4GYUA

Crystal structure of new delhi metallo-beta-lactamase-1 a121f mutant from klebsiella pneumoniae
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
241
structure length
241
Chain Sequence
NAIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHFHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of New Delhi Metallo-beta-Lactamase-1 A121F mutant from Klebsiella pneumoniae
rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
molecule keywords Beta-lactamase NDM-1
total genus 73
structure length 241
sequence length 241
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4gyuA00
1X8IA 1M2XA 2ZNBA 1BVTA 3DHAA 2BFKA 4TZEA 2YNTB 4PVTA 2GKLA 3BC2A 2BG7A 5HIOA 2NZEA 5HISA 2FK6A 5K4KA 1WW1A 4EXSA 5AEBA 5EVKA 4LE6A 2M5CA 3LVZA 2HB9A 5ACPA 3DH8A 5FQCA 2BG8B 4TZBA 4D1TA 4HKYA 4CHLA 2I7TA 3SFPA 4EY2A 1P9EA 2GCUA 4TYTA 1JT1A 3FAIA 5EWAA 4EYFA 4TYFA 3P2UA 2WYLA 1JJTA 5LS3A 5HIPA 5LSCA 5EVDA 4NQ4A 3T3OA 3AF6A 2P1EA 5EV6A 5K0WA 3SW3A 4JO0A 4C1EA 2AIOA 4AX0B 2BG8A 2NZFA 4D1VA 4J5FA 2QINA 2BGAA 1X8GA 4RL0A 4NQ5A 5K4NA 5KILA 1K07A 2P18A 1JJEA 5LE1A 1E5DA 4WD6A 4GYQA 3BK1A 5AHRA 5LM6A 1A7TA 4Z7RA 2GFJA 3KL7A 2FM6A 5LCAA 4TZFA 2FU6A 2XR1A 2Q0IA 2Q0JA 2BIBA 4YSKA 2BFZA 2BC2A 3I14A 2E7YA 4GYUA 4P62A 3I0VA 2I7XA 5A0VA 2YNTA 4PVOA 2BG6A 3DHBA 4YSBA 4B87A 2YNVB 2FHXA 3IOGA 3TP9A 2QDSA 5B15A 4Z5ZA 2QJSA 3I11A 1WUOA 4YSLA 5EW0A 4C1HA 4AD9A 2FU7A 2GFKA 2H6AA 4NQ2A 1DD6A 2Y8BA 4EFZA 3RPCA 3IE2A 4UWRB 1YCHA 4RBSA 5AYAA 3L6NA 2QEDA 4Z67A 1KO3A 4UBQA 4Z5YA 2A7MA 3SRXA 5KIKA 1A8TA 3WXCA 3BK2A 1X8HA 1WRAA 1XM8A 2Q42A 3IDZA 2ZO4A 1HLKA 1MQOA 2OHJA 3DHCA 5B3RA 3R2UA 1YCFA 3ZQ4A 3AF5A 5FQBA 3I13A 5AXOA 4EYBA 5EH9A 1XTOA 4C1CA 5AXRA 2Q9UA 5ACTA 4KEPA 1KR3A 2WHGA 3PY6A 1SMLA 2BTNA 2CBNA 4RAMA 4AWYB 3F9OA 4XWTA 2ZZIA 1WUPA 3KNSA 5EV8A 2YNVA 4UWPB 4NQ6A 2M5DA 2BG2A 3QH8A 2WYMC 2ZWRA 4DILA 3X2YA 2DKFA 2AZ4A 5IQKA 3ZR9A 4UWSB 2QDTA 1ZNBA 4D02A 4U4LA 4C1DA 3I15A 5ACSA 2BFZB 4AX1B 3IE1A 3BV6A 5AHOA 2BMIA 4RL2A 5ACVA 3T9MA 4AWZA 4DIKA 1L9YA 5DPXA 2P97A 2YZ3A 3IEMA 3PG4A 4D1UA 2WYMA 4UA4A 1Y44A 4BP0A 2NYPA 5HIQA 2YNUA 2I7VA 3IE0A 5FQAA 3X30A 2FU8A 3ADRA 3A4YA 1DDKA 2OHIA 3S0ZA 3RKKA 3SBLA 3KNRA 3ZWFA 2FU9A 4GCWA 2GMNA 5B1UA 4J5HA 4C09A 5HH5A 1DXKA 3JXPA 4UWOB 5K4MA 4XUKA 2XF4A 4ZO2A 3MD7A 4F6HA 5ACWA 2BFLA 3X2ZA 4BZ3A 4FSBA 3RKJA 4ZNBA 4RAWA 2UYXA 4EYLA 2DOOA 3IEKA 2WRSA 5A87A 3T3NA 5EVBA 5ACUA 4O98A 2OHHA 4Z6XA 4UAMA 3X2XA 5EHTA 3ESHA 1QH3A 4TZ9A 3VQZA 4Z60A 1QH5A 3Q6VA 4FR7A 4ZEJA 4C1FA 5ACQA 5LCHA 4H0DA 1ZKPA 2R2DA 1VJNA 3AJ3A 4EXYA 3FCZA 4D1WA 1BC2A 1VMEA 4HL1A 4RM5A 4ZO3A 5LCFA 5ACRA 3VPEA 5LMCA 3G1PA 1VGNA 1ZTCA 3PY5A 2Y87A 3IELA 4HL2A 3IOFA 4FEKA 5LLDA 3ZNBA 5A0TA 5ACXA 4F6ZA 2YCBA 2YNWA 1KO2A 1BMCA 2P4ZA 5HH6A 5A5ZA 2FHXB 3SPUA 4KEQA 3H3EA 4XWWA 4V0HA 2VW8A 2BR6A 3SD9A 1YCGA 2Y8AA 5HH4A 2NXAA 4C1GA
chains in the Genus database with same CATH superfamily
1X8IA 1M2XA 2ZNBA 1BVTA 3DHAA 2BFKA 4TZEA 2YNTB 4PVTA 2GKLA 3BC2A 2BG7A 5HIOA 2NZEA 5HISA 2FK6A 5K4KA 1WW1A 4NURA 4EXSA 5AEBA 5EVKA 4LE6A 2M5CA 3LVZA 2HB9A 5ACPA 3DH8A 5FQCA 2BG8B 4TZBA 4D1TA 4HKYA 4CHLA 2I7TA 3SFPA 4EY2A 1P9EA 2GCUA 4TYTA 1JT1A 3FAIA 2CG3A 5EWAA 4EYFA 4TYFA 3P2UA 2WYLA 1JJTA 5LS3A 5HIPA 5LSCA 5EVDA 4NQ4A 3T3OA 3AF6A 2P1EA 5EV6A 5K0WA 3SW3A 4JO0A 4C1EA 2AIOA 4AX0B 2BG8A 2NZFA 4D1VA 4J5FA 2QINA 2BGAA 1X8GA 4RL0A 4NQ5A 5K4NA 5KILA 1K07A 2P18A 1JJEA 5LE1A 1E5DA 4WD6A 4GYQA 3BK1A 5AHRA 5LM6A 1A7TA 4Z7RA 2GFJA 2CFUA 3KL7A 2FM6A 4AXHA 5LCAA 4TZFA 2FU6A 2XR1A 2Q0IA 2Q0JA 2BIBA 4YSKA 2BFZA 2BC2A 3I14A 2E7YA 4GYUA 4P62A 2YHEA 3I0VA 2I7XA 5A0VA 2YNTA 4PVOA 2BG6A 3DHBA 4YSBA 4B87A 2YNVB 2FHXA 3IOGA 3TP9A 2QDSA 5B15A 4Z5ZA 2QJSA 3I11A 1WUOA 4YSLA 5EW0A 4C1HA 4AD9A 2FU7A 2GFKA 2H6AA 4NQ2A 1DD6A 2Y8BA 4EFZA 3RPCA 3IE2A 4UWRB 4PDXA 1YCHA 4RBSA 5AYAA 3L6NA 2QEDA 4Z67A 1KO3A 4UBQA 4Z5YA 2A7MA 3SRXA 5KIKA 1A8TA 3WXCA 3BK2A 1X8HA 1WRAA 4AV7A 1XM8A 2Q42A 3IDZA 2ZO4A 1HLKA 1MQOA 2OHJA 3DHCA 5B3RA 3R2UA 1YCFA 3ZQ4A 3AF5A 5FQBA 3I13A 4EYBA 5AXOA 5EH9A 1XTOA 4C1CA 5AXRA 2Q9UA 5ACTA 4KEPA 1KR3A 2WHGA 3PY6A 1SMLA 2BTNA 2CBNA 4RAMA 4AWYB 3F9OA 4XWTA 2ZZIA 1WUPA 3KNSA 5EV8A 2YNVA 4UWPB 4NQ6A 2M5DA 2BG2A 3QH8A 2WYMC 2ZWRA 4DILA 3X2YA 2DKFA 2AZ4A 5IQKA 3ZR9A 4UWSB 2QDTA 1ZNBA 4D02A 4U4LA 4C1DA 3I15A 5ACSA 2BFZB 4AX1B 3IE1A 3BV6A 5AHOA 2BMIA 4RL2A 5ACVA 3T9MA 4AWZA 4DIKA 1L9YA 5DPXA 2P97A 2YZ3A 3IEMA 3PG4A 4D1UA 2WYMA 4UA4A 1Y44A 5AIJA 4BP0A 2NYPA 5HIQA 2YNUA 2I7VA 3IE0A 5FQAA 3X30A 2FU8A 3ADRA 3A4YA 1DDKA 2OHIA 3S0ZA 3RKKA 3SBLA 3KNRA 3ZWFA 2CFZA 2FU9A 4GCWA 2GMNA 5B1UA 4J5HA 4C09A 5HH5A 1DXKA 3JXPA 4UWOB 5K4MA 4XUKA 2XF4A 4ZO2A 3MD7A 5AJLA 4F6HA 5ACWA 2BFLA 3X2ZA 4BZ3A 4FSBA 3RKJA 4ZNBA 5A23A 4RAWA 2UYXA 4EYLA 2DOOA 3IEKA 2WRSA 5A87A 3T3NA 5EVBA 2CG2A 5ACUA 4O98A 2OHHA 4Z6XA 4UAMA 3X2XA 5EHTA 3ESHA 1QH3A 4TZ9A 3VQZA 4Z60A 1QH5A 3Q6VA 4FR7A 4ZEJA 4C1FA 5ACQA 5LCHA 4H0DA 1ZKPA 2R2DA 1VJNA 3AJ3A 4EXYA 3FCZA 4D1WA 1BC2A 1VMEA 4HL1A 4RM5A 4ZO3A 5LCFA 5ACRA 3VPEA 5LMCA 3G1PA 1VGNA 1ZTCA 3PY5A 2Y87A 3IELA 4HL2A 3IOFA 4FEKA 5LLDA 3ZNBA 5A0TA 5ACXA 4F6ZA 2YCBA 2YNWA 1KO2A 1BMCA 2P4ZA 5HH6A 5A5ZA 2FHXB 3SPUA 4KEQA 3H3EA 4XWWA 4V0HA 2VW8A 2BR6A 3SD9A 1YCGA 2Y8AA 5HH4A 2NXAA 4C1GA
chains in the Genus database with same CATH topology
1X8IA 1M2XA 2ZNBA 1BVTA 3DHAA 2BFKA 4TZEA 2YNTB 4PVTA 2GKLA 3BC2A 2BG7A 5HIOA 2NZEA 5HISA 2FK6A 5K4KA 1WW1A 4EXSA 5AEBA 5EVKA 4LE6A 2M5CA 3LVZA 2HB9A 5ACPA 3DH8A 5FQCA 2BG8B 4TZBA 4D1TA 4HKYA 4CHLA 2I7TA 3SFPA 4EY2A 1P9EA 2GCUA 4TYTA 1JT1A 3FAIA 5EWAA 4EYFA 4TYFA 3P2UA 2WYLA 1JJTA 5LS3A 5HIPA 5LSCA 5EVDA 4NQ4A 3T3OA 3AF6A 2P1EA 5EV6A 5K0WA 3SW3A 4JO0A 4C1EA 2AIOA 4AX0B 2BG8A 2NZFA 4D1VA 4J5FA 2QINA 2BGAA 1X8GA 4RL0A 4NQ5A 5K4NA 5KILA 1K07A 2P18A 1JJEA 5LE1A 1E5DA 4WD6A 4GYQA 3BK1A 5AHRA 5LM6A 1A7TA 4Z7RA 2GFJA 3KL7A 2FM6A 5LCAA 4TZFA 2FU6A 2XR1A 2Q0IA 2Q0JA 2BIBA 4YSKA 2BFZA 2BC2A 3I14A 2E7YA 4GYUA 4P62A 3I0VA 2I7XA 5A0VA 2YNTA 4PVOA 2BG6A 3DHBA 4YSBA 4B87A 2YNVB 2FHXA 3IOGA 3TP9A 2QDSA 5B15A 4Z5ZA 2QJSA 3I11A 1WUOA 4YSLA 5EW0A 4C1HA 4AD9A 2FU7A 2GFKA 2H6AA 4NQ2A 1DD6A 2Y8BA 4EFZA 3RPCA 3IE2A 4UWRB 1YCHA 4RBSA 5AYAA 3L6NA 2QEDA 4Z67A 1KO3A 4UBQA 4Z5YA 2A7MA 3SRXA 5KIKA 1A8TA 3WXCA 3BK2A 1X8HA 1WRAA 1XM8A 2Q42A 3IDZA 2ZO4A 1HLKA 1MQOA 2OHJA 3DHCA 5B3RA 3R2UA 1YCFA 3ZQ4A 3AF5A 5FQBA 3I13A 5AXOA 4EYBA 5EH9A 1XTOA 4C1CA 5AXRA 2Q9UA 5ACTA 4KEPA 1KR3A 2WHGA 3PY6A 1SMLA 2BTNA 2CBNA 4RAMA 4AWYB 3F9OA 4XWTA 2ZZIA 1WUPA 3KNSA 5EV8A 2YNVA 4UWPB 4NQ6A 2M5DA 2BG2A 3QH8A 2WYMC 2ZWRA 4DILA 3X2YA 2DKFA 2AZ4A 5IQKA 3ZR9A 4UWSB 2QDTA 1ZNBA 4D02A 4U4LA 4C1DA 3I15A 5ACSA 2BFZB 4AX1B 3IE1A 3BV6A 5AHOA 2BMIA 4RL2A 5ACVA 3T9MA 4AWZA 4DIKA 1L9YA 5DPXA 2P97A 2YZ3A 3IEMA 3PG4A 4D1UA 2WYMA 4UA4A 1Y44A 4BP0A 2NYPA 5HIQA 2YNUA 2I7VA 3IE0A 5FQAA 3X30A 2FU8A 3ADRA 3A4YA 1DDKA 2OHIA 3S0ZA 3RKKA 3SBLA 3KNRA 3ZWFA 2FU9A 4GCWA 2GMNA 5B1UA 4J5HA 4C09A 5HH5A 1DXKA 3JXPA 4UWOB 5K4MA 4XUKA 2XF4A 4ZO2A 3MD7A 4F6HA 5ACWA 2BFLA 3X2ZA 4BZ3A 4FSBA 3RKJA 4ZNBA 4RAWA 2UYXA 4EYLA 2DOOA 3IEKA 2WRSA 5A87A 3T3NA 5EVBA 5ACUA 4O98A 2OHHA 4Z6XA 4UAMA 3X2XA 5EHTA 3ESHA 1QH3A 4TZ9A 3VQZA 4Z60A 1QH5A 3Q6VA 4FR7A 4ZEJA 4C1FA 5ACQA 5LCHA 4H0DA 1ZKPA 2R2DA 1VJNA 3AJ3A 4EXYA 3FCZA 4D1WA 1BC2A 1VMEA 4HL1A 4RM5A 4ZO3A 5LCFA 5ACRA 3VPEA 5LMCA 3G1PA 1VGNA 1ZTCA 3PY5A 2Y87A 3IELA 4HL2A 3IOFA 4FEKA 5LLDA 3ZNBA 5A0TA 5ACXA 4F6ZA 2YCBA 2YNWA 1KO2A 1BMCA 2P4ZA 5HH6A 5A5ZA 2FHXB 3SPUA 4KEQA 3H3EA 4XWWA 4V0HA 2VW8A 2BR6A 3SD9A 1YCGA 2Y8AA 5HH4A 2NXAA 4C1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X8I A;  1M2X A;  2ZNB A;  1BVT A;  3DHA A;  2BFK A;  4TZE A;  2YNT B;  4PVT A;  2GKL A;  3BC2 A;  2BG7 A;  5HIO A;  2NZE A;  5HIS A;  2FK6 A;  5K4K A;  1WW1 A;  4EXS A;  5AEB A;  5EVK A;  4LE6 A;  2M5C A;  3LVZ A;  2HB9 A;  5ACP A;  3DH8 A;  5FQC A;  2BG8 B;  4TZB A;  4D1T A;  4HKY A;  4CHL A;  2I7T A;  3SFP A;  4EY2 A;  1P9E A;  2GCU A;  4TYT A;  1JT1 A;  3FAI A;  5EWA A;  4EYF A;  4TYF A;  3P2U A;  2WYL A;  1JJT A;  5LS3 A;  5HIP A;  5LSC A;  5EVD A;  4NQ4 A;  3T3O A;  3AF6 A;  2P1E A;  5EV6 A;  5K0W A;  3SW3 A;  4JO0 A;  4C1E A;  2AIO A;  4AX0 B;  2BG8 A;  2NZF A;  4D1V A;  4J5F A;  2QIN A;  2BGA A;  1X8G A;  4RL0 A;  4NQ5 A;  5K4N A;  5KIL A;  1K07 A;  2P18 A;  1JJE A;  5LE1 A;  1E5D A;  4WD6 A;  4GYQ A;  3BK1 A;  5AHR A;  5LM6 A;  1A7T A;  4Z7R A;  2GFJ A;  3KL7 A;  2FM6 A;  5LCA A;  4TZF A;  2FU6 A;  2XR1 A;  2Q0I A;  2Q0J A;  2BIB A;  4YSK A;  2BFZ A;  2BC2 A;  3I14 A;  2E7Y A;  4GYU A;  4P62 A;  3I0V A;  2I7X A;  5A0V A;  2YNT A;  4PVO A;  2BG6 A;  3DHB A;  4YSB A;  4B87 A;  2YNV B;  2FHX A;  3IOG A;  3TP9 A;  2QDS A;  5B15 A;  4Z5Z A;  2QJS A;  3I11 A;  1WUO A;  4YSL A;  5EW0 A;  4C1H A;  4AD9 A;  2FU7 A;  2GFK A;  2H6A A;  4NQ2 A;  1DD6 A;  2Y8B A;  4EFZ A;  3RPC A;  3IE2 A;  4UWR B;  1YCH A;  4RBS A;  5AYA A;  3L6N A;  2QED A;  4Z67 A;  1KO3 A;  4UBQ A;  4Z5Y A;  2A7M A;  3SRX A;  5KIK A;  1A8T A;  3WXC A;  3BK2 A;  1X8H A;  1WRA A;  1XM8 A;  2Q42 A;  3IDZ A;  2ZO4 A;  1HLK A;  1MQO A;  2OHJ A;  3DHC A;  5B3R A;  3R2U A;  1YCF A;  3ZQ4 A;  3AF5 A;  5FQB A;  3I13 A;  5AXO A;  4EYB A;  5EH9 A;  1XTO A;  4C1C A;  5AXR A;  2Q9U A;  5ACT A;  4KEP A;  1KR3 A;  2WHG A;  3PY6 A;  1SML A;  2BTN A;  2CBN A;  4RAM A;  4AWY B;  3F9O A;  4XWT A;  2ZZI A;  1WUP A;  3KNS A;  5EV8 A;  2YNV A;  4UWP B;  4NQ6 A;  2M5D A;  2BG2 A;  3QH8 A;  2WYM C;  2ZWR A;  4DIL A;  3X2Y A;  2DKF A;  2AZ4 A;  5IQK A;  3ZR9 A;  4UWS B;  2QDT A;  1ZNB A;  4D02 A;  4U4L A;  4C1D A;  3I15 A;  5ACS A;  2BFZ B;  4AX1 B;  3IE1 A;  3BV6 A;  5AHO A;  2BMI A;  4RL2 A;  5ACV A;  3T9M A;  4AWZ A;  4DIK A;  1L9Y A;  5DPX A;  2P97 A;  2YZ3 A;  3IEM A;  3PG4 A;  4D1U A;  2WYM A;  4UA4 A;  1Y44 A;  4BP0 A;  2NYP A;  5HIQ A;  2YNU A;  2I7V A;  3IE0 A;  5FQA A;  3X30 A;  2FU8 A;  3ADR A;  3A4Y A;  1DDK A;  2OHI A;  3S0Z A;  3RKK A;  3SBL A;  3KNR A;  3ZWF A;  2FU9 A;  4GCW A;  2GMN A;  5B1U A;  4J5H A;  4C09 A;  5HH5 A;  1DXK A;  3JXP A;  4UWO B;  5K4M A;  4XUK A;  2XF4 A;  4ZO2 A;  3MD7 A;  4F6H A;  5ACW A;  2BFL A;  3X2Z A;  4BZ3 A;  4FSB A;  3RKJ A;  4ZNB A;  4RAW A;  2UYX A;  4EYL A;  2DOO A;  3IEK A;  2WRS A;  5A87 A;  3T3N A;  5EVB A;  5ACU A;  4O98 A;  2OHH A;  4Z6X A;  4UAM A;  3X2X A;  5EHT A;  3ESH A;  1QH3 A;  4TZ9 A;  3VQZ A;  4Z60 A;  1QH5 A;  3Q6V A;  4FR7 A;  4ZEJ A;  4C1F A;  5ACQ A;  5LCH A;  4H0D A;  1ZKP A;  2R2D A;  1VJN A;  3AJ3 A;  4EXY A;  3FCZ A;  4D1W A;  1BC2 A;  1VME A;  4HL1 A;  4RM5 A;  4ZO3 A;  5LCF A;  5ACR A;  3VPE A;  5LMC A;  3G1P A;  1VGN A;  1ZTC A;  3PY5 A;  2Y87 A;  3IEL A;  4HL2 A;  3IOF A;  4FEK A;  5LLD A;  3ZNB A;  5A0T A;  5ACX A;  4F6Z A;  2YCB A;  2YNW A;  1KO2 A;  1BMC A;  2P4Z A;  5HH6 A;  5A5Z A;  2FHX B;  3SPU A;  4KEQ A;  3H3E A;  4XWW A;  4V0H A;  2VW8 A;  2BR6 A;  3SD9 A;  1YCG A;  2Y8A A;  5HH4 A;  2NXA A;  4C1G A; 
#chains in the Genus database with same CATH topology
 1X8I A;  1M2X A;  2ZNB A;  1BVT A;  3DHA A;  2BFK A;  4TZE A;  2YNT B;  4PVT A;  2GKL A;  3BC2 A;  2BG7 A;  5HIO A;  2NZE A;  5HIS A;  2FK6 A;  5K4K A;  1WW1 A;  4NUR A;  4EXS A;  5AEB A;  5EVK A;  4LE6 A;  2M5C A;  3LVZ A;  2HB9 A;  5ACP A;  3DH8 A;  5FQC A;  2BG8 B;  4TZB A;  4D1T A;  4HKY A;  4CHL A;  2I7T A;  3SFP A;  4EY2 A;  1P9E A;  2GCU A;  4TYT A;  1JT1 A;  3FAI A;  2CG3 A;  5EWA A;  4EYF A;  4TYF A;  3P2U A;  2WYL A;  1JJT A;  5LS3 A;  5HIP A;  5LSC A;  5EVD A;  4NQ4 A;  3T3O A;  3AF6 A;  2P1E A;  5EV6 A;  5K0W A;  3SW3 A;  4JO0 A;  4C1E A;  2AIO A;  4AX0 B;  2BG8 A;  2NZF A;  4D1V A;  4J5F A;  2QIN A;  2BGA A;  1X8G A;  4RL0 A;  4NQ5 A;  5K4N A;  5KIL A;  1K07 A;  2P18 A;  1JJE A;  5LE1 A;  1E5D A;  4WD6 A;  4GYQ A;  3BK1 A;  5AHR A;  5LM6 A;  1A7T A;  4Z7R A;  2GFJ A;  2CFU A;  3KL7 A;  2FM6 A;  4AXH A;  5LCA A;  4TZF A;  2FU6 A;  2XR1 A;  2Q0I A;  2Q0J A;  2BIB A;  4YSK A;  2BFZ A;  2BC2 A;  3I14 A;  2E7Y A;  4GYU A;  4P62 A;  2YHE A;  3I0V A;  2I7X A;  5A0V A;  2YNT A;  4PVO A;  2BG6 A;  3DHB A;  4YSB A;  4B87 A;  2YNV B;  2FHX A;  3IOG A;  3TP9 A;  2QDS A;  5B15 A;  4Z5Z A;  2QJS A;  3I11 A;  1WUO A;  4YSL A;  5EW0 A;  4C1H A;  4AD9 A;  2FU7 A;  2GFK A;  2H6A A;  4NQ2 A;  1DD6 A;  2Y8B A;  4EFZ A;  3RPC A;  3IE2 A;  4UWR B;  4PDX A;  1YCH A;  4RBS A;  5AYA A;  3L6N A;  2QED A;  4Z67 A;  1KO3 A;  4UBQ A;  4Z5Y A;  2A7M A;  3SRX A;  5KIK A;  1A8T A;  3WXC A;  3BK2 A;  1X8H A;  1WRA A;  4AV7 A;  1XM8 A;  2Q42 A;  3IDZ A;  2ZO4 A;  1HLK A;  1MQO A;  2OHJ A;  3DHC A;  5B3R A;  3R2U A;  1YCF A;  3ZQ4 A;  3AF5 A;  5FQB A;  3I13 A;  4EYB A;  5AXO A;  5EH9 A;  1XTO A;  4C1C A;  5AXR A;  2Q9U A;  5ACT A;  4KEP A;  1KR3 A;  2WHG A;  3PY6 A;  1SML A;  2BTN A;  2CBN A;  4RAM A;  4AWY B;  3F9O A;  4XWT A;  2ZZI A;  1WUP A;  3KNS A;  5EV8 A;  2YNV A;  4UWP B;  4NQ6 A;  2M5D A;  2BG2 A;  3QH8 A;  2WYM C;  2ZWR A;  4DIL A;  3X2Y A;  2DKF A;  2AZ4 A;  5IQK A;  3ZR9 A;  4UWS B;  2QDT A;  1ZNB A;  4D02 A;  4U4L A;  4C1D A;  3I15 A;  5ACS A;  2BFZ B;  4AX1 B;  3IE1 A;  3BV6 A;  5AHO A;  2BMI A;  4RL2 A;  5ACV A;  3T9M A;  4AWZ A;  4DIK A;  1L9Y A;  5DPX A;  2P97 A;  2YZ3 A;  3IEM A;  3PG4 A;  4D1U A;  2WYM A;  4UA4 A;  1Y44 A;  5AIJ A;  4BP0 A;  2NYP A;  5HIQ A;  2YNU A;  2I7V A;  3IE0 A;  5FQA A;  3X30 A;  2FU8 A;  3ADR A;  3A4Y A;  1DDK A;  2OHI A;  3S0Z A;  3RKK A;  3SBL A;  3KNR A;  3ZWF A;  2CFZ A;  2FU9 A;  4GCW A;  2GMN A;  5B1U A;  4J5H A;  4C09 A;  5HH5 A;  1DXK A;  3JXP A;  4UWO B;  5K4M A;  4XUK A;  2XF4 A;  4ZO2 A;  3MD7 A;  5AJL A;  4F6H A;  5ACW A;  2BFL A;  3X2Z A;  4BZ3 A;  4FSB A;  3RKJ A;  4ZNB A;  5A23 A;  4RAW A;  2UYX A;  4EYL A;  2DOO A;  3IEK A;  2WRS A;  5A87 A;  3T3N A;  5EVB A;  2CG2 A;  5ACU A;  4O98 A;  2OHH A;  4Z6X A;  4UAM A;  3X2X A;  5EHT A;  3ESH A;  1QH3 A;  4TZ9 A;  3VQZ A;  4Z60 A;  1QH5 A;  3Q6V A;  4FR7 A;  4ZEJ A;  4C1F A;  5ACQ A;  5LCH A;  4H0D A;  1ZKP A;  2R2D A;  1VJN A;  3AJ3 A;  4EXY A;  3FCZ A;  4D1W A;  1BC2 A;  1VME A;  4HL1 A;  4RM5 A;  4ZO3 A;  5LCF A;  5ACR A;  3VPE A;  5LMC A;  3G1P A;  1VGN A;  1ZTC A;  3PY5 A;  2Y87 A;  3IEL A;  4HL2 A;  3IOF A;  4FEK A;  5LLD A;  3ZNB A;  5A0T A;  5ACX A;  4F6Z A;  2YCB A;  2YNW A;  1KO2 A;  1BMC A;  2P4Z A;  5HH6 A;  5A5Z A;  2FHX B;  3SPU A;  4KEQ A;  3H3E A;  4XWW A;  4V0H A;  2VW8 A;  2BR6 A;  3SD9 A;  1YCG A;  2Y8A A;  5HH4 A;  2NXA A;  4C1G A; 
#chains in the Genus database with same CATH homology
 1X8I A;  1M2X A;  2ZNB A;  1BVT A;  3DHA A;  2BFK A;  4TZE A;  2YNT B;  4PVT A;  2GKL A;  3BC2 A;  2BG7 A;  5HIO A;  2NZE A;  5HIS A;  2FK6 A;  5K4K A;  1WW1 A;  4EXS A;  5AEB A;  5EVK A;  4LE6 A;  2M5C A;  3LVZ A;  2HB9 A;  5ACP A;  3DH8 A;  5FQC A;  2BG8 B;  4TZB A;  4D1T A;  4HKY A;  4CHL A;  2I7T A;  3SFP A;  4EY2 A;  1P9E A;  2GCU A;  4TYT A;  1JT1 A;  3FAI A;  5EWA A;  4EYF A;  4TYF A;  3P2U A;  2WYL A;  1JJT A;  5LS3 A;  5HIP A;  5LSC A;  5EVD A;  4NQ4 A;  3T3O A;  3AF6 A;  2P1E A;  5EV6 A;  5K0W A;  3SW3 A;  4JO0 A;  4C1E A;  2AIO A;  4AX0 B;  2BG8 A;  2NZF A;  4D1V A;  4J5F A;  2QIN A;  2BGA A;  1X8G A;  4RL0 A;  4NQ5 A;  5K4N A;  5KIL A;  1K07 A;  2P18 A;  1JJE A;  5LE1 A;  1E5D A;  4WD6 A;  4GYQ A;  3BK1 A;  5AHR A;  5LM6 A;  1A7T A;  4Z7R A;  2GFJ A;  3KL7 A;  2FM6 A;  5LCA A;  4TZF A;  2FU6 A;  2XR1 A;  2Q0I A;  2Q0J A;  2BIB A;  4YSK A;  2BFZ A;  2BC2 A;  3I14 A;  2E7Y A;  4GYU A;  4P62 A;  3I0V A;  2I7X A;  5A0V A;  2YNT A;  4PVO A;  2BG6 A;  3DHB A;  4YSB A;  4B87 A;  2YNV B;  2FHX A;  3IOG A;  3TP9 A;  2QDS A;  5B15 A;  4Z5Z A;  2QJS A;  3I11 A;  1WUO A;  4YSL A;  5EW0 A;  4C1H A;  4AD9 A;  2FU7 A;  2GFK A;  2H6A A;  4NQ2 A;  1DD6 A;  2Y8B A;  4EFZ A;  3RPC A;  3IE2 A;  4UWR B;  1YCH A;  4RBS A;  5AYA A;  3L6N A;  2QED A;  4Z67 A;  1KO3 A;  4UBQ A;  4Z5Y A;  2A7M A;  3SRX A;  5KIK A;  1A8T A;  3WXC A;  3BK2 A;  1X8H A;  1WRA A;  1XM8 A;  2Q42 A;  3IDZ A;  2ZO4 A;  1HLK A;  1MQO A;  2OHJ A;  3DHC A;  5B3R A;  3R2U A;  1YCF A;  3ZQ4 A;  3AF5 A;  5FQB A;  3I13 A;  5AXO A;  4EYB A;  5EH9 A;  1XTO A;  4C1C A;  5AXR A;  2Q9U A;  5ACT A;  4KEP A;  1KR3 A;  2WHG A;  3PY6 A;  1SML A;  2BTN A;  2CBN A;  4RAM A;  4AWY B;  3F9O A;  4XWT A;  2ZZI A;  1WUP A;  3KNS A;  5EV8 A;  2YNV A;  4UWP B;  4NQ6 A;  2M5D A;  2BG2 A;  3QH8 A;  2WYM C;  2ZWR A;  4DIL A;  3X2Y A;  2DKF A;  2AZ4 A;  5IQK A;  3ZR9 A;  4UWS B;  2QDT A;  1ZNB A;  4D02 A;  4U4L A;  4C1D A;  3I15 A;  5ACS A;  2BFZ B;  4AX1 B;  3IE1 A;  3BV6 A;  5AHO A;  2BMI A;  4RL2 A;  5ACV A;  3T9M A;  4AWZ A;  4DIK A;  1L9Y A;  5DPX A;  2P97 A;  2YZ3 A;  3IEM A;  3PG4 A;  4D1U A;  2WYM A;  4UA4 A;  1Y44 A;  4BP0 A;  2NYP A;  5HIQ A;  2YNU A;  2I7V A;  3IE0 A;  5FQA A;  3X30 A;  2FU8 A;  3ADR A;  3A4Y A;  1DDK A;  2OHI A;  3S0Z A;  3RKK A;  3SBL A;  3KNR A;  3ZWF A;  2FU9 A;  4GCW A;  2GMN A;  5B1U A;  4J5H A;  4C09 A;  5HH5 A;  1DXK A;  3JXP A;  4UWO B;  5K4M A;  4XUK A;  2XF4 A;  4ZO2 A;  3MD7 A;  4F6H A;  5ACW A;  2BFL A;  3X2Z A;  4BZ3 A;  4FSB A;  3RKJ A;  4ZNB A;  4RAW A;  2UYX A;  4EYL A;  2DOO A;  3IEK A;  2WRS A;  5A87 A;  3T3N A;  5EVB A;  5ACU A;  4O98 A;  2OHH A;  4Z6X A;  4UAM A;  3X2X A;  5EHT A;  3ESH A;  1QH3 A;  4TZ9 A;  3VQZ A;  4Z60 A;  1QH5 A;  3Q6V A;  4FR7 A;  4ZEJ A;  4C1F A;  5ACQ A;  5LCH A;  4H0D A;  1ZKP A;  2R2D A;  1VJN A;  3AJ3 A;  4EXY A;  3FCZ A;  4D1W A;  1BC2 A;  1VME A;  4HL1 A;  4RM5 A;  4ZO3 A;  5LCF A;  5ACR A;  3VPE A;  5LMC A;  3G1P A;  1VGN A;  1ZTC A;  3PY5 A;  2Y87 A;  3IEL A;  4HL2 A;  3IOF A;  4FEK A;  5LLD A;  3ZNB A;  5A0T A;  5ACX A;  4F6Z A;  2YCB A;  2YNW A;  1KO2 A;  1BMC A;  2P4Z A;  5HH6 A;  5A5Z A;  2FHX B;  3SPU A;  4KEQ A;  3H3E A;  4XWW A;  4V0H A;  2VW8 A;  2BR6 A;  3SD9 A;  1YCG A;  2Y8A A;  5HH4 A;  2NXA A;  4C1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...