4GYUA

Crystal structure of new delhi metallo-beta-lactamase-1 a121f mutant from klebsiella pneumoniae
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
241
structure length
241
Chain Sequence
NAIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHFHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of New Delhi Metallo-beta-Lactamase-1 A121F mutant from Klebsiella pneumoniae
rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
molecule keywords Beta-lactamase NDM-1
total genus 73
structure length 241
sequence length 241
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4gyuA00
2QJSA 4EYLA 2BFKA 4U4LA 3FCZA 2BG7A 2UYXA 4TZFA 4C1FA 4FR7A 4RM5A 4CHLA 3IEKA 1JT1A 2NXAA 2XR1A 2WYMA 3X2XA 1KO2A 3WXCA 1KR3A 3X2YA 5HIPA 4Z5ZA 5ACUA 2M5DA 5ACRA 2FU6A 5EVDA 2FM6A 5LS3A 4HL2A 1BC2A 3T3NA 4H0DA 1XM8A 4NQ5A 4FSBA 2H6AA 4C09A 3IOGA 2AIOA 5LLDA 3ZR9A 3BC2A 3ZNBA 2QINA 4D1UA 2I7XA 2NZEA 5EV6A 1P9EA 2QDTA 3JXPA 3SBLA 2GKLA 5KIKA 2OHIA 1VGNA 2Q9UA 4XWTA 2XF4A 5LCFA 2FU9A 3IDZA 3LVZA 5ACSA 2DKFA 4F6ZA 4HKYA 4AD9A 4PVOA 5LSCA 4NQ6A 2P18A 4HL1A 4EYBA 4RBSA 4C1GA 5ACWA 1WUPA 3IOFA 4WD6A 4YSLA 2YZ3A 3SFPA 4C1CA 1YCGA 4TZEA 1WRAA 5AXRA 3T9MA 1E5DA 2YNVB 1HLKA 2YNVA 2BIBA 4AX0B 2BFZA 2BFZB 2P97A 4UWPB 1JJTA 1X8IA 2E7YA 4ZEJA 5ACPA 5HH5A 3MD7A 5LCHA 1DD6A 3AJ3A 4EY2A 2WYMC 5B3RA 3L6NA 4EYFA 3F9OA 2FK6A 5FQCA 2YNTA 4ZO3A 4D1TA 1BMCA 2R2DA 4F6HA 5ACXA 4P62A 2BMIA 3X2ZA 3FAIA 2GCUA 2NYPA 3PY6A 5LCAA 3T3OA 3G1PA 1QH5A 2FU8A 5A0TA 3RKKA 5EHTA 4GCWA 5HH6A 4AX1B 4ZNBA 4YSKA 4C1EA 3VQZA 2HB9A 2BGAA 4J5FA 5EV8A 4NQ2A 3PG4A 4UA4A 4V0HA 1X8HA 1M2XA 1X8GA 1ZTCA 2BTNA 1XTOA 5IQKA 3BV6A 3IEMA 1BVTA 2BG8A 2NZFA 2BG8B 4O98A 1DDKA 1YCFA 2M5CA 3H3EA 4TYFA 3SW3A 5B1UA 1L9YA 4TZ9A 5EWAA 4Z7RA 2Y87A 1K07A 4UBQA 4D1WA 1Y44A 4TZBA 3R2UA 3BK1A 4GYQA 2QEDA 2P1EA 3IE2A 4XWWA 5A87A 1DXKA 4EFZA 4ZO2A 2ZZIA 1ZKPA 3ZQ4A 5FQAA 2Y8AA 5ACTA 3DHAA 1KO3A 4Z6XA 3KNRA 2FHXA 3DHBA 2FHXB 4AWZA 4D1VA 5AHOA 3VPEA 4UWOB 5LMCA 2BR6A 4YSBA 4RAMA 2YNWA 2YNUA 2OHHA 1VJNA 4RAWA 5K4MA 4DIKA 2YCBA 2DOOA 4UAMA 5HH4A 2FU7A 5ACVA 3AF6A 1ZNBA 5AXOA 3ZWFA 5HIOA 2P4ZA 2WHGA 5HISA 3I11A 3QH8A 1MQOA 1WW1A 2ZO4A 4UWSB 2WYLA 1QH3A 3S0ZA 2GFKA 2A7MA 5EVKA 5A5ZA 2BC2A 2I7TA 2BG2A 2BFLA 4JO0A 5ACQA 4BP0A 4AWYB 3X30A 5KILA 1A7TA 3Q6VA 5LM6A 4Z60A 4TYTA 3KNSA 5K0WA 4XUKA 2Q0JA 2Y8BA 4Z67A 4EXSA 4C1HA 3SRXA 4BZ3A 4RL0A 4NQ4A 3ESHA 3DH8A 5DPXA 4PVTA 3RKJA 3I13A 3I15A 3A4YA 4DILA 2I7VA 2QDSA 2ZNBA 4FEKA 3ADRA 1YCHA 4Z5YA 2YNTB 2Q0IA 3TP9A 1JJEA 5LE1A 4UWRB 1WUOA 3AF5A 2CBNA 1SMLA 3SD9A 3BK2A 4EXYA 3IE1A 3DHCA 4RL2A 4B87A 2Q42A 4J5HA 2VW8A 3RPCA 5K4NA 2ZWRA 2AZ4A 5AYAA 1A8TA 5EW0A 3I14A 3PY5A 4KEQA 5HIQA 2OHJA 4LE6A 2WRSA 5K4KA 3IE0A 5EVBA 5A0VA 5B15A 3KL7A 4D02A 5AEBA 3SPUA 3I0VA 1VMEA 2GFJA 4GYUA 5AHRA 5FQBA 4KEPA 3P2UA 5EH9A 4C1DA 2BG6A 2GMNA 3IELA
chains in the Genus database with same CATH superfamily
2QJSA 4EYLA 2BFKA 4U4LA 3FCZA 2BG7A 2UYXA 4TZFA 4AV7A 4C1FA 4FR7A 4RM5A 4CHLA 3IEKA 1JT1A 2NXAA 2XR1A 2WYMA 3X2XA 1KO2A 3WXCA 1KR3A 3X2YA 5HIPA 4Z5ZA 5ACUA 2M5DA 5ACRA 2FU6A 5EVDA 2FM6A 5LS3A 4HL2A 1BC2A 3T3NA 4H0DA 1XM8A 4NQ5A 4FSBA 2H6AA 4C09A 3IOGA 2AIOA 5LLDA 3ZR9A 3BC2A 3ZNBA 2QINA 4D1UA 2I7XA 2NZEA 5EV6A 1P9EA 2QDTA 3JXPA 3SBLA 2GKLA 5KIKA 2OHIA 1VGNA 2Q9UA 4XWTA 2XF4A 5LCFA 2FU9A 3IDZA 3LVZA 5ACSA 2DKFA 4F6ZA 4HKYA 4AD9A 4PVOA 5LSCA 4NQ6A 2P18A 4HL1A 4EYBA 4RBSA 4C1GA 5ACWA 1WUPA 3IOFA 2CFUA 4WD6A 4YSLA 2YZ3A 3SFPA 4C1CA 2CG2A 1YCGA 4TZEA 1WRAA 5AXRA 3T9MA 1E5DA 2YNVB 1HLKA 2YNVA 2BIBA 4AX0B 2BFZA 2BFZB 2P97A 4UWPB 1JJTA 1X8IA 2E7YA 4ZEJA 5ACPA 5HH5A 3MD7A 5LCHA 1DD6A 3AJ3A 4EY2A 2WYMC 5B3RA 3L6NA 4EYFA 3F9OA 2FK6A 5FQCA 2YNTA 4ZO3A 4D1TA 1BMCA 2R2DA 4F6HA 5ACXA 4P62A 2BMIA 3X2ZA 3FAIA 2GCUA 2NYPA 3PY6A 5AIJA 5LCAA 3T3OA 3G1PA 1QH5A 2FU8A 5A0TA 3RKKA 5EHTA 4GCWA 5HH6A 4AX1B 5AJLA 4ZNBA 4YSKA 4C1EA 3VQZA 2HB9A 2BGAA 4J5FA 5EV8A 4NQ2A 3PG4A 4UA4A 4V0HA 1X8HA 5A23A 1M2XA 1X8GA 1ZTCA 2BTNA 2CG3A 1XTOA 5IQKA 3BV6A 3IEMA 1BVTA 2BG8A 2NZFA 2BG8B 4O98A 1DDKA 1YCFA 2M5CA 3H3EA 4TYFA 3SW3A 5B1UA 1L9YA 4TZ9A 5EWAA 4Z7RA 2Y87A 1K07A 4UBQA 4D1WA 1Y44A 4TZBA 3R2UA 3BK1A 4GYQA 2QEDA 2P1EA 3IE2A 4XWWA 5A87A 1DXKA 4EFZA 4ZO2A 2ZZIA 1ZKPA 3ZQ4A 2CFZA 5FQAA 2Y8AA 5ACTA 3DHAA 1KO3A 4Z6XA 3KNRA 2FHXA 3DHBA 2FHXB 4AWZA 4D1VA 5AHOA 3VPEA 4UWOB 5LMCA 2BR6A 4YSBA 4RAMA 2YNWA 2YNUA 2OHHA 1VJNA 4RAWA 5K4MA 4DIKA 2YCBA 2DOOA 4UAMA 5HH4A 4AXHA 2FU7A 5ACVA 3AF6A 1ZNBA 5AXOA 3ZWFA 5HIOA 2P4ZA 2WHGA 5HISA 3I11A 3QH8A 1MQOA 1WW1A 2ZO4A 4UWSB 2WYLA 4PDXA 1QH3A 3S0ZA 2GFKA 2A7MA 5EVKA 5A5ZA 2BC2A 2I7TA 2BG2A 4NURA 2BFLA 4JO0A 5ACQA 4BP0A 4AWYB 3X30A 5KILA 1A7TA 3Q6VA 5LM6A 4Z60A 4TYTA 3KNSA 5K0WA 4XUKA 2Q0JA 2Y8BA 4Z67A 4EXSA 4C1HA 3SRXA 4BZ3A 4RL0A 4NQ4A 3ESHA 3DH8A 5DPXA 4PVTA 3RKJA 3I13A 3I15A 3A4YA 4DILA 2I7VA 2QDSA 2ZNBA 4FEKA 3ADRA 1YCHA 4Z5YA 2YNTB 2Q0IA 3TP9A 1JJEA 5LE1A 4UWRB 1WUOA 3AF5A 2CBNA 1SMLA 3SD9A 3BK2A 4EXYA 3IE1A 3DHCA 4RL2A 4B87A 2Q42A 4J5HA 2VW8A 3RPCA 5K4NA 2ZWRA 2AZ4A 5AYAA 1A8TA 5EW0A 3I14A 3PY5A 4KEQA 5HIQA 2OHJA 4LE6A 2WRSA 5K4KA 3IE0A 5EVBA 5A0VA 5B15A 3KL7A 4D02A 5AEBA 3SPUA 3I0VA 1VMEA 2GFJA 4GYUA 5AHRA 5FQBA 4KEPA 3P2UA 5EH9A 4C1DA 2BG6A 2GMNA 2YHEA 3IELA
chains in the Genus database with same CATH topology
2QJSA 4EYLA 2BFKA 4U4LA 3FCZA 2BG7A 2UYXA 4TZFA 4C1FA 4FR7A 4RM5A 4CHLA 3IEKA 1JT1A 2NXAA 2XR1A 2WYMA 3X2XA 1KO2A 3WXCA 1KR3A 3X2YA 5HIPA 4Z5ZA 5ACUA 2M5DA 5ACRA 2FU6A 5EVDA 2FM6A 5LS3A 4HL2A 1BC2A 3T3NA 4H0DA 1XM8A 4NQ5A 4FSBA 2H6AA 4C09A 3IOGA 2AIOA 5LLDA 3ZR9A 3BC2A 3ZNBA 2QINA 4D1UA 2I7XA 2NZEA 5EV6A 1P9EA 2QDTA 3JXPA 3SBLA 2GKLA 5KIKA 2OHIA 1VGNA 2Q9UA 4XWTA 2XF4A 5LCFA 2FU9A 3IDZA 3LVZA 5ACSA 2DKFA 4F6ZA 4HKYA 4AD9A 4PVOA 5LSCA 4NQ6A 2P18A 4HL1A 4EYBA 4RBSA 4C1GA 5ACWA 1WUPA 3IOFA 4WD6A 4YSLA 2YZ3A 3SFPA 4C1CA 1YCGA 4TZEA 1WRAA 5AXRA 3T9MA 1E5DA 2YNVB 1HLKA 2YNVA 2BIBA 4AX0B 2BFZA 2BFZB 2P97A 4UWPB 1JJTA 1X8IA 2E7YA 4ZEJA 5ACPA 5HH5A 3MD7A 5LCHA 1DD6A 3AJ3A 4EY2A 2WYMC 5B3RA 3L6NA 4EYFA 3F9OA 2FK6A 5FQCA 2YNTA 4ZO3A 4D1TA 1BMCA 2R2DA 4F6HA 5ACXA 4P62A 2BMIA 3X2ZA 3FAIA 2GCUA 2NYPA 3PY6A 5LCAA 3T3OA 3G1PA 1QH5A 2FU8A 5A0TA 3RKKA 5EHTA 4GCWA 5HH6A 4AX1B 4ZNBA 4YSKA 4C1EA 3VQZA 2HB9A 2BGAA 4J5FA 5EV8A 4NQ2A 3PG4A 4UA4A 4V0HA 1X8HA 1M2XA 1X8GA 1ZTCA 2BTNA 1XTOA 5IQKA 3BV6A 3IEMA 1BVTA 2BG8A 2NZFA 2BG8B 4O98A 1DDKA 1YCFA 2M5CA 3H3EA 4TYFA 3SW3A 5B1UA 1L9YA 4TZ9A 5EWAA 4Z7RA 2Y87A 1K07A 4UBQA 4D1WA 1Y44A 4TZBA 3R2UA 3BK1A 4GYQA 2QEDA 2P1EA 3IE2A 4XWWA 5A87A 1DXKA 4EFZA 4ZO2A 2ZZIA 1ZKPA 3ZQ4A 5FQAA 2Y8AA 5ACTA 3DHAA 1KO3A 4Z6XA 3KNRA 2FHXA 3DHBA 2FHXB 4AWZA 4D1VA 5AHOA 3VPEA 4UWOB 5LMCA 2BR6A 4YSBA 4RAMA 2YNWA 2YNUA 2OHHA 1VJNA 4RAWA 5K4MA 4DIKA 2YCBA 2DOOA 4UAMA 5HH4A 2FU7A 5ACVA 3AF6A 1ZNBA 5AXOA 3ZWFA 5HIOA 2P4ZA 2WHGA 5HISA 3I11A 3QH8A 1MQOA 1WW1A 2ZO4A 4UWSB 2WYLA 1QH3A 3S0ZA 2GFKA 2A7MA 5EVKA 5A5ZA 2BC2A 2I7TA 2BG2A 2BFLA 4JO0A 5ACQA 4BP0A 4AWYB 3X30A 5KILA 1A7TA 3Q6VA 5LM6A 4Z60A 4TYTA 3KNSA 5K0WA 4XUKA 2Q0JA 2Y8BA 4Z67A 4EXSA 4C1HA 3SRXA 4BZ3A 4RL0A 4NQ4A 3ESHA 3DH8A 5DPXA 4PVTA 3RKJA 3I13A 3I15A 3A4YA 4DILA 2I7VA 2QDSA 2ZNBA 4FEKA 3ADRA 1YCHA 4Z5YA 2YNTB 2Q0IA 3TP9A 1JJEA 5LE1A 4UWRB 1WUOA 3AF5A 2CBNA 1SMLA 3SD9A 3BK2A 4EXYA 3IE1A 3DHCA 4RL2A 4B87A 2Q42A 4J5HA 2VW8A 3RPCA 5K4NA 2ZWRA 2AZ4A 5AYAA 1A8TA 5EW0A 3I14A 3PY5A 4KEQA 5HIQA 2OHJA 4LE6A 2WRSA 5K4KA 3IE0A 5EVBA 5A0VA 5B15A 3KL7A 4D02A 5AEBA 3SPUA 3I0VA 1VMEA 2GFJA 4GYUA 5AHRA 5FQBA 4KEPA 3P2UA 5EH9A 4C1DA 2BG6A 2GMNA 3IELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJS A;  4EYL A;  2BFK A;  4U4L A;  3FCZ A;  2BG7 A;  2UYX A;  4TZF A;  4C1F A;  4FR7 A;  4RM5 A;  4CHL A;  3IEK A;  1JT1 A;  2NXA A;  2XR1 A;  2WYM A;  3X2X A;  1KO2 A;  3WXC A;  1KR3 A;  3X2Y A;  5HIP A;  4Z5Z A;  5ACU A;  2M5D A;  5ACR A;  2FU6 A;  5EVD A;  2FM6 A;  5LS3 A;  4HL2 A;  1BC2 A;  3T3N A;  4H0D A;  1XM8 A;  4NQ5 A;  4FSB A;  2H6A A;  4C09 A;  3IOG A;  2AIO A;  5LLD A;  3ZR9 A;  3BC2 A;  3ZNB A;  2QIN A;  4D1U A;  2I7X A;  2NZE A;  5EV6 A;  1P9E A;  2QDT A;  3JXP A;  3SBL A;  2GKL A;  5KIK A;  2OHI A;  1VGN A;  2Q9U A;  4XWT A;  2XF4 A;  5LCF A;  2FU9 A;  3IDZ A;  3LVZ A;  5ACS A;  2DKF A;  4F6Z A;  4HKY A;  4AD9 A;  4PVO A;  5LSC A;  4NQ6 A;  2P18 A;  4HL1 A;  4EYB A;  4RBS A;  4C1G A;  5ACW A;  1WUP A;  3IOF A;  4WD6 A;  4YSL A;  2YZ3 A;  3SFP A;  4C1C A;  1YCG A;  4TZE A;  1WRA A;  5AXR A;  3T9M A;  1E5D A;  2YNV B;  1HLK A;  2YNV A;  2BIB A;  4AX0 B;  2BFZ A;  2BFZ B;  2P97 A;  4UWP B;  1JJT A;  1X8I A;  2E7Y A;  4ZEJ A;  5ACP A;  5HH5 A;  3MD7 A;  5LCH A;  1DD6 A;  3AJ3 A;  4EY2 A;  2WYM C;  5B3R A;  3L6N A;  4EYF A;  3F9O A;  2FK6 A;  5FQC A;  2YNT A;  4ZO3 A;  4D1T A;  1BMC A;  2R2D A;  4F6H A;  5ACX A;  4P62 A;  2BMI A;  3X2Z A;  3FAI A;  2GCU A;  2NYP A;  3PY6 A;  5LCA A;  3T3O A;  3G1P A;  1QH5 A;  2FU8 A;  5A0T A;  3RKK A;  5EHT A;  4GCW A;  5HH6 A;  4AX1 B;  4ZNB A;  4YSK A;  4C1E A;  3VQZ A;  2HB9 A;  2BGA A;  4J5F A;  5EV8 A;  4NQ2 A;  3PG4 A;  4UA4 A;  4V0H A;  1X8H A;  1M2X A;  1X8G A;  1ZTC A;  2BTN A;  1XTO A;  5IQK A;  3BV6 A;  3IEM A;  1BVT A;  2BG8 A;  2NZF A;  2BG8 B;  4O98 A;  1DDK A;  1YCF A;  2M5C A;  3H3E A;  4TYF A;  3SW3 A;  5B1U A;  1L9Y A;  4TZ9 A;  5EWA A;  4Z7R A;  2Y87 A;  1K07 A;  4UBQ A;  4D1W A;  1Y44 A;  4TZB A;  3R2U A;  3BK1 A;  4GYQ A;  2QED A;  2P1E A;  3IE2 A;  4XWW A;  5A87 A;  1DXK A;  4EFZ A;  4ZO2 A;  2ZZI A;  1ZKP A;  3ZQ4 A;  5FQA A;  2Y8A A;  5ACT A;  3DHA A;  1KO3 A;  4Z6X A;  3KNR A;  2FHX A;  3DHB A;  2FHX B;  4AWZ A;  4D1V A;  5AHO A;  3VPE A;  4UWO B;  5LMC A;  2BR6 A;  4YSB A;  4RAM A;  2YNW A;  2YNU A;  2OHH A;  1VJN A;  4RAW A;  5K4M A;  4DIK A;  2YCB A;  2DOO A;  4UAM A;  5HH4 A;  2FU7 A;  5ACV A;  3AF6 A;  1ZNB A;  5AXO A;  3ZWF A;  5HIO A;  2P4Z A;  2WHG A;  5HIS A;  3I11 A;  3QH8 A;  1MQO A;  1WW1 A;  2ZO4 A;  4UWS B;  2WYL A;  1QH3 A;  3S0Z A;  2GFK A;  2A7M A;  5EVK A;  5A5Z A;  2BC2 A;  2I7T A;  2BG2 A;  2BFL A;  4JO0 A;  5ACQ A;  4BP0 A;  4AWY B;  3X30 A;  5KIL A;  1A7T A;  3Q6V A;  5LM6 A;  4Z60 A;  4TYT A;  3KNS A;  5K0W A;  4XUK A;  2Q0J A;  2Y8B A;  4Z67 A;  4EXS A;  4C1H A;  3SRX A;  4BZ3 A;  4RL0 A;  4NQ4 A;  3ESH A;  3DH8 A;  5DPX A;  4PVT A;  3RKJ A;  3I13 A;  3I15 A;  3A4Y A;  4DIL A;  2I7V A;  2QDS A;  2ZNB A;  4FEK A;  3ADR A;  1YCH A;  4Z5Y A;  2YNT B;  2Q0I A;  3TP9 A;  1JJE A;  5LE1 A;  4UWR B;  1WUO A;  3AF5 A;  2CBN A;  1SML A;  3SD9 A;  3BK2 A;  4EXY A;  3IE1 A;  3DHC A;  4RL2 A;  4B87 A;  2Q42 A;  4J5H A;  2VW8 A;  3RPC A;  5K4N A;  2ZWR A;  2AZ4 A;  5AYA A;  1A8T A;  5EW0 A;  3I14 A;  3PY5 A;  4KEQ A;  5HIQ A;  2OHJ A;  4LE6 A;  2WRS A;  5K4K A;  3IE0 A;  5EVB A;  5A0V A;  5B15 A;  3KL7 A;  4D02 A;  5AEB A;  3SPU A;  3I0V A;  1VME A;  2GFJ A;  4GYU A;  5AHR A;  5FQB A;  4KEP A;  3P2U A;  5EH9 A;  4C1D A;  2BG6 A;  2GMN A;  3IEL A; 
#chains in the Genus database with same CATH topology
 2QJS A;  4EYL A;  2BFK A;  4U4L A;  3FCZ A;  2BG7 A;  2UYX A;  4TZF A;  4AV7 A;  4C1F A;  4FR7 A;  4RM5 A;  4CHL A;  3IEK A;  1JT1 A;  2NXA A;  2XR1 A;  2WYM A;  3X2X A;  1KO2 A;  3WXC A;  1KR3 A;  3X2Y A;  5HIP A;  4Z5Z A;  5ACU A;  2M5D A;  5ACR A;  2FU6 A;  5EVD A;  2FM6 A;  5LS3 A;  4HL2 A;  1BC2 A;  3T3N A;  4H0D A;  1XM8 A;  4NQ5 A;  4FSB A;  2H6A A;  4C09 A;  3IOG A;  2AIO A;  5LLD A;  3ZR9 A;  3BC2 A;  3ZNB A;  2QIN A;  4D1U A;  2I7X A;  2NZE A;  5EV6 A;  1P9E A;  2QDT A;  3JXP A;  3SBL A;  2GKL A;  5KIK A;  2OHI A;  1VGN A;  2Q9U A;  4XWT A;  2XF4 A;  5LCF A;  2FU9 A;  3IDZ A;  3LVZ A;  5ACS A;  2DKF A;  4F6Z A;  4HKY A;  4AD9 A;  4PVO A;  5LSC A;  4NQ6 A;  2P18 A;  4HL1 A;  4EYB A;  4RBS A;  4C1G A;  5ACW A;  1WUP A;  3IOF A;  2CFU A;  4WD6 A;  4YSL A;  2YZ3 A;  3SFP A;  4C1C A;  2CG2 A;  1YCG A;  4TZE A;  1WRA A;  5AXR A;  3T9M A;  1E5D A;  2YNV B;  1HLK A;  2YNV A;  2BIB A;  4AX0 B;  2BFZ A;  2BFZ B;  2P97 A;  4UWP B;  1JJT A;  1X8I A;  2E7Y A;  4ZEJ A;  5ACP A;  5HH5 A;  3MD7 A;  5LCH A;  1DD6 A;  3AJ3 A;  4EY2 A;  2WYM C;  5B3R A;  3L6N A;  4EYF A;  3F9O A;  2FK6 A;  5FQC A;  2YNT A;  4ZO3 A;  4D1T A;  1BMC A;  2R2D A;  4F6H A;  5ACX A;  4P62 A;  2BMI A;  3X2Z A;  3FAI A;  2GCU A;  2NYP A;  3PY6 A;  5AIJ A;  5LCA A;  3T3O A;  3G1P A;  1QH5 A;  2FU8 A;  5A0T A;  3RKK A;  5EHT A;  4GCW A;  5HH6 A;  4AX1 B;  5AJL A;  4ZNB A;  4YSK A;  4C1E A;  3VQZ A;  2HB9 A;  2BGA A;  4J5F A;  5EV8 A;  4NQ2 A;  3PG4 A;  4UA4 A;  4V0H A;  1X8H A;  5A23 A;  1M2X A;  1X8G A;  1ZTC A;  2BTN A;  2CG3 A;  1XTO A;  5IQK A;  3BV6 A;  3IEM A;  1BVT A;  2BG8 A;  2NZF A;  2BG8 B;  4O98 A;  1DDK A;  1YCF A;  2M5C A;  3H3E A;  4TYF A;  3SW3 A;  5B1U A;  1L9Y A;  4TZ9 A;  5EWA A;  4Z7R A;  2Y87 A;  1K07 A;  4UBQ A;  4D1W A;  1Y44 A;  4TZB A;  3R2U A;  3BK1 A;  4GYQ A;  2QED A;  2P1E A;  3IE2 A;  4XWW A;  5A87 A;  1DXK A;  4EFZ A;  4ZO2 A;  2ZZI A;  1ZKP A;  3ZQ4 A;  2CFZ A;  5FQA A;  2Y8A A;  5ACT A;  3DHA A;  1KO3 A;  4Z6X A;  3KNR A;  2FHX A;  3DHB A;  2FHX B;  4AWZ A;  4D1V A;  5AHO A;  3VPE A;  4UWO B;  5LMC A;  2BR6 A;  4YSB A;  4RAM A;  2YNW A;  2YNU A;  2OHH A;  1VJN A;  4RAW A;  5K4M A;  4DIK A;  2YCB A;  2DOO A;  4UAM A;  5HH4 A;  4AXH A;  2FU7 A;  5ACV A;  3AF6 A;  1ZNB A;  5AXO A;  3ZWF A;  5HIO A;  2P4Z A;  2WHG A;  5HIS A;  3I11 A;  3QH8 A;  1MQO A;  1WW1 A;  2ZO4 A;  4UWS B;  2WYL A;  4PDX A;  1QH3 A;  3S0Z A;  2GFK A;  2A7M A;  5EVK A;  5A5Z A;  2BC2 A;  2I7T A;  2BG2 A;  4NUR A;  2BFL A;  4JO0 A;  5ACQ A;  4BP0 A;  4AWY B;  3X30 A;  5KIL A;  1A7T A;  3Q6V A;  5LM6 A;  4Z60 A;  4TYT A;  3KNS A;  5K0W A;  4XUK A;  2Q0J A;  2Y8B A;  4Z67 A;  4EXS A;  4C1H A;  3SRX A;  4BZ3 A;  4RL0 A;  4NQ4 A;  3ESH A;  3DH8 A;  5DPX A;  4PVT A;  3RKJ A;  3I13 A;  3I15 A;  3A4Y A;  4DIL A;  2I7V A;  2QDS A;  2ZNB A;  4FEK A;  3ADR A;  1YCH A;  4Z5Y A;  2YNT B;  2Q0I A;  3TP9 A;  1JJE A;  5LE1 A;  4UWR B;  1WUO A;  3AF5 A;  2CBN A;  1SML A;  3SD9 A;  3BK2 A;  4EXY A;  3IE1 A;  3DHC A;  4RL2 A;  4B87 A;  2Q42 A;  4J5H A;  2VW8 A;  3RPC A;  5K4N A;  2ZWR A;  2AZ4 A;  5AYA A;  1A8T A;  5EW0 A;  3I14 A;  3PY5 A;  4KEQ A;  5HIQ A;  2OHJ A;  4LE6 A;  2WRS A;  5K4K A;  3IE0 A;  5EVB A;  5A0V A;  5B15 A;  3KL7 A;  4D02 A;  5AEB A;  3SPU A;  3I0V A;  1VME A;  2GFJ A;  4GYU A;  5AHR A;  5FQB A;  4KEP A;  3P2U A;  5EH9 A;  4C1D A;  2BG6 A;  2GMN A;  2YHE A;  3IEL A; 
#chains in the Genus database with same CATH homology
 2QJS A;  4EYL A;  2BFK A;  4U4L A;  3FCZ A;  2BG7 A;  2UYX A;  4TZF A;  4C1F A;  4FR7 A;  4RM5 A;  4CHL A;  3IEK A;  1JT1 A;  2NXA A;  2XR1 A;  2WYM A;  3X2X A;  1KO2 A;  3WXC A;  1KR3 A;  3X2Y A;  5HIP A;  4Z5Z A;  5ACU A;  2M5D A;  5ACR A;  2FU6 A;  5EVD A;  2FM6 A;  5LS3 A;  4HL2 A;  1BC2 A;  3T3N A;  4H0D A;  1XM8 A;  4NQ5 A;  4FSB A;  2H6A A;  4C09 A;  3IOG A;  2AIO A;  5LLD A;  3ZR9 A;  3BC2 A;  3ZNB A;  2QIN A;  4D1U A;  2I7X A;  2NZE A;  5EV6 A;  1P9E A;  2QDT A;  3JXP A;  3SBL A;  2GKL A;  5KIK A;  2OHI A;  1VGN A;  2Q9U A;  4XWT A;  2XF4 A;  5LCF A;  2FU9 A;  3IDZ A;  3LVZ A;  5ACS A;  2DKF A;  4F6Z A;  4HKY A;  4AD9 A;  4PVO A;  5LSC A;  4NQ6 A;  2P18 A;  4HL1 A;  4EYB A;  4RBS A;  4C1G A;  5ACW A;  1WUP A;  3IOF A;  4WD6 A;  4YSL A;  2YZ3 A;  3SFP A;  4C1C A;  1YCG A;  4TZE A;  1WRA A;  5AXR A;  3T9M A;  1E5D A;  2YNV B;  1HLK A;  2YNV A;  2BIB A;  4AX0 B;  2BFZ A;  2BFZ B;  2P97 A;  4UWP B;  1JJT A;  1X8I A;  2E7Y A;  4ZEJ A;  5ACP A;  5HH5 A;  3MD7 A;  5LCH A;  1DD6 A;  3AJ3 A;  4EY2 A;  2WYM C;  5B3R A;  3L6N A;  4EYF A;  3F9O A;  2FK6 A;  5FQC A;  2YNT A;  4ZO3 A;  4D1T A;  1BMC A;  2R2D A;  4F6H A;  5ACX A;  4P62 A;  2BMI A;  3X2Z A;  3FAI A;  2GCU A;  2NYP A;  3PY6 A;  5LCA A;  3T3O A;  3G1P A;  1QH5 A;  2FU8 A;  5A0T A;  3RKK A;  5EHT A;  4GCW A;  5HH6 A;  4AX1 B;  4ZNB A;  4YSK A;  4C1E A;  3VQZ A;  2HB9 A;  2BGA A;  4J5F A;  5EV8 A;  4NQ2 A;  3PG4 A;  4UA4 A;  4V0H A;  1X8H A;  1M2X A;  1X8G A;  1ZTC A;  2BTN A;  1XTO A;  5IQK A;  3BV6 A;  3IEM A;  1BVT A;  2BG8 A;  2NZF A;  2BG8 B;  4O98 A;  1DDK A;  1YCF A;  2M5C A;  3H3E A;  4TYF A;  3SW3 A;  5B1U A;  1L9Y A;  4TZ9 A;  5EWA A;  4Z7R A;  2Y87 A;  1K07 A;  4UBQ A;  4D1W A;  1Y44 A;  4TZB A;  3R2U A;  3BK1 A;  4GYQ A;  2QED A;  2P1E A;  3IE2 A;  4XWW A;  5A87 A;  1DXK A;  4EFZ A;  4ZO2 A;  2ZZI A;  1ZKP A;  3ZQ4 A;  5FQA A;  2Y8A A;  5ACT A;  3DHA A;  1KO3 A;  4Z6X A;  3KNR A;  2FHX A;  3DHB A;  2FHX B;  4AWZ A;  4D1V A;  5AHO A;  3VPE A;  4UWO B;  5LMC A;  2BR6 A;  4YSB A;  4RAM A;  2YNW A;  2YNU A;  2OHH A;  1VJN A;  4RAW A;  5K4M A;  4DIK A;  2YCB A;  2DOO A;  4UAM A;  5HH4 A;  2FU7 A;  5ACV A;  3AF6 A;  1ZNB A;  5AXO A;  3ZWF A;  5HIO A;  2P4Z A;  2WHG A;  5HIS A;  3I11 A;  3QH8 A;  1MQO A;  1WW1 A;  2ZO4 A;  4UWS B;  2WYL A;  1QH3 A;  3S0Z A;  2GFK A;  2A7M A;  5EVK A;  5A5Z A;  2BC2 A;  2I7T A;  2BG2 A;  2BFL A;  4JO0 A;  5ACQ A;  4BP0 A;  4AWY B;  3X30 A;  5KIL A;  1A7T A;  3Q6V A;  5LM6 A;  4Z60 A;  4TYT A;  3KNS A;  5K0W A;  4XUK A;  2Q0J A;  2Y8B A;  4Z67 A;  4EXS A;  4C1H A;  3SRX A;  4BZ3 A;  4RL0 A;  4NQ4 A;  3ESH A;  3DH8 A;  5DPX A;  4PVT A;  3RKJ A;  3I13 A;  3I15 A;  3A4Y A;  4DIL A;  2I7V A;  2QDS A;  2ZNB A;  4FEK A;  3ADR A;  1YCH A;  4Z5Y A;  2YNT B;  2Q0I A;  3TP9 A;  1JJE A;  5LE1 A;  4UWR B;  1WUO A;  3AF5 A;  2CBN A;  1SML A;  3SD9 A;  3BK2 A;  4EXY A;  3IE1 A;  3DHC A;  4RL2 A;  4B87 A;  2Q42 A;  4J5H A;  2VW8 A;  3RPC A;  5K4N A;  2ZWR A;  2AZ4 A;  5AYA A;  1A8T A;  5EW0 A;  3I14 A;  3PY5 A;  4KEQ A;  5HIQ A;  2OHJ A;  4LE6 A;  2WRS A;  5K4K A;  3IE0 A;  5EVB A;  5A0V A;  5B15 A;  3KL7 A;  4D02 A;  5AEB A;  3SPU A;  3I0V A;  1VME A;  2GFJ A;  4GYU A;  5AHR A;  5FQB A;  4KEP A;  3P2U A;  5EH9 A;  4C1D A;  2BG6 A;  2GMN A;  3IEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...