4GYUA

Crystal structure of new delhi metallo-beta-lactamase-1 a121f mutant from klebsiella pneumoniae
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
241
structure length
241
Chain Sequence
NAIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHFHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase NDM-1
publication title Crystal Structure of New Delhi Metallo-beta-Lactamase-1 A121F mutant from Klebsiella pneumoniae
rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
total genus 73
structure length 241
sequence length 241
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4gyuA00
5KIKA 4DILA 2QDTA 2NZFA 2BFLA 2YNTB 1ZKPA 2XR1A 5HIQA 4TZFA 3KNRA 4H0DA 2YCBA 2BFZB 4RAWA 2A7MA 2UYXA 4C1FA 5LCAA 4UA4A 3X2ZA 2OHJA 4C1DA 4UWOB 1KR3A 2YZ3A 5HIPA 3BC2A 3BK1A 5FQCA 4Z60A 5IQKA 4TZEA 5LLDA 2QJSA 2YNUA 3AF6A 3H3EA 4WD6A 3PG4A 5ACWA 3SBLA 2BG2A 5HH5A 5K0WA 1VJNA 5AHRA 5EVKA 1KO2A 1M2XA 4C1HA 4FR7A 4Z67A 2OHHA 2GCUA 4AWYB 4C1GA 1BC2A 5LCHA 2BG6A 5LM6A 5EV8A 4F6HA 3Q6VA 3IDZA 5HISA 5LSCA 3X2XA 1ZTCA 1KO3A 1SMLA 1X8HA 3MD7A 2GFJA 2AZ4A 2DKFA 2FU7A 3LVZA 4P62A 2XF4A 5A5ZA 3ESHA 2R2DA 3RKKA 2FHXA 5K4NA 1YCFA 4D02A 1BVTA 4UWRB 4TZBA 3I14A 4Z5YA 3I15A 4NQ4A 3VPEA 5FQAA 4BZ3A 3I0VA 1A8TA 3SD9A 2Y8AA 4RM5A 5B15A 3KL7A 1YCHA 3DHBA 2Q9UA 3RKJA 2CBNA 3T9MA 5EH9A 4PVOA 4YSKA 2P97A 5ACVA 4RAMA 3IE2A 3BV6A 5AXRA 2Y8BA 4FEKA 4Z5ZA 2NXAA 1VMEA 1WUOA 1QH5A 3I13A 4NQ6A 2FU6A 2NYPA 5ACQA 4LE6A 5EVBA 4UWSB 5KILA 2YNVA 4TYFA 4KEPA 4GYQA 5ACRA 5A0VA 2BC2A 3IE1A 3R2UA 5HIOA 4CHLA 4EYLA 5LMCA 3AF5A 2Q0JA 2Y87A 2WRSA 5HH6A 2HB9A 2VW8A 4NQ2A 3FAIA 4EFZA 4AX1B 4YSBA 3AJ3A 3QH8A 3A4YA 2P4ZA 4RBSA 4ZO3A 4KEQA 2OHIA 3L6NA 4JO0A 3X2YA 2I7XA 2WYMC 4BP0A 5ACUA 2P1EA 3VQZA 1WRAA 3SW3A 4ZEJA 3X30A 3G1PA 4PVTA 2BG7A 4DIKA 2ZWRA 2QINA 4C1EA 5LE1A 4UAMA 3WXCA 2GKLA 3IEKA 4EXYA 5ACXA 2FHXB 2WYMA 3ZQ4A 1L9YA 3ADRA 5B3RA 3IEMA 1Y44A 3I11A 2QDSA 4GYUA 3KNSA 2BTNA 3TP9A 3IOFA 3RPCA 4UWPB 3JXPA 4HKYA 4C09A 4D1UA 2ZNBA 1MQOA 4D1WA 4EXSA 2M5DA 2WHGA 1XM8A 4XUKA 4GCWA 4EYFA 1QH3A 3ZWFA 2Q0IA 1P9EA 3SRXA 4AD9A 5AYAA 2GFKA 3P2UA 2E7YA 4HL2A 2M5CA 2BG8A 2FU8A 4TZ9A 2H6AA 1XTOA 3IELA 5EWAA 4XWWA 4FSBA 5FQBA 2BFKA 4UBQA 5AXOA 5LCFA 2YNTA 3DH8A 5K4MA 2YNVB 2FK6A 2I7TA 2FU9A 2NZEA 2BR6A 5ACSA 4U4LA 3DHCA 2BFZA 1E5DA 5EV6A 1JT1A 3FCZA 2QEDA 5ACTA 1JJEA 2Q42A 3T3NA 5AEBA 4B87A 4TYTA 3SFPA 5B1UA 5HH4A 1BMCA 5LS3A 3PY6A 3IOGA 3DHAA 4EYBA 4D1TA 1A7TA 3ZNBA 5EW0A 4D1VA 1DD6A 2I7VA 1HLKA 4EY2A 4J5FA 1YCGA 2ZO4A 2GMNA 3T3OA 2BGAA 2P18A 5AHOA 5DPXA 5K4KA 3ZR9A 2WYLA 1JJTA 4NQ5A 5EVDA 4F6ZA 1X8IA 3IE0A 4RL0A 2ZZIA 3PY5A 5ACPA 1ZNBA 4O98A 4V0HA 5A87A 4AX0B 4RL2A 3SPUA 2BIBA 1X8GA 4AWZA 1DXKA 1K07A 2YNWA 1WUPA 4J5HA 3BK2A 3S0ZA 5A0TA 4HL1A 4XWTA 5EHTA 4YSLA 1WW1A 3F9OA 4Z7RA 4ZNBA 2DOOA 2AIOA 4C1CA 2BG8B 4Z6XA 1VGNA 4ZO2A 1DDKA 2FM6A 2BMIA
chains in the Genus database with same CATH superfamily
5KIKA 4DILA 2QDTA 2NZFA 2BFLA 2YNTB 1ZKPA 2XR1A 5HIQA 4TZFA 3KNRA 4H0DA 2YCBA 2BFZB 4RAWA 2A7MA 2UYXA 4C1FA 5LCAA 4UA4A 3X2ZA 2OHJA 4C1DA 4UWOB 1KR3A 2YZ3A 5HIPA 3BC2A 3BK1A 5FQCA 4Z60A 5IQKA 4TZEA 5LLDA 2QJSA 2YNUA 3AF6A 3H3EA 4WD6A 3PG4A 5ACWA 3SBLA 2BG2A 5HH5A 5K0WA 1VJNA 5AHRA 5EVKA 1KO2A 1M2XA 4PDXA 4C1HA 4FR7A 4Z67A 2OHHA 2GCUA 4AWYB 4C1GA 1BC2A 5LCHA 4AXHA 2BG6A 5LM6A 5EV8A 4F6HA 3Q6VA 3IDZA 5HISA 5LSCA 3X2XA 1ZTCA 1KO3A 1SMLA 1X8HA 2CG3A 3MD7A 2GFJA 2AZ4A 2DKFA 2FU7A 3LVZA 4AV7A 4P62A 2XF4A 5A5ZA 3ESHA 2R2DA 3RKKA 2FHXA 5K4NA 1YCFA 4D02A 1BVTA 4UWRB 4TZBA 3I14A 4Z5YA 3I15A 4NQ4A 3VPEA 5FQAA 4BZ3A 3I0VA 5AJLA 1A8TA 3SD9A 2Y8AA 4RM5A 5B15A 3KL7A 1YCHA 3DHBA 2Q9UA 3RKJA 2CBNA 3T9MA 5EH9A 4PVOA 4YSKA 2P97A 5ACVA 4RAMA 3IE2A 3BV6A 5AXRA 2Y8BA 4FEKA 4Z5ZA 2NXAA 1VMEA 1WUOA 1QH5A 3I13A 4NQ6A 2FU6A 2NYPA 5ACQA 4LE6A 5EVBA 4UWSB 2CFUA 5KILA 2YNVA 4TYFA 4KEPA 4GYQA 5ACRA 5A0VA 2BC2A 3IE1A 3R2UA 5HIOA 4CHLA 4EYLA 5LMCA 3AF5A 2Q0JA 2Y87A 2WRSA 5HH6A 2HB9A 2VW8A 4NQ2A 3FAIA 4EFZA 4AX1B 4YSBA 3AJ3A 3QH8A 3A4YA 2P4ZA 4RBSA 4ZO3A 4KEQA 2OHIA 3L6NA 4JO0A 3X2YA 2I7XA 2WYMC 4BP0A 5ACUA 2P1EA 3VQZA 1WRAA 3SW3A 4ZEJA 3X30A 3G1PA 4PVTA 2BG7A 4DIKA 2ZWRA 2QINA 4C1EA 5LE1A 4UAMA 3WXCA 2GKLA 3IEKA 4EXYA 5ACXA 2FHXB 2WYMA 3ZQ4A 1L9YA 3ADRA 5B3RA 3IEMA 1Y44A 3I11A 2QDSA 4GYUA 3KNSA 2BTNA 3TP9A 3IOFA 3RPCA 4UWPB 3JXPA 4HKYA 4C09A 4D1UA 2ZNBA 1MQOA 4D1WA 4EXSA 2M5DA 2WHGA 1XM8A 4XUKA 4GCWA 4EYFA 1QH3A 3ZWFA 2Q0IA 1P9EA 3SRXA 4AD9A 5AYAA 2GFKA 3P2UA 2CFZA 2E7YA 5A23A 4HL2A 2M5CA 2BG8A 2FU8A 4TZ9A 2H6AA 1XTOA 3IELA 5EWAA 4XWWA 4FSBA 5FQBA 2BFKA 4UBQA 5AXOA 5LCFA 2YNTA 3DH8A 5K4MA 2YNVB 2FK6A 2I7TA 2FU9A 2NZEA 2BR6A 5ACSA 4U4LA 3DHCA 2BFZA 1E5DA 5EV6A 1JT1A 3FCZA 2QEDA 5ACTA 1JJEA 2Q42A 3T3NA 5AEBA 4B87A 4TYTA 3SFPA 5B1UA 5HH4A 1BMCA 5LS3A 3PY6A 3IOGA 3DHAA 4EYBA 4D1TA 1A7TA 3ZNBA 5EW0A 4D1VA 1DD6A 2I7VA 1HLKA 4EY2A 4J5FA 1YCGA 2ZO4A 2GMNA 3T3OA 2BGAA 2P18A 5AHOA 5AIJA 5DPXA 5K4KA 3ZR9A 2WYLA 1JJTA 4NQ5A 5EVDA 4F6ZA 1X8IA 3IE0A 4RL0A 2ZZIA 3PY5A 5ACPA 1ZNBA 4O98A 4V0HA 5A87A 4AX0B 4RL2A 3SPUA 2BIBA 1X8GA 4AWZA 1DXKA 1K07A 2YNWA 1WUPA 4J5HA 3BK2A 3S0ZA 5A0TA 4HL1A 2CG2A 4XWTA 5EHTA 2YHEA 4YSLA 4NURA 1WW1A 3F9OA 4Z7RA 4ZNBA 2DOOA 2AIOA 4C1CA 2BG8B 4Z6XA 1VGNA 4ZO2A 1DDKA 2FM6A 2BMIA
chains in the Genus database with same CATH topology
5KIKA 4DILA 2QDTA 2NZFA 2BFLA 2YNTB 1ZKPA 2XR1A 5HIQA 4TZFA 3KNRA 4H0DA 2YCBA 2BFZB 4RAWA 2A7MA 2UYXA 4C1FA 5LCAA 4UA4A 3X2ZA 2OHJA 4C1DA 4UWOB 1KR3A 2YZ3A 5HIPA 3BC2A 3BK1A 5FQCA 4Z60A 5IQKA 4TZEA 5LLDA 2QJSA 2YNUA 3AF6A 3H3EA 4WD6A 3PG4A 5ACWA 3SBLA 2BG2A 5HH5A 5K0WA 1VJNA 5AHRA 5EVKA 1KO2A 1M2XA 4C1HA 4FR7A 4Z67A 2OHHA 2GCUA 4AWYB 4C1GA 1BC2A 5LCHA 2BG6A 5LM6A 5EV8A 4F6HA 3Q6VA 3IDZA 5HISA 5LSCA 3X2XA 1ZTCA 1KO3A 1SMLA 1X8HA 3MD7A 2GFJA 2AZ4A 2DKFA 2FU7A 3LVZA 4P62A 2XF4A 5A5ZA 3ESHA 2R2DA 3RKKA 2FHXA 5K4NA 1YCFA 4D02A 1BVTA 4UWRB 4TZBA 3I14A 4Z5YA 3I15A 4NQ4A 3VPEA 5FQAA 4BZ3A 3I0VA 1A8TA 3SD9A 2Y8AA 4RM5A 5B15A 3KL7A 1YCHA 3DHBA 2Q9UA 3RKJA 2CBNA 3T9MA 5EH9A 4PVOA 4YSKA 2P97A 5ACVA 4RAMA 3IE2A 3BV6A 5AXRA 2Y8BA 4FEKA 4Z5ZA 2NXAA 1VMEA 1WUOA 1QH5A 3I13A 4NQ6A 2FU6A 2NYPA 5ACQA 4LE6A 5EVBA 4UWSB 5KILA 2YNVA 4TYFA 4KEPA 4GYQA 5ACRA 5A0VA 2BC2A 3IE1A 3R2UA 5HIOA 4CHLA 4EYLA 5LMCA 3AF5A 2Q0JA 2Y87A 2WRSA 5HH6A 2HB9A 2VW8A 4NQ2A 3FAIA 4EFZA 4AX1B 4YSBA 3AJ3A 3QH8A 3A4YA 2P4ZA 4RBSA 4ZO3A 4KEQA 2OHIA 3L6NA 4JO0A 3X2YA 2I7XA 2WYMC 4BP0A 5ACUA 2P1EA 3VQZA 1WRAA 3SW3A 4ZEJA 3X30A 3G1PA 4PVTA 2BG7A 4DIKA 2ZWRA 2QINA 4C1EA 5LE1A 4UAMA 3WXCA 2GKLA 3IEKA 4EXYA 5ACXA 2FHXB 2WYMA 3ZQ4A 1L9YA 3ADRA 5B3RA 3IEMA 1Y44A 3I11A 2QDSA 4GYUA 3KNSA 2BTNA 3TP9A 3IOFA 3RPCA 4UWPB 3JXPA 4HKYA 4C09A 4D1UA 2ZNBA 1MQOA 4D1WA 4EXSA 2M5DA 2WHGA 1XM8A 4XUKA 4GCWA 4EYFA 1QH3A 3ZWFA 2Q0IA 1P9EA 3SRXA 4AD9A 5AYAA 2GFKA 3P2UA 2E7YA 4HL2A 2M5CA 2BG8A 2FU8A 4TZ9A 2H6AA 1XTOA 3IELA 5EWAA 4XWWA 4FSBA 5FQBA 2BFKA 4UBQA 5AXOA 5LCFA 2YNTA 3DH8A 5K4MA 2YNVB 2FK6A 2I7TA 2FU9A 2NZEA 2BR6A 5ACSA 4U4LA 3DHCA 2BFZA 1E5DA 5EV6A 1JT1A 3FCZA 2QEDA 5ACTA 1JJEA 2Q42A 3T3NA 5AEBA 4B87A 4TYTA 3SFPA 5B1UA 5HH4A 1BMCA 5LS3A 3PY6A 3IOGA 3DHAA 4EYBA 4D1TA 1A7TA 3ZNBA 5EW0A 4D1VA 1DD6A 2I7VA 1HLKA 4EY2A 4J5FA 1YCGA 2ZO4A 2GMNA 3T3OA 2BGAA 2P18A 5AHOA 5DPXA 5K4KA 3ZR9A 2WYLA 1JJTA 4NQ5A 5EVDA 4F6ZA 1X8IA 3IE0A 4RL0A 2ZZIA 3PY5A 5ACPA 1ZNBA 4O98A 4V0HA 5A87A 4AX0B 4RL2A 3SPUA 2BIBA 1X8GA 4AWZA 1DXKA 1K07A 2YNWA 1WUPA 4J5HA 3BK2A 3S0ZA 5A0TA 4HL1A 4XWTA 5EHTA 4YSLA 1WW1A 3F9OA 4Z7RA 4ZNBA 2DOOA 2AIOA 4C1CA 2BG8B 4Z6XA 1VGNA 4ZO2A 1DDKA 2FM6A 2BMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KIK A;  4DIL A;  2QDT A;  2NZF A;  2BFL A;  2YNT B;  1ZKP A;  2XR1 A;  5HIQ A;  4TZF A;  3KNR A;  4H0D A;  2YCB A;  2BFZ B;  4RAW A;  2A7M A;  2UYX A;  4C1F A;  5LCA A;  4UA4 A;  3X2Z A;  2OHJ A;  4C1D A;  4UWO B;  1KR3 A;  2YZ3 A;  5HIP A;  3BC2 A;  3BK1 A;  5FQC A;  4Z60 A;  5IQK A;  4TZE A;  5LLD A;  2QJS A;  2YNU A;  3AF6 A;  3H3E A;  4WD6 A;  3PG4 A;  5ACW A;  3SBL A;  2BG2 A;  5HH5 A;  5K0W A;  1VJN A;  5AHR A;  5EVK A;  1KO2 A;  1M2X A;  4C1H A;  4FR7 A;  4Z67 A;  2OHH A;  2GCU A;  4AWY B;  4C1G A;  1BC2 A;  5LCH A;  2BG6 A;  5LM6 A;  5EV8 A;  4F6H A;  3Q6V A;  3IDZ A;  5HIS A;  5LSC A;  3X2X A;  1ZTC A;  1KO3 A;  1SML A;  1X8H A;  3MD7 A;  2GFJ A;  2AZ4 A;  2DKF A;  2FU7 A;  3LVZ A;  4P62 A;  2XF4 A;  5A5Z A;  3ESH A;  2R2D A;  3RKK A;  2FHX A;  5K4N A;  1YCF A;  4D02 A;  1BVT A;  4UWR B;  4TZB A;  3I14 A;  4Z5Y A;  3I15 A;  4NQ4 A;  3VPE A;  5FQA A;  4BZ3 A;  3I0V A;  1A8T A;  3SD9 A;  2Y8A A;  4RM5 A;  5B15 A;  3KL7 A;  1YCH A;  3DHB A;  2Q9U A;  3RKJ A;  2CBN A;  3T9M A;  5EH9 A;  4PVO A;  4YSK A;  2P97 A;  5ACV A;  4RAM A;  3IE2 A;  3BV6 A;  5AXR A;  2Y8B A;  4FEK A;  4Z5Z A;  2NXA A;  1VME A;  1WUO A;  1QH5 A;  3I13 A;  4NQ6 A;  2FU6 A;  2NYP A;  5ACQ A;  4LE6 A;  5EVB A;  4UWS B;  5KIL A;  2YNV A;  4TYF A;  4KEP A;  4GYQ A;  5ACR A;  5A0V A;  2BC2 A;  3IE1 A;  3R2U A;  5HIO A;  4CHL A;  4EYL A;  5LMC A;  3AF5 A;  2Q0J A;  2Y87 A;  2WRS A;  5HH6 A;  2HB9 A;  2VW8 A;  4NQ2 A;  3FAI A;  4EFZ A;  4AX1 B;  4YSB A;  3AJ3 A;  3QH8 A;  3A4Y A;  2P4Z A;  4RBS A;  4ZO3 A;  4KEQ A;  2OHI A;  3L6N A;  4JO0 A;  3X2Y A;  2I7X A;  2WYM C;  4BP0 A;  5ACU A;  2P1E A;  3VQZ A;  1WRA A;  3SW3 A;  4ZEJ A;  3X30 A;  3G1P A;  4PVT A;  2BG7 A;  4DIK A;  2ZWR A;  2QIN A;  4C1E A;  5LE1 A;  4UAM A;  3WXC A;  2GKL A;  3IEK A;  4EXY A;  5ACX A;  2FHX B;  2WYM A;  3ZQ4 A;  1L9Y A;  3ADR A;  5B3R A;  3IEM A;  1Y44 A;  3I11 A;  2QDS A;  4GYU A;  3KNS A;  2BTN A;  3TP9 A;  3IOF A;  3RPC A;  4UWP B;  3JXP A;  4HKY A;  4C09 A;  4D1U A;  2ZNB A;  1MQO A;  4D1W A;  4EXS A;  2M5D A;  2WHG A;  1XM8 A;  4XUK A;  4GCW A;  4EYF A;  1QH3 A;  3ZWF A;  2Q0I A;  1P9E A;  3SRX A;  4AD9 A;  5AYA A;  2GFK A;  3P2U A;  2E7Y A;  4HL2 A;  2M5C A;  2BG8 A;  2FU8 A;  4TZ9 A;  2H6A A;  1XTO A;  3IEL A;  5EWA A;  4XWW A;  4FSB A;  5FQB A;  2BFK A;  4UBQ A;  5AXO A;  5LCF A;  2YNT A;  3DH8 A;  5K4M A;  2YNV B;  2FK6 A;  2I7T A;  2FU9 A;  2NZE A;  2BR6 A;  5ACS A;  4U4L A;  3DHC A;  2BFZ A;  1E5D A;  5EV6 A;  1JT1 A;  3FCZ A;  2QED A;  5ACT A;  1JJE A;  2Q42 A;  3T3N A;  5AEB A;  4B87 A;  4TYT A;  3SFP A;  5B1U A;  5HH4 A;  1BMC A;  5LS3 A;  3PY6 A;  3IOG A;  3DHA A;  4EYB A;  4D1T A;  1A7T A;  3ZNB A;  5EW0 A;  4D1V A;  1DD6 A;  2I7V A;  1HLK A;  4EY2 A;  4J5F A;  1YCG A;  2ZO4 A;  2GMN A;  3T3O A;  2BGA A;  2P18 A;  5AHO A;  5DPX A;  5K4K A;  3ZR9 A;  2WYL A;  1JJT A;  4NQ5 A;  5EVD A;  4F6Z A;  1X8I A;  3IE0 A;  4RL0 A;  2ZZI A;  3PY5 A;  5ACP A;  1ZNB A;  4O98 A;  4V0H A;  5A87 A;  4AX0 B;  4RL2 A;  3SPU A;  2BIB A;  1X8G A;  4AWZ A;  1DXK A;  1K07 A;  2YNW A;  1WUP A;  4J5H A;  3BK2 A;  3S0Z A;  5A0T A;  4HL1 A;  4XWT A;  5EHT A;  4YSL A;  1WW1 A;  3F9O A;  4Z7R A;  4ZNB A;  2DOO A;  2AIO A;  4C1C A;  2BG8 B;  4Z6X A;  1VGN A;  4ZO2 A;  1DDK A;  2FM6 A;  2BMI A; 
#chains in the Genus database with same CATH topology
 5KIK A;  4DIL A;  2QDT A;  2NZF A;  2BFL A;  2YNT B;  1ZKP A;  2XR1 A;  5HIQ A;  4TZF A;  3KNR A;  4H0D A;  2YCB A;  2BFZ B;  4RAW A;  2A7M A;  2UYX A;  4C1F A;  5LCA A;  4UA4 A;  3X2Z A;  2OHJ A;  4C1D A;  4UWO B;  1KR3 A;  2YZ3 A;  5HIP A;  3BC2 A;  3BK1 A;  5FQC A;  4Z60 A;  5IQK A;  4TZE A;  5LLD A;  2QJS A;  2YNU A;  3AF6 A;  3H3E A;  4WD6 A;  3PG4 A;  5ACW A;  3SBL A;  2BG2 A;  5HH5 A;  5K0W A;  1VJN A;  5AHR A;  5EVK A;  1KO2 A;  1M2X A;  4PDX A;  4C1H A;  4FR7 A;  4Z67 A;  2OHH A;  2GCU A;  4AWY B;  4C1G A;  1BC2 A;  5LCH A;  4AXH A;  2BG6 A;  5LM6 A;  5EV8 A;  4F6H A;  3Q6V A;  3IDZ A;  5HIS A;  5LSC A;  3X2X A;  1ZTC A;  1KO3 A;  1SML A;  1X8H A;  2CG3 A;  3MD7 A;  2GFJ A;  2AZ4 A;  2DKF A;  2FU7 A;  3LVZ A;  4AV7 A;  4P62 A;  2XF4 A;  5A5Z A;  3ESH A;  2R2D A;  3RKK A;  2FHX A;  5K4N A;  1YCF A;  4D02 A;  1BVT A;  4UWR B;  4TZB A;  3I14 A;  4Z5Y A;  3I15 A;  4NQ4 A;  3VPE A;  5FQA A;  4BZ3 A;  3I0V A;  5AJL A;  1A8T A;  3SD9 A;  2Y8A A;  4RM5 A;  5B15 A;  3KL7 A;  1YCH A;  3DHB A;  2Q9U A;  3RKJ A;  2CBN A;  3T9M A;  5EH9 A;  4PVO A;  4YSK A;  2P97 A;  5ACV A;  4RAM A;  3IE2 A;  3BV6 A;  5AXR A;  2Y8B A;  4FEK A;  4Z5Z A;  2NXA A;  1VME A;  1WUO A;  1QH5 A;  3I13 A;  4NQ6 A;  2FU6 A;  2NYP A;  5ACQ A;  4LE6 A;  5EVB A;  4UWS B;  2CFU A;  5KIL A;  2YNV A;  4TYF A;  4KEP A;  4GYQ A;  5ACR A;  5A0V A;  2BC2 A;  3IE1 A;  3R2U A;  5HIO A;  4CHL A;  4EYL A;  5LMC A;  3AF5 A;  2Q0J A;  2Y87 A;  2WRS A;  5HH6 A;  2HB9 A;  2VW8 A;  4NQ2 A;  3FAI A;  4EFZ A;  4AX1 B;  4YSB A;  3AJ3 A;  3QH8 A;  3A4Y A;  2P4Z A;  4RBS A;  4ZO3 A;  4KEQ A;  2OHI A;  3L6N A;  4JO0 A;  3X2Y A;  2I7X A;  2WYM C;  4BP0 A;  5ACU A;  2P1E A;  3VQZ A;  1WRA A;  3SW3 A;  4ZEJ A;  3X30 A;  3G1P A;  4PVT A;  2BG7 A;  4DIK A;  2ZWR A;  2QIN A;  4C1E A;  5LE1 A;  4UAM A;  3WXC A;  2GKL A;  3IEK A;  4EXY A;  5ACX A;  2FHX B;  2WYM A;  3ZQ4 A;  1L9Y A;  3ADR A;  5B3R A;  3IEM A;  1Y44 A;  3I11 A;  2QDS A;  4GYU A;  3KNS A;  2BTN A;  3TP9 A;  3IOF A;  3RPC A;  4UWP B;  3JXP A;  4HKY A;  4C09 A;  4D1U A;  2ZNB A;  1MQO A;  4D1W A;  4EXS A;  2M5D A;  2WHG A;  1XM8 A;  4XUK A;  4GCW A;  4EYF A;  1QH3 A;  3ZWF A;  2Q0I A;  1P9E A;  3SRX A;  4AD9 A;  5AYA A;  2GFK A;  3P2U A;  2CFZ A;  2E7Y A;  5A23 A;  4HL2 A;  2M5C A;  2BG8 A;  2FU8 A;  4TZ9 A;  2H6A A;  1XTO A;  3IEL A;  5EWA A;  4XWW A;  4FSB A;  5FQB A;  2BFK A;  4UBQ A;  5AXO A;  5LCF A;  2YNT A;  3DH8 A;  5K4M A;  2YNV B;  2FK6 A;  2I7T A;  2FU9 A;  2NZE A;  2BR6 A;  5ACS A;  4U4L A;  3DHC A;  2BFZ A;  1E5D A;  5EV6 A;  1JT1 A;  3FCZ A;  2QED A;  5ACT A;  1JJE A;  2Q42 A;  3T3N A;  5AEB A;  4B87 A;  4TYT A;  3SFP A;  5B1U A;  5HH4 A;  1BMC A;  5LS3 A;  3PY6 A;  3IOG A;  3DHA A;  4EYB A;  4D1T A;  1A7T A;  3ZNB A;  5EW0 A;  4D1V A;  1DD6 A;  2I7V A;  1HLK A;  4EY2 A;  4J5F A;  1YCG A;  2ZO4 A;  2GMN A;  3T3O A;  2BGA A;  2P18 A;  5AHO A;  5AIJ A;  5DPX A;  5K4K A;  3ZR9 A;  2WYL A;  1JJT A;  4NQ5 A;  5EVD A;  4F6Z A;  1X8I A;  3IE0 A;  4RL0 A;  2ZZI A;  3PY5 A;  5ACP A;  1ZNB A;  4O98 A;  4V0H A;  5A87 A;  4AX0 B;  4RL2 A;  3SPU A;  2BIB A;  1X8G A;  4AWZ A;  1DXK A;  1K07 A;  2YNW A;  1WUP A;  4J5H A;  3BK2 A;  3S0Z A;  5A0T A;  4HL1 A;  2CG2 A;  4XWT A;  5EHT A;  2YHE A;  4YSL A;  4NUR A;  1WW1 A;  3F9O A;  4Z7R A;  4ZNB A;  2DOO A;  2AIO A;  4C1C A;  2BG8 B;  4Z6X A;  1VGN A;  4ZO2 A;  1DDK A;  2FM6 A;  2BMI A; 
#chains in the Genus database with same CATH homology
 5KIK A;  4DIL A;  2QDT A;  2NZF A;  2BFL A;  2YNT B;  1ZKP A;  2XR1 A;  5HIQ A;  4TZF A;  3KNR A;  4H0D A;  2YCB A;  2BFZ B;  4RAW A;  2A7M A;  2UYX A;  4C1F A;  5LCA A;  4UA4 A;  3X2Z A;  2OHJ A;  4C1D A;  4UWO B;  1KR3 A;  2YZ3 A;  5HIP A;  3BC2 A;  3BK1 A;  5FQC A;  4Z60 A;  5IQK A;  4TZE A;  5LLD A;  2QJS A;  2YNU A;  3AF6 A;  3H3E A;  4WD6 A;  3PG4 A;  5ACW A;  3SBL A;  2BG2 A;  5HH5 A;  5K0W A;  1VJN A;  5AHR A;  5EVK A;  1KO2 A;  1M2X A;  4C1H A;  4FR7 A;  4Z67 A;  2OHH A;  2GCU A;  4AWY B;  4C1G A;  1BC2 A;  5LCH A;  2BG6 A;  5LM6 A;  5EV8 A;  4F6H A;  3Q6V A;  3IDZ A;  5HIS A;  5LSC A;  3X2X A;  1ZTC A;  1KO3 A;  1SML A;  1X8H A;  3MD7 A;  2GFJ A;  2AZ4 A;  2DKF A;  2FU7 A;  3LVZ A;  4P62 A;  2XF4 A;  5A5Z A;  3ESH A;  2R2D A;  3RKK A;  2FHX A;  5K4N A;  1YCF A;  4D02 A;  1BVT A;  4UWR B;  4TZB A;  3I14 A;  4Z5Y A;  3I15 A;  4NQ4 A;  3VPE A;  5FQA A;  4BZ3 A;  3I0V A;  1A8T A;  3SD9 A;  2Y8A A;  4RM5 A;  5B15 A;  3KL7 A;  1YCH A;  3DHB A;  2Q9U A;  3RKJ A;  2CBN A;  3T9M A;  5EH9 A;  4PVO A;  4YSK A;  2P97 A;  5ACV A;  4RAM A;  3IE2 A;  3BV6 A;  5AXR A;  2Y8B A;  4FEK A;  4Z5Z A;  2NXA A;  1VME A;  1WUO A;  1QH5 A;  3I13 A;  4NQ6 A;  2FU6 A;  2NYP A;  5ACQ A;  4LE6 A;  5EVB A;  4UWS B;  5KIL A;  2YNV A;  4TYF A;  4KEP A;  4GYQ A;  5ACR A;  5A0V A;  2BC2 A;  3IE1 A;  3R2U A;  5HIO A;  4CHL A;  4EYL A;  5LMC A;  3AF5 A;  2Q0J A;  2Y87 A;  2WRS A;  5HH6 A;  2HB9 A;  2VW8 A;  4NQ2 A;  3FAI A;  4EFZ A;  4AX1 B;  4YSB A;  3AJ3 A;  3QH8 A;  3A4Y A;  2P4Z A;  4RBS A;  4ZO3 A;  4KEQ A;  2OHI A;  3L6N A;  4JO0 A;  3X2Y A;  2I7X A;  2WYM C;  4BP0 A;  5ACU A;  2P1E A;  3VQZ A;  1WRA A;  3SW3 A;  4ZEJ A;  3X30 A;  3G1P A;  4PVT A;  2BG7 A;  4DIK A;  2ZWR A;  2QIN A;  4C1E A;  5LE1 A;  4UAM A;  3WXC A;  2GKL A;  3IEK A;  4EXY A;  5ACX A;  2FHX B;  2WYM A;  3ZQ4 A;  1L9Y A;  3ADR A;  5B3R A;  3IEM A;  1Y44 A;  3I11 A;  2QDS A;  4GYU A;  3KNS A;  2BTN A;  3TP9 A;  3IOF A;  3RPC A;  4UWP B;  3JXP A;  4HKY A;  4C09 A;  4D1U A;  2ZNB A;  1MQO A;  4D1W A;  4EXS A;  2M5D A;  2WHG A;  1XM8 A;  4XUK A;  4GCW A;  4EYF A;  1QH3 A;  3ZWF A;  2Q0I A;  1P9E A;  3SRX A;  4AD9 A;  5AYA A;  2GFK A;  3P2U A;  2E7Y A;  4HL2 A;  2M5C A;  2BG8 A;  2FU8 A;  4TZ9 A;  2H6A A;  1XTO A;  3IEL A;  5EWA A;  4XWW A;  4FSB A;  5FQB A;  2BFK A;  4UBQ A;  5AXO A;  5LCF A;  2YNT A;  3DH8 A;  5K4M A;  2YNV B;  2FK6 A;  2I7T A;  2FU9 A;  2NZE A;  2BR6 A;  5ACS A;  4U4L A;  3DHC A;  2BFZ A;  1E5D A;  5EV6 A;  1JT1 A;  3FCZ A;  2QED A;  5ACT A;  1JJE A;  2Q42 A;  3T3N A;  5AEB A;  4B87 A;  4TYT A;  3SFP A;  5B1U A;  5HH4 A;  1BMC A;  5LS3 A;  3PY6 A;  3IOG A;  3DHA A;  4EYB A;  4D1T A;  1A7T A;  3ZNB A;  5EW0 A;  4D1V A;  1DD6 A;  2I7V A;  1HLK A;  4EY2 A;  4J5F A;  1YCG A;  2ZO4 A;  2GMN A;  3T3O A;  2BGA A;  2P18 A;  5AHO A;  5DPX A;  5K4K A;  3ZR9 A;  2WYL A;  1JJT A;  4NQ5 A;  5EVD A;  4F6Z A;  1X8I A;  3IE0 A;  4RL0 A;  2ZZI A;  3PY5 A;  5ACP A;  1ZNB A;  4O98 A;  4V0H A;  5A87 A;  4AX0 B;  4RL2 A;  3SPU A;  2BIB A;  1X8G A;  4AWZ A;  1DXK A;  1K07 A;  2YNW A;  1WUP A;  4J5H A;  3BK2 A;  3S0Z A;  5A0T A;  4HL1 A;  4XWT A;  5EHT A;  4YSL A;  1WW1 A;  3F9O A;  4Z7R A;  4ZNB A;  2DOO A;  2AIO A;  4C1C A;  2BG8 B;  4Z6X A;  1VGN A;  4ZO2 A;  1DDK A;  2FM6 A;  2BMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...