIN A;  4UA4 A;  2YNT A;  5KIL A;  2BG7 A;  2Q0I A;  3PY5 A;  5ACT A;  1BC2 A;  2BFZ B;  4EY2 A;  3MD7 A;  4RM5 A;  2OHJ A;  1A7T A;  3DH8 A;  4RBS A;  5AXO A;  4FEK A;  5ACU A;  4JO0 A;  3BV6 A;  3IE0 A;  3I15 A;  5HIS A;  4RAW A;  4BZ3 A;  4XWW A;  4XUK A;  1M2X A;  1E5D A;  3AF5 A;  4NQ5 A;  4RL2 A;  4U4L A;  3X30 A;  4LE6 A;  5HH4 A;  5A0V A;  4KEP A; 
#chains in the Genus database with same CATH topology
 4C1G A;  2FU8 A;  4Z67 A;  2FU7 A;  4C1H A;  2P97 A;  4UAM A;  2YNV B;  1HLK A;  4C1F A;  2ZZI A;  4AWZ A;  5A23 A;  2BFL A;  2GKL A;  2Y8B A;  4CHL A;  4Z5Z A;  2I7T A;  2P18 A;  1WUO A;  3T9M A;  1BMC A;  4BP0 A;  2YNV A;  2M5D A;  3DHA A;  3A4Y A;  3ZQ4 A;  3BK1 A;  5LS3 A;  5HIQ A;  4F6Z A;  5ACX A;  2BIB A;  1X8H A;  2BGA A;  2XF4 A;  2BG8 B;  1ZTC A;  3I14 A;  5LSC A;  3ZNB A;  3ADR A;  2OHI A;  1KR3 A;  4Z60 A;  5K4N A;  4PVT A;  2NZF A;  5ACS A;  3AJ3 A;  2QED A;  3LVZ A;  1VGN A;  3IOF A;  4Z5Y A;  5ACW A;  3KNR A;  1BVT A;  4AXH A;  2BC2 A;  2P1E A;  4TZB A;  4EFZ A;  2BR6 A;  5ACR A;  2QJS A;  2QDT A;  2YZ3 A;  4UWS B;  2FHX B;  4D1V A;  1VJN A;  3F9O A;  4KEQ A;  2YNT B;  4P62 A;  4HKY A;  4WD6 A;  2CFZ A;  2M5C A;  2BFZ A;  2QDS A;  4TZE A;  4D1T A;  1VME A;  1X8G A;  5EVK A;  1SML A;  3S0Z A;  2FHX A;  5K4M A;  4ZO2 A;  4Z6X A;  5FQC A;  5EVB A;  1DDK A;  3ZR9 A;  5ACQ A;  2ZO4 A;  4DIK A;  3IE1 A;  4TZ9 A;  2BTN A;  3T3N A;  4EYF A;  4C1E A;  5AHR A;  2XR1 A;  1ZNB A;  2WYM A;  5EVD A;  2FM6 A;  4EXY A;  5ACV A;  3BC2 A;  4PDX A;  4UBQ A;  5EV8 A;  3TP9 A;  4RAM A;  1KO3 A;  3SD9 A;  3X2Y A;  3VPE A;  4F6H A;  5AHO A;  1KO2 A;  1XTO A;  4YSK A;  5B3R A;  1YCG A;  5LE1 A;  1WW1 A;  5AYA A;  1QH3 A;  1Y44 A;  4J5H A;  4H0D A;  1XM8 A;  3DHC A;  2BG8 A;  2VW8 A;  3SBL A;  2BMI A;  2FU6 A;  2DKF A;  1X8I A;  4PVO A;  3X2Z A;  2I7X A;  2I7V A;  2Q9U A;  3SFP A;  2AIO A;  5IQK A;  3I13 A;  5EH9 A;  1P9E A;  2YNW A;  2AZ4 A;  2FU9 A;  5LMC A;  3FCZ A;  5B15 A;  3FAI A;  3IEL A;  2GMN A;  2R2D A;  3H3E A;  2GFJ A;  1A8T A;  4UWR B;  5EV6 A;  2YHE A;  3X2X A;  1DD6 A;  4O98 A;  4EYB A;  2BG2 A;  5EHT A;  1DXK A;  1WUP A;  4J5F A;  3IEK A;  4RL0 A;  3ZWF A;  3QH8 A;  5LCF A;  5AJL A;  2BG6 A;  4TYF A;  2WRS A;  2CG2 A;  4NUR A;  4AWY B;  1QH5 A;  1WRA A;  2H6A A;  4UWO B;  2ZNB A;  3KNS A;  4C1C A;  5DPX A;  4D1W A;  4NQ6 A;  1JT1 A;  2WHG A;  4UWP B;  3PG4 A;  3SPU A;  5LLD A;  2FK6 A;  5HIO A;  3PY6 A;  5A0T A;  5K0W A;  3SRX A;  2OHH A;  4TZF A;  2WYL A;  3RKJ A;  3WXC A;  2HB9 A;  2Y8A A;  4EYL A;  2NXA A;  3L6N A;  3IEM A;  3G1P A;  5FQB A;  2GFK A;  2UYX A;  1L9Y A;  1YCF A;  4ZO3 A;  4XWT A;  2CBN A;  3RPC A;  2ZWR A;  4V0H A;  3RKK A;  5AXR A;  3IDZ A;  3I0V A;  3ESH A;  4ZEJ A;  1JJT A;  5A87 A;  3R2U A;  1K07 A;  4GYU A;  3AF6 A;  3I11 A;  4GYQ A;  4DIL A;  4D1U A;  3IE2 A;  4HL1 A;  5KIK A;  3VQZ A;  2YNU A;  5EW0 A;  4HL2 A;  4NQ4 A;  4YSL A;  3T3O A;  4TYT A;  2NYP A;  2P4Z A;  4ZNB A;  4AX1 B;  3P2U A;  5AIJ A;  5HIP A;  5A5Z A;  2WYM C;  2A7M A;  3SW3 A;  1JJE A;  5LCA A;  2GCU A;  4FSB A;  3JXP A;  5FQA A;  2YCB A;  5LCH A;  4Z7R A;  4D02 A;  2DOO A;  2BFK A;  3KL7 A;  3IOG A;  1YCH A;  4C1D A;  1ZKP A;  2E7Y A;  4AV7 A;  4EXS A;  1MQO A;  5EWA A;  5AEB A;  5K4K A;  4GCW A;  4B87 A;  5HH6 A;  4AX0 B;  4AD9 A;  4YSB A;  2NZE A;  2Q0J A;  4C09 A;  5B1U A;  5LM6 A;  5ACP A;  2Q42 A;  2Y87 A;  3BK2 A;  4FR7 A;  3DHB A;  5HH5 A;  4NQ2 A;  3Q6V A;  2QIN A;  4UA4 A;  2YNT A;  5KIL A;  2BG7 A;  2Q0I A;  3PY5 A;  5ACT A;  1BC2 A;  2BFZ B;  4EY2 A;  3MD7 A;  4RM5 A;  2OHJ A;  1A7T A;  2CG3 A;  3DH8 A;  4RBS A;  5AXO A;  4FEK A;  2CFU A;  5ACU A;  4JO0 A;  3BV6 A;  3IE0 A;  3I15 A;  5HIS A;  4RAW A;  4BZ3 A;  4XWW A;  4XUK A;  1M2X A;  1E5D A;  3AF5 A;  4NQ5 A;  4RL2 A;  4U4L A;  3X30 A;  4LE6 A;  5HH4 A;  5A0V A;  4KEP A; 
#chains in the Genus database with same CATH homology
 4C1G A;  2FU8 A;  4Z67 A;  2FU7 A;  4C1H A;  2P97 A;  4UAM A;  2YNV B;  1HLK A;  4C1F A;  2ZZI A;  4AWZ A;  2BFL A;  2GKL A;  2Y8B A;  4CHL A;  4Z5Z A;  2I7T A;  2P18 A;  1WUO A;  3T9M A;  1BMC A;  4BP0 A;  2YNV A;  2M5D A;  3DHA A;  3A4Y A;  3ZQ4 A;  3BK1 A;  5LS3 A;  5HIQ A;  4F6Z A;  5ACX A;  2BIB A;  1X8H A;  2BGA A;  2XF4 A;  2BG8 B;  1ZTC A;  3I14 A;  5LSC A;  3ZNB A;  3ADR A;  2OHI A;  1KR3 A;  4Z60 A;  5K4N A;  4PVT A;  2NZF A;  5ACS A;  3AJ3 A;  2QED A;  3LVZ A;  1VGN A;  3IOF A;  4Z5Y A;  5ACW A;  3KNR A;  1BVT A;  2BC2 A;  2P1E A;  4TZB A;  4EFZ A;  2BR6 A;  5ACR A;  2QJS A;  2QDT A;  2YZ3 A;  4UWS B;  2FHX B;  4D1V A;  1VJN A;  3F9O A;  4KEQ A;  2YNT B;  4P62 A;  4HKY A;  4WD6 A;  2M5C A;  2BFZ A;  2QDS A;  4TZE A;  4D1T A;  1VME A;  1X8G A;  5EVK A;  1SML A;  3S0Z A;  2FHX A;  5K4M A;  4ZO2 A;  4Z6X A;  5FQC A;  5EVB A;  1DDK A;  3ZR9 A;  5ACQ A;  2ZO4 A;  4DIK A;  3IE1 A;  4TZ9 A;  2BTN A;  3T3N A;  4EYF A;  4C1E A;  5AHR A;  2XR1 A;  1ZNB A;  2WYM A;  5EVD A;  2FM6 A;  4EXY A;  5ACV A;  3BC2 A;  4UBQ A;  5EV8 A;  3TP9 A;  4RAM A;  1KO3 A;  3SD9 A;  3X2Y A;  3VPE A;  4F6H A;  5AHO A;  1KO2 A;  1XTO A;  4YSK A;  5B3R A;  1YCG A;  5LE1 A;  1WW1 A;  5AYA A;  1QH3 A;  1Y44 A;  4J5H A;  4H0D A;  1XM8 A;  3DHC A;  2BG8 A;  2VW8 A;  3SBL A;  2BMI A;  2FU6 A;  2DKF A;  1X8I A;  4PVO A;  3X2Z A;  2I7X A;  2I7V A;  2Q9U A;  3SFP A;  2AIO A;  5IQK A;  3I13 A;  5EH9 A;  1P9E A;  2YNW A;  2AZ4 A;  2FU9 A;  5LMC A;  3FCZ A;  5B15 A;  3FAI A;  3IEL A;  2GMN A;  2R2D A;  3H3E A;  2GFJ A;  1A8T A;  4UWR B;  5EV6 A;  3X2X A;  1DD6 A;  4O98 A;  4EYB A;  2BG2 A;  5EHT A;  1DXK A;  1WUP A;  4J5F A;  3IEK A;  4RL0 A;  3ZWF A;  3QH8 A;  5LCF A;  2BG6 A;  4TYF A;  2WRS A;  4AWY B;  1QH5 A;  1WRA A;  2H6A A;  4UWO B;  2ZNB A;  3KNS A;  4C1C A;  5DPX A;  4D1W A;  4NQ6 A;  1JT1 A;  2WHG A;  4UWP B;  3PG4 A;  3SPU A;  5LLD A;  2FK6 A;  5HIO A;  3PY6 A;  5A0T A;  5K0W A;  3SRX A;  2OHH A;  4TZF A;  2WYL A;  3RKJ A;  3WXC A;  2HB9 A;  2Y8A A;  4EYL A;  2NXA A;  3L6N A;  3IEM A;  3G1P A;  5FQB A;  2GFK A;  2UYX A;  1L9Y A;  1YCF A;  4ZO3 A;  4XWT A;  2CBN A;  3RPC A;  2ZWR A;  4V0H A;  3RKK A;  5AXR A;  3IDZ A;  3I0V A;  3ESH A;  4ZEJ A;  1JJT A;  5A87 A;  3R2U A;  1K07 A;  4GYU A;  3AF6 A;  3I11 A;  4GYQ A;  4DIL A;  4D1U A;  3IE2 A;  4HL1 A;  5KIK A;  3VQZ A;  2YNU A;  5EW0 A;  4HL2 A;  4NQ4 A;  4YSL A;  3T3O A;  4TYT A;  2NYP A;  2P4Z A;  4ZNB A;  4AX1 B;  3P2U A;  5HIP A;  5A5Z A;  2WYM C;  2A7M A;  3SW3 A;  1JJE A;  5LCA A;  2GCU A;  4FSB A;  3JXP A;  5FQA A;  2YCB A;  5LCH A;  4Z7R A;  4D02 A;  2DOO A;  2BFK A;  3KL7 A;  3IOG A;  1YCH A;  4C1D A;  1ZKP A;  2E7Y A;  4EXS A;  1MQO A;  5EWA A;  5AEB A;  5K4K A;  4GCW A;  4B87 A;  5HH6 A;  4AX0 B;  4AD9 A;  4YSB A;  2NZE A;  2Q0J A;  4C09 A;  5B1U A;  5LM6 A;  5ACP A;  2Q42 A;  2Y87 A;  3BK2 A;  4FR7 A;  3DHB A;  5HH5 A;  4NQ2 A;  3Q6V A;  2QIN A;  4UA4 A;  2YNT A;  5KIL A;  2BG7 A;  2Q0I A;  3PY5 A;  5ACT A;  1BC2 A;  2BFZ B;  4EY2 A;  3MD7 A;  4RM5 A;  2OHJ A;  1A7T A;  3DH8 A;  4RBS A;  5AXO A;  4FEK A;  5ACU A;  4JO0 A;  3BV6 A;  3IE0 A;  3I15 A;  5HIS A;  4RAW A;  4BZ3 A;  4XWW A;  4XUK A;  1M2X A;  1E5D A;  3AF5 A;  4NQ5 A;  4RL2 A;  4U4L A;  3X30 A;  4LE6 A;  5HH4 A;  5A0V A;  4KEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...