5AHOA

Crystal structure of human 5' exonuclease apollo
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
314
structure length
314
Chain Sequence
SMNGVLIPHTPIAVDFWSLRRAGTARLFFLSHMHSDHTVGLSSTWARPLYCSPITAHLLHRHLQVSKQWIQALEVGESHVLPLDEIGQETMTVTLLDANHCPGSVMFLFEGYFGTILYTGDFRYTPSMLKEPALTLGKQIHTLYLDNTNCNPALVLPSRQEAAHQIVQLIRKHPQHNIKIGLYSLGKESLLEQLALEFQTWVVLSPRRLELVQLLGLADVFTVEEKAGRIHAVDHMEICHSNMLRWNQTHPTIAILPTSRKIHSSHPDIHVIPYSDHSSYSELRAFVAALKPCQVVPIVSRRPCGGFQDSLSPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5' EXONUCLEASE APOLLO
publication title The Structures of the Snm1A and Snm1B/Apollo Nuclease Domains Reveal a Potential Basis for Their Distinct DNA Processing Activities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 87
structure length 314
sequence length 314
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07522 DRMBL DNA repair metallo-beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12650 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5ahoA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5ahoA01
1KO2A 4RL2A 2H6AA 4D1TA 1VJNA 2YZ3A 3BK1A 5LM6A 2NZEA 4C1HA 3RPCA 5EV6A 4FSBA 2XR1A 2R2DA 1WUPA 3IELA 5K0WA 2AZ4A 3Q6VA 5EWAA 4TZBA 5ACXA 3DHAA 2VW8A 2NZFA 4F6HA 3I14A 4EYFA 2M5CA 1YCFA 5HH6A 4AD9A 3BC2A 4GCWA 2M5DA 2I7TA 3AF5A 2ZZIA 2WYMA 2YNVA 2WRSA 3DHBA 1ZTCA 4C1FA 3SD9A 5EV8A 2ZO4A 2FU9A 5LE1A 4DIKA 4RAMA 5LMCA 2DOOA 4XWTA 4NQ4A 2FU8A 3X30A 2UYXA 2OHHA 3AF6A 1DXKA 5IQKA 5ACTA 3PY5A 2QDSA 3RKKA 2NXAA 4EXSA 2Q42A 1K07A 1WRAA 3IOGA 5AYAA 2GFJA 5EVKA 5AXRA 4ZNBA 3T3OA 5AEBA 2A7MA 3I11A 3IDZA 5LS3A 4EFZA 3A4YA 3SW3A 2BFLA 5KILA 3I0VA 1KR3A 1DD6A 3AJ3A 4D02A 2BFZA 1E5DA 2YCBA 3PG4A 1QH5A 3DHCA 3T9MA 2BR6A 3FCZA 4HKYA 5HIPA 3I13A 4PVOA 3SBLA 2FU6A 4EXYA 4YSKA 3PY6A 1DDKA 2BG8B 3SRXA 4ZO3A 3IE1A 4AWZA 4HL1A 3BK2A 4AWYB 2QJSA 3FAIA 3X2XA 3F9OA 3MD7A 2BG7A 4RM5A 5ACRA 2YNTB 4Z7RA 4B87A 2YNVB 4C1EA 5LCHA 3IOFA 2Y8BA 1SMLA 5EHTA 5LSCA 1ZNBA 2BTNA 3IEKA 4F6ZA 5ACWA 1VMEA 4TZEA 3ZNBA 2WYMC 4D1UA 1XM8A 5AHRA 5B15A 4ZEJA 1BVTA 2YNWA 1A8TA 5FQBA 5K4KA 2BMIA 2DKFA 5EVBA 1Y44A 4D1WA 4WD6A 4KEPA 5ACUA 1QH3A 3R2UA 4NQ2A 4O98A 4TYFA 5ACQA 3T3NA 4UA4A 3P2UA 4XWWA 2Q0JA 1L9YA 1A7TA 5KIKA 4NQ5A 3IE2A 4ZO2A 3ADRA 3SFPA 5HH4A 2WHGA 2GFKA 4UWRB 1MQOA 2XF4A 2YNUA 4V0HA 3KL7A 4TYTA 2P18A 4C1DA 2E7YA 3VQZA 5LCFA 4EYLA 5HIQA 4YSBA 1ZKPA 4C1GA 5FQCA 1JJTA 5EH9A 5K4MA 4H0DA 3G1PA 2FHXA 4LE6A 4Z60A 5B3RA 4UWPB 2P4ZA 5A87A 5ACSA 3ZWFA 2WYLA 5K4NA 5ACPA 5DPXA 5EVDA 1XTOA 3WXCA 4EY2A 4RL0A 2CBNA 4Z5YA 3SPUA 3ZQ4A 4BZ3A 2Y8AA 2FU7A 2I7XA 3JXPA 3QH8A 2GKLA 4GYUA 4XUKA 4NQ6A 1KO3A 2FM6A 5FQAA 5AXOA 5EW0A 4J5FA 1BC2A 4BP0A 4PVTA 4GYQA 4Z5ZA 3L6NA 4HL2A 1WUOA 4RAWA 5HH5A 3VPEA 3KNRA 2BG8A 5LCAA 5A0VA 3IE0A 3X2ZA 1YCGA 2OHJA 4UWSB 1X8GA 4KEQA 4Z67A 4JO0A 5B1UA 2GMNA 5A5ZA 2YNTA 2QINA 1X8HA 2QEDA 4Z6XA 3ZR9A 1BMCA 2FK6A 3DH8A 4CHLA 4AX0B 2OHIA 4RBSA 5HIOA 1M2XA 2BIBA 3KNSA 2QDTA 4J5HA 5ACVA 2BC2A 3ESHA 3H3EA 4FR7A 4EYBA 2BGAA 3LVZA 4AX1B 2BFZB 4UWOB 2ZWRA 5AHOA 3BV6A 5HISA 2FHXB 2P1EA 1YCHA 2AIOA 1P9EA 2I7VA 4TZ9A 2NYPA 3S0ZA 5LLDA 2BG6A 4DILA 2BG2A 4YSLA 1JJEA 2ZNBA 2P97A 3X2YA 2HB9A 2BFKA 4TZFA 1VGNA 2Q0IA 3TP9A 4C1CA 4UAMA 2GCUA 4C09A 1JT1A 3RKJA 1X8IA 3IEMA 4D1VA 5A0TA 3I15A 2Y87A 4U4LA 4FEKA 2Q9UA 1WW1A 4UBQA 4P62A 1HLKA
chains in the Genus database with same CATH superfamily
1KO2A 2J5XA 1W47A 3MRVA 3O9ZA 1MDBA 1NRXA 3UAWA 4B33A 3WRVA 5ITZA 7MHTA 5KSYA 3KPJA 4NYJR 4YXFA 5LM3A 4Y2YA 4A16A 3RPCA 3I1YA 3TZCA 3VHQA 1X94A 1G8FA 2XR1A 4O2AF 3EVZA 1QPZA 4QDUA 2V97A 2GPJA 5GZ1A 2P27A 1X8KA 5LOVA 4DDWA 4FOPA 2GEDA 1QU2A 2AZ4A 3SGLA 1FLAA 1DIOB 1WZIA 2P40A 4ZVUA 1A1VA 1J2JA 2GHIA 2OYCA 1JALA 2VSNA 3LK7A 5CT9A 2QDKA 4J91A 4CTKA 3KE8A 1QR2A 4YC7A 4EJ0A 2KSQA 5I7HA 4AYWA 3A10A 2XRZA 5DK4A 5HF9A 3ZWNA 1YHNA 3HC7A 1H2WA 1CUBA 1KC1A 3FHOA 2DKOA 3ECCA 1RKXA 2AC7A 2WYVA 3HQ4O 4PG4A 2B8WA 3QWAA 4F6HA 1I24A 3M5CA 1EBUA 5GPBA 4HATA 3NDJA 3GZJA 3Q3VA 4AB1A 1FBNA 3N9IA 3AILA 3G9TA 1KBOA 3SNKA 2ZZIA 1KYVA 1FX0A 3JARB 4MQFB 3H1FA 2RAUA 1RSZA 4BZQA 4DEXA 4UMEA 5ES3A 3AVTA 2O8CA 1PR0A 2A0KA 3HU3A 4MV7A 4R31A 1O5TA 5JHGB 4DQ0A 3UJ3X 3HYCA 2B83A 3ZDAA 2VQEB 1G64A 3GT4A 3D0RA 4RUKA 1S7GA 1UKVY 3LDGA 1D4AA 5ELMA 5B6JA 4X90A 2XQFA 3NHKA 5LZ9A 2XXAB 3HHEA 4W7SA 1KOGA 4JT9A 1F3OA 1MT3A 5AJYA 3A7DA 4JOQA 4RD0A 1KTIA 2OWDA 3RU9A 2AMLA 3MJHA 2PDAA 1RXUA 3AZQA 4HJRA 1JU4A 3HKCB 4GYWA 2C7GA 4KO3S 1ZCBA 4YACA 4D3XA 1CEQA 1IBCA 4GVPA 4P8RA 1NSYA 3OLXA 2X6RA 4JLSA 1FQOA 1UJ2A 3V9AA 4QZVA 5C5CA 4IXWA 4JI6B 3RODA 2IUSA 4UC0A 3L7OA 4IQ8A 3SLRA 4OB7A 4YMUA 3C5CA 5F7XA 3ZDRA 1JVBA 5JJCA 3UW1A 1HNWB 1GARA 2IK8A 5FQNA 1P7PA 5IJZA 3MJRA 5D3QA 4ZTBA 1K8ZB 1KARA 2YWHA 1WSBA 2EL7A 4X60A 4KDEA 1XELA 4ZYYA 2HLDA 2XIQA 2VNIA 4M9RA 3DOHA 3AF6A 3WAJA 1DXKA 4TLBA 4X62B 5IQKA 4A0RA 2CDNA 1DKUA 4XAQA 5FUQA 2IPMA 5T4BA 2NXAA 3E5RA 4Y30A 2P9GA 4NE9A 1IM5A 1I51A 3W6OA 4HRVA 5REQB 3GRKA 1S2MA 3B7PA 3SSMA 3MWGA 4AVYA 4IF4A 3OEED 4DNPA 5JXHA 1G2OA 2BEVA 3GJSA 4RTLA 4M83A 2YOHA 2PJRA 3NRJA 5HR5A 2X5JO 3HKBA 2OQVA 3I61A 2OKCA 2K7FA 1EK0A 1G21E 3MTDA 4BEVA 3LHDA 2VSOA 4X63A 4Y0VA 3UF0A 3ORHA 1GAXA 4FK8A 4Q9IA 2GCNA 2JJ8A 3T1HB 4JD5A 1PJLA 2Q3MA 3EUFA 4BX3A 3I0VA 4XVUA 1P4HA 4ALNA 4KLAA 2VF8A 2JCBA 3HRIA 2A9FA 2BKUA 3H4VA 1W30A 3L07A 4XQ9A 4HV4A 3QYFA 3OIGA 1BD3A 2DPMA 3B89A 3PV0A 5AVJA 5I48A 3HCWA 3I9MA 2DB3A 3OD5A 1PJAA 3O38A 3PLRA 2PT7A 5HQ3A 1DQSA 1DJOA 1Z4OA 2PUGA 5F9MA 3WWCA 4RMJA 3S1LA 3AHDA 4D9MA 2JLVA 1WF6A 2AW5A 2ABWA 3H3JA 3WSVA 2M32A 1XKTA 2JVJA 3UG6A 2WJ3A 4Q9KA 3W2TA 3L7BA 4B46A 5JJ5A 2EFDB 1RHKA 1E1QD 3KXKA 4OQYA 5DTQA 4ARZB 2VTDA 3A6ZA 3BXGA 3VTAA 1JAYA 2C57A 1U5CA 4IWXA 3U49A 4C5CA 2WLTA 1SK9A 2XX3A 2C95A 2ZI9A 3NONA 3QWBA 3UHPA 3VR6A 2O7RA 2D2EA 4YSKA 4P81A 3KPUA 4HFJA 4MGYR 4H35A 4C6TA 3RYIB 2PT6A 3DM5A 1V5FA 2M1XA 4K3VA 3ZQ6A 4KRFA 2BBOA 1KS2A 1Z36A 4PFSA 5FPHA 2E4YA 2YZ7A 4BNKA 3SKXA 1NF2A 4AZ3A 2P90A 2FZVA 2JHGA 1C1HA 2XD9A 3Q9UA 4FCTA 4OP2A 3V7FA 3K9BA 5DWDA 2VPQA 3VC7A 4CKBB 1AZTA 2W2LA 2G7ZA 1AKRA 5EL0A 3RRJA 5L4LA 3Q9NA 4AWZA 4GNKA 1UANA 3ITNA 5B4UA 1B8VA 2AOTA 2JGEA 1LPBB 4U1RA 4I4NA 4NZOA 3S28A 4EMBA 1XTSA 3UN1A 4IKPA 3T7EA 2XGSA 2G72A 3K09C 2VJDA 4HFRA 5EFOA 3T41A 2JHFA 3A6FA 2VDWA 5CD9A 1XG5A 4JU8A 4ODIA 1BXGA 1DQRA 1FDWA 3WKCA 1KVRA 1M8GA 1N5OX 1YFJA 2WAOA 3QNWA 3VUEA 3MS7A 5F7ZA 5LD2B 1M5RA 2ZUEA 4DLRA 4LJKA 1OX4B 3RR2A 2B98A 2P9JA 3HSYA 1ISPA 1KIAA 2EQBA 1ADCA 5GWXA 5J2TB 2YWRA 5F2KA 5TQJA 1WZNA 2D74A 4RK5A 1W34A 1XTPA 2G1JA 4ZICA 1NZFA 3FIJA 3FZNA 3HU1A 3OPQA 5A9TA 5B2EA 3KYCA 5GTDA 5JCZA 4BZPA 3IEKA 5ACWA 1HSZA 1P1KA 2NSYA 1HPLA 2VDQB 1F0YA 3IBCA 4OG2A 3HVJA 4WIAA 4D41A 1MX3A 3BA6A 4LYHA 1OU4A 2NQTA 4K6FA 4REQB 5DGDA 5GJCA 3ZHTA 1U0SY 1YB6A 3DAYA 4RE5A 1C9DB 2JGAA 4FC7A 3DBRA 2C0PA 2R1TB 3MB8A 4HS4A 4KLNA 4L7VA 4PBSA 4X1KB 4JDPA 2P3LA 4K9OA 1M74A 3PEFA 2FWIA 1FSGA 1GLVA 2Q2WA 2QLNA 1FFAA 2ZJZA 4KRGA 4OXYA 5FQBA 1SQGA 3C4VA 1J6UA 1XDDA 1KJZA 2HPVA 2IPOA 3EIXA 5FEUA 3DLPX 5T57A 4EJSC 1N9KA 1ZUWA 4DREA 2WOJA 2YWJA 2VK1A 3F4KA 3PC3A 1C3OA 3OEHA 1Y4ZA 2XLCA 1GL9B 3I4CA 3S1AA 3SOPA 4DLSA 4FGJA 2GDZA 2J59A 3D7MA 3WR5A 4XEHA 4R7ZA 4DG5A 2JZNA 5C8YB 3TCKA 1G1AA 3VI4B 1UXIA 4YR7A 1DTSA 1M1ZA 4QPPA 3HPRA 2DHQA 5EJ8A 1CP3A 2ZRKA 4GYYA 5AW6A 5J4KA 4YH1A 1YR7A 2EERA 4OI0A 5F52A 3T1NA 2O8DB 4EZEA 4LEIA 3Q10A 2XKJE 5KOYA 4EHHA 2D0DA 5DSZA 4GKKB 3ANLA 2QG6A 1D2MA 4PRYA 5T6MA 4BQFA 2INGX 4L27A 1ZA1A 4TS3A 2OY0A 3U3OA 1JEQA 1GPYA 1DOHA 1RRKA 1ZM3A 2IDJA 3LBNA 3AF1A 1NT2A 2GAIA 1NNUA 2QTNA 3FAZA 4PONA 3CTPA 3S4YA 3CF0A 5E7QA 4FWTA 3QI2A 5JQWA 2JKYA 4IG4A 1CNEA 1JYEA 3SKYA 4B7UA 3OO0A 3FPAA 4YT4A 3DMHA 4X54A 3K9GA 2VTBB 3DO6A 4QNNA 4C2BA 1XYVA 5KWSA 2XTNA 2Y99A 4K40A 1XCJA 4LVUA 1HE8B 4BNZA 4E13A 1E2FA 2QV7A 5BR1A 4QG3A 4XRRA 4U9UA 3UFXA 1NRWA 2OKGA 4IO0A 3UK1A 1FQWA 1T3ZA 3OOJA 2P9FA 1A2QA 2C9BA 4OHFA 1S1MA 5CLLA 3K35A 4IG9A 4MR7B 4NESA 4EYOA 1CRPA 2E7YA 4DR6B 2NVUB 1K6IA 4N49A 4NURA 5COAA 4XOUA 3KUDA 4OH7A 3S2YA 3K70C 2YRFA 4FJ1A 3ZGLA 1PUXA 2Q0QA 2LP4Y 4KYIB 3U4DA 2B9EA 4L72A 3J81k 5EHNA 3HEBA 4HDRA 2PD3A 2O5EA 1OLUA 1SHJA 2PYDA 3CV3A 3OLYA 4OSPA 5B1IA 4M9UA 1ZKDA 3U48A 3BTSA 5H3CA 1G5TA 4D82A 2HLPA 4G01B 2DXIA 4NHEA 5JMWA 1YWGO 2BTQB 1OXVA 1W0KD 4IUDS 2FWMX 5IT5A 3ZDCA 5AIJA 2GCOB 1H2YA 2RBEA 1GUZA 1GTSA 1WKCA 1MQ8B 1A4IA 1V0JA 3I0NA 5LLSA 4G41A 2ZIGA 2PRSA 3CNLA 3U7EB 1HYEA 4DY6A 3FKSA 3JZAA 2DYKA 4J4TA 4DMUB 6NULA 4G5QA 3I5MA 3KSMA 2HEGA 5CW1A 3RIYA 5B37A 2IBTA 3KQYA 2IEZA 2BZGA 4HEA1 4ZYUA 3DD1A 1P2SA 5FF9A 3AF4A 1DKNA 2Q5EA 1I3CA 2I2DA 2O20A 2QRMA 4LRYA 3PXUA 5GOZA 3FYCA 1RFLA 5BPHA 2G80A 4FZVA 2AR7A 5JMPA 3F47A 3KKLA 2JIQA 4C1BA 4YCLA 1EP1B 1UOEA 2B3DA 2BTOA 3QH8A 4TV9A 5BW4A 2JCVA 1TM5E 3TZHA 3CWQA 3P97A 4WSOA 2C88A 3V4RA 4YYEA 5ISMA 4CFYA 2CHEA 5CVDA 4B6EA 3D3EA 3VKHA 1GT91 1E2IA 3NHPA 2ZJ3A 2WQ6A 2FM6A 5FQAA 5KWIA 1KI3A 2GJSA 4WOKA 1QG0A 5CHYA 2DEUA 2VG8A 3U2QA 1Q2UA 3O84A 1YS1X 2V5UA 3SD7A 4DCGA 4TKZA 5AJLA 4QUGA 4WLNA 3FUWA 3OZUA 2QVYX 4IGFA 3L6NA 5CITA 3COPA 5IEJA 1UF9A 3LBHA 4X66B 2Y2VA 3RARA 3T9AA 1Z4LA 2GI4A 3ASYA 1SBCA 4GQIA 3B51X 4GRIA 4H77A 4RLFA 2V1UA 4MWEA 3TQCA 5CJJA 3RJTA 1UPXA 1HFEL 2JD2A 3W1EA 3QEKA 3AONB 2C2GA 1OTXA 8ADHA 4E94A 1QJ4A 1YCGA 3B53X 5K3FA 1OYVA 1RJ9A 1WXFA 4EG0A 1UJBA 2O4UX 2X1VA 2WKRA 3KAJA 4AUNA 4D9KA 3PUWA 4QDXA 3ZR4B 4A27A 3NIDB 4DR1B 4ZMBA 4YY3B 1Z08A 5KNDA 2NX2A 6GPBA 4BJ1A 2ODTX 1P6XA 4KAFA 4WINA 1MC8A 3LXUX 3ZLTA 1OA1A 2OA0A 1M9NA 4EVRA 5CDHA 1K5GA 4QTUB 3F6RA 1U8CB 2XOEA 4WCFB 2JS7A 3M1AA 1KRWA 3KAQA 1SFRA 3KL4A 2WKWA 4QVKA 5CVUA 4HLNA 3RAFC 5BT8A 4BFUA 3PQDA 5TV2A 4BJ6A 4DKXA 1GA1A 5HX7A 1XRNA 1QP4A 5FI0B 1OVGA 3QLEA 2W5UA 2Y1KA 3X1MA 3NBUA 1BVRA 3WB0A 3E22A 4MWSA 5I9BA 1XTUA 4OUDB 1GKLA 3FVTA 2L17A 4LFAB 4NIMA 1Z15A 2R6GA 2N1BA 3DXYA 3LVBA 3N86A 3PIIA 4GC5A 4EG6A 1XTKA 1I4DD 3MT9A 4WBNB 2A35A 2YZKA 4XLZA 4TVKA 1ZUD1 4NPCA 3BFPA 3QEOA 1L4YA 2HMSA 2FQQA 1QYDA 3E3AA 3SC3A 5TQ0A 2BUCA 3D4LA 4AJNA 1JHRA 2YUIA 5EN4A 1P4RA 3SFTA 3EGCA 3X1YA 2MCFA 5CM8B 3AKYA 4OJQA 4OMFG 1LQTA 2QT9A 4MWZA 1UBSB 1KMHB 2H1OA 4CMEC 4NBNA 1JQ5A 3BD9A 2J3IA 3IDQA 1DP4A 3LBAA 1FU7A 1L5WA 3MGBA 3V00A 3ZNPA 5HISA 4N39A 5ALOA 1RJFA 5A3VA 1J25A 2FP3A 3G1WA 2ZWIA 1UPUA 2EQ5A 5FWDA 5HFNA 1I2DA 5HTOA 3T3HA 1ZBDA 2V3CC 2WDZA 4CM4A 5JEEA 2RMKA 2B92A 3GEIA 3KR0A 4IIEA 4Q9HA 2JNWA 1BA3A 2WM2A 4UZSA 5BMVB 1NVKA 3WAGA 2VNJA 2Q6LA 4I4TB 2H4WA 1P2GA 1YQGA 2I6TA 2YWEA 3D59A 3VNQA 3CUEF 1I36A 3WIDA 1IM8A 3CBGA 1UZNA 1U3CA 2BSAA 1YDEA 4DV7B 3RYHA 2IELA 3JPYA 3ZWVA 3NPMA 3JQRA 4YAEA 2JJ2A 1ACLA 4IYJA 2YY5A 5LXTF 2V6GA 2OFPA 4JJIA 5KYVA 2Z08A 3NANA 3NM4A 1CY4A 4DA8A 4MW9A 1GNPA 1YL6A 3PQFA 4M8SA 4RHFA 3UT0A 3H1EA 3UHJA 1TQ4A 2JGDA 4Q47A 3D2AA 5EXTA 5ALSA 4RBNA 5ICFA 2OL4A 1Q0SA 3VU8A 1ZWKA 2FX5A 3E3MA 3PVSA 3A1CA 1K27A 3NHBA 3ASZA 4JL5A 3GXOA 3NBQA 5ALNA 3BMQB 1YA4A 3GYBA 3SVTA 1LNQA 1QGOA 3WP0A 4UW9A 2RONA 1TQ6A 3ZWXA 2PR2A 5EW0A 1WJGA 3QTBA 4CUJA 5EMNA 3CEAA 4XCQA 3N8HA 1CB7A 3LYLA 3M8KA 4II2A 2Z83A 2HHHB 1VXRA 2WHPB 4RMNA 1IBKB 4N47A 3HV2A 4EOGA 3TTUA 3MMNA 1A77A 4FFNA 1X1QA 4ZZ2A 5A4FS 2PWBA 1HY3A 3QMVA 4M8KA 3TD9A 4J0HA 2Q3HA 4KG7A 3HKDA 1F8UA 1V1RA 5FQOA 1DI0A 2CDAA 1RZVA 2C2ZA 3IAS1 4NI5A 5CX4A 3WBKA 3RYFA 4EJMA 5EV6A 1C4OA 1WULS 1KDYA 3E2PA 4RL4A 2B25A 2V7WA 4AKIA 1OWOA 2QJRA 4NJMA 4CIXA 2V6FA 2UYQA 4YQYA 3P9SA 1BCRB 3DEJA 5ALGA 1VP3A 4Q93A 3RYCB 5AVRA 1SBNE 2PANA 3CMCO 3QNUA 4I66A 1Q11A 3NC4A 4P08A 1E2JA 3CCFA 3U7QB 4YJKA 1EDDA 4WCVA 3UAOA 2DULA 4UFPA 2HT1A 1MU0A 2G9RA 3AV0B 5LIPA 1H2EA 1N5MA 2P9ZA 3JU3A 4FYPA 4EI7A 4MKRA 5IHXA 3FTNA 2X58A 2Z1MA 3CVJA 5FUXA 2BFEB 3AHHA 5K8UA 3D2BA 4ISBA 3IV6A 1CJCA 5EWLB 3CTMA 5LIRA 1V39A 2H3HA 2WYMA 1NBMA 2QZPA 5IASA 2W48A 5LJIA 1ZOIA 2A5FA 1RJGA 4M87A 5LBIA 3CF2A 2J45A 4K46A 3NGMA 3LZDA 5K0CA 1I1OA 4KPUB 1WSDA 3A31A 3KTDA 1IZ8A 4L3OA 4MH0R 5KYWB 4LJLA 2ZO4A 2HJSA 3Q4GA 4HDAA 3EVEA 3PLNA 4DIKA 2VYND 2JCSA 2GKSA 4CIVA 4WZAA 4ZYTA 3OLQA 5IAOA 3WL3A 4Y9DA 4QPDA 5LMCA 2H4ZA 4XKJA 2PQ2A 2YN4A 4RS3A 1UBNA 3DHWC 4LZLA 3GBSA 4YRTA 2X0EA 5M29A 4M0FA 2J0UB 3FTFA 1FP4B 1NNSA 3ZGXA 4FILA 1Z7EA 1FRFS 2GN2A 1Q6ZA 2IYFA 1WA5A 2I6QA 3OQJA 4WXRA 3GQVA 4YDRA 4V3BA 2JF0A 4EYKA 1DTWA 5BQPA 3FMOB 4DUZB 4RVHA 4CV1A 3A6KA 2DP4E 3NO4A 2PL1A 4EG3A 3CGWA 3O7MA 1RI5A 2ODWA 3LVRE 3BZWA 3IBGA 4UZFA 4IIJF 4LC9A 3BMOB 1G8PA 2PGOA 4JJKA 3KEFA 5AM5A 3UWMA 4LSMA 3TTVA 5J23A 5DOZA 3SC2A 2Z8YA 4BVKA 4YRNA 2CYBA 2X22A 2PSFA 5FTNA 2R0QC 3WB9A 4TOIA 4LKOA 1NDUA 3UJ6A 1DDOA 1WRAA 3OF2A 5DTRA 1LUAA 1PJBA 4DLVA 5AYAA 1B3BA 1VFNA 1S3IA 2OE2A 3F5FA 1YNOA 5FFFA 4K03A 10MHA 2FX3A 2XW6A 2E9SA 1PR6A 1Y5NA 2ACWA 3K8YA 2A9KA 2YIVX 4BX9A 3GF4A 5BQFA 2EKQA 1WSWA 5BO5A 1RHJA 4JVOA 2GZHA 4XDGA 4YCMA 1KMCA 4GX1A 1Y1QA 3AETA 4QGBA 5CYOA 3K0CC 5KILA 1RRVA 4KHZA 3ZTYA 1Y8RB 1YQXA 2YYAA 3JYNA 8OHMA 4B71A 4KPGA 3OQIB 1D5WA 3AR3A 3IEIA 4IS2A 4NCNA 1YE3A 5KSZA 1M2JA 3E9RA 4NDNE 4LMRA 1AGRA 1R0WA 4EG4A 1OILA 2ZIWB 1HURA 2HIAA 1HWYA 5K3EA 1SCIA 2F3UA 1YR3A 2FQXA 1VJGA 2CLDX 2Y6VA 3GNQA 3QHPA 4R1NA 4YMHA 1XEWX 1YBMA 2IYLD 2VJYA 5KCMA 5IAAA 3T9MA 3OWOA 1GRNA 4HB2A 1JJ7A 1K9SA 4FQ8A 1ORRA 3WIOA 3I13A 4H16A 1MC5A 4CIDA 1S4QA 1TJPB 2C07A 1XZQA 5FYQA 5B1YA 4R05A 1E6WA 1GAEO 4O2AB 5C3UA 1NOJA 1E64A 3IH5A 4MV6A 1Z16A 3KT3A 4B31A 2O19A 1FU8A 1ACJA 2G25A 5EIWA 3F6PA 4ARUA 4H7EA 2QQ0A 4XUCA 4F85A 3KZVA 4XYBA 2Q50A 2J4DA 4Z4EA 4TSFD 2LR0A 2WVHA 2HKIA 3LX5A 4XX0B 2SKDA 2NP7A 4HDMA 1HYQA 5T64A 2VWPA 1T9GR 1PR2A 1Z34A 3GUZA 4NMLA 5EIFA 3T5MA 1W5BA 5EC8A 1PSWA 1SKYB 1BX3A 1ORHA 3GQBA 3O3CA 4WKBA 4YCDA 5LWQA 1D2RA 4W5RA 2FFBA 2W6JD 3KUKA 2XYQA 1SC1A 3KQHA 3B2EA 1H6BA 1MB4A 5IAEA 4BMNA 5BNTA 5LKAA 3DPUA 1M83A 3MILA 2OO5C 3W5IA 4AYTA 4F5ZA 3VNBA 2ZVJA 2BR5A 1L2TA 4H0CA 2CUKA 3SR0A 2FPGB 4AN4A 2BFZB 5KINB 4J8PA 2P75A 3SQLA 3A0UA 4NYIR 5CB6A 3F8TA 4ZAFA 2QP4A 4G8DA 2ACVA 2Z04A 1WBJB 3TLCA 4DR3B 2IDMA 2PY6A 2ZVPX 2QJTA 4JC0A 1SXJB 1MA3A 3WFJA 5CB4A 3TK1A 1FTGA 1IXZA 2FQWA 3HCFA 2H08A 3H1AA 1TO6A 1LH0A 4JBNA 4U2EA 4URVR 3PIDA 4L2IB 3PXEA 5EGSA 1FTSA 2C96A 1L6IA 3PJRA 4LF9B 3B3JA 4XJXA 5DM2A 3QU7A 2A0WA 2WJAA 4S2EA 2D7DA 3NUZA 1UOQA 3AVQA 1AY0A 2G8NA 2VJQA 3HCAA 1KZHA 2XCTB 2UZ3A 3AFIA 4UU8A 3I6YA 4G6ZA 3VI3B 1L4KA 1U2ZA 4MTLA 1HQDA 3HWSA 5AHRA 4YRZA 3EZNA 4ROSA 4KTTE 1ORTA 2LKDA 4MEJA 3A1NA 2SNIE 4Y2QA 2MOKA 2QAGC 3ESQA 4INJA 1D1PA 4EENA 4I5IA 2QIPA 3KL2A 4X8HA 1Z74A 2QTGA 4N5LA 2IKSA 1TTTA 2CXSA 3GN1A 3RC7A 2UYOA 3H19A 4GNRA 4K87A 3VO8A 3LI2A 2CGEA 1UMDA 1H66A 2GGSA 3AFOA 1HT1E 1ECJA 3CEJA 3GN2A 3HO8A 4H3SA 2NVBA 2PGIA 1TE2A 3GB9A 5C9ZA 3O3MB 1NUUA 3B6MA 3N70A 5MN5A 2G08A 2H5JA 4ER3A 4ENPA 4M3NA 4A15A 3GUHA 5BSRA 1PJ3A 4J7CA 1TYDE 5AK6A 4GP6A 4N4AA 1L4EA 2PL9A 1HYGA 4EKGA 3QNMA 3DJYA 2WWYA 4C88A 5ICSA 3U1VA 4FUQA 4DQKA 3LHSA 2AJ8A 3IMCA 1OD6A 2IY7A 1J99A 1JHUA 2I2CA 2XMSA 2Y9MB 1N9GA 2RG7A 2VJOA 5HZGA 4XWWA 5LQUA 4IICA 3HDVA 2IUEA 4GKBA 4GQBA 1OXBB 1V5WA 4JJZA 5GP1A 5L4NA 2QB5A 2WPDA 5TLSA 1UPTA 1N0UA 7ABPA 5J47A 3JSAA 1C3LA 4G1EB 3RJZA 3AUSA 4LNUA 2GVNA 1AGPA 2ONYA 3B20A 3W2EA 5HW0A 2GBIA 4DYVA 2FLWA 4NOLA 4A82A 3SFPA 3EK2A 2JEOA 4KQKA 1HC7A 5SICE 3QSYA 4JSTA 3H11B 4B84A 1MB2A 2O3UA 2YASA 1PWZA 4IF6A 4FFLA 4GOMD 5FP0A 4Y3UA 4P0PB 2ADMA 3DMTA 1XKXA 3ETGA 3ZHBA 1BMFD 3L7YA 4XSVA 5DPMA 4NS1A 1FYWA 3BRWA 3B78A 3E48A 1L7EA 1YF3A 1V8ZA 1AIPA 2BHTA 3IUBA 4DW8A 5IZCA 3EIEA 3MN1A 5DISB 4MEAA 1JHQA 2BR3A 1ZIPA 3R3ZA 3ABQB 4QLBA 1RNLA 1TM4E 3F4LA 2R9VA 3Q3IA 4MDEA 1JAHA 2M1ZA 3MJVA 4QU8A 3DPSA 2VZLA 5EIOA 1CERA 3IAEA 1GYRA 2XE7A 3GLHA 2J09A 3O73A 2D2FA 4QGGA 4TV8F 4CEIB 4HSGA 4DNXA 3VU3A 1N2SA 1P9NA 4I8DA 4DBLE 1PE0A 4JHLA 5AVXA 1QH8B 1U3GA 1VCNA 3LCUA 3ANYB 2P65A 3K8QA 3OZDA 2BM8A 5J2UF 3MWKA 2I4IA 2QD1A 4HCJA 3CXRA 5JCJA 5K3DA 3GNTA 2FHXA 3C7DB 5EQJB 2DUMA 5FPSA 2VYFA 2P4ZA 2EJVA 1I3KA 3PENA 3CRRA 1R15A 1HT2E 3ZDQA 1JG4A 3EAGA 1EZ1A 3C24A 4LRSB 2XDQA 1RYEA 5JQGB 1PV4A 1C0LA 2HF7A 4HH3C 4D42A 5DTJA 4MOWA 4MPJA 2O2JA 1TUGA 1JAIA 5ALQA 4KE8A 2GZ1A 3GRAA 4OVKA 3C3MA 4DYDA 3WYEA 1I4LD 1XEFA 2CCKA 4KXWA 2FSUA 4HWSA 3EHEA 5JAZA 2IWHA 2CMDA 1F5SA 4CNBA 4BTEA 5BR8B 1WAMA 1SA0A 3C3YA 2ORED 1R6DA 3FROA 3A26A 3B12A 2PAAA 1K1EA 2WHRA 4UD2A 3WTBA 1JGTA 2DLNA 2DX7A 2AJDA 2NZUG 3KJNA 3ORRA 4B73A 4F97A 1R0BA 2HSEA 3CY6A 3I30X 4KACA 4KMSA 1ZH2A 1VSUA 5D8DA 1JZSA 4C7OA 2GKLA 1ADFA 3OE4A 2B2XA 1A9SA 3P5BA 2YNMC 1RCFA 1OKKA 2ZSBA 3I1IA 5CRIA 3SC4A 4F1KA 3W2IA 1H2FA 1TK9A 4G4SP 2EFJA 2QM8A 1TCCA 1GAQA 2J9RA 2FLKA 3OM1A 3PDIA 3R6WA 4ND4A 3WA6A 1PJQA 3S81A 1CJKC 1DCTA 4ZI2A 2EKDA 1GCOA 5IUNC 4LHSA 2YQZA 2JD1A 3UMSA 1UODA 3TI9A 4DE5A 4MS4A 4L51A 1D2CA 5DLEA 4AYXA 5C5DA 2IEAA 4X8OA 1U3UA 5I7SA 1CEEA 1W0CA 1JJFA 1GPJA 1R9NA 2J7KA 4Y2HA 2BKXA 3DF7A 2MSDB 3EAFA 4ITVA 3LTNC 2HDHA 1VYVA 1XNHA 5F2EA 4QJ3A 5KYUB 3OCWA 1G8MA 4DJFC 2Q29A 4LF6B 3WYCA 1DBPA 2CD9A 2IYYA 4N0DA 4C4YA 4EF4A 3QKUA 1I4EB 4ZDKA 4YBZA 4MMYB 1QZ3A 2B8JA 3CIOA 3FGZA 3RK4A 4AJKA 4TYYA 3DBHB 4L4ZA 2A1IA 4C78A 2C5FA 5A3QA 2WPNA 5C1IA 1JJBA 5GONA 1T9GS 2QUAA 1XVLA 2FR1A 3N0XA 3I2IA 5JNSA 1OWMA 4IVPA 4O4HB 2QINA 4NJEA 4DV6B 3BL8A 4DR7B 1SHKA 3ZWMA 3UUFA 2WILA 4C07A 2EHDA 2FCRA 2H7CA 2R4QA 3LUGA 3HM9A 3HLKA 4QA9A 3R7FA 2QEDA 4BCCA 4CQLB 3Q15C 4F8YA 1WMFA 1XTQA 3UEOA 4F2GA 1VE5A 4ZT5A 3DBLA 1NI3A 2GN0A 4W6ZA 4FFMA 1SULA 2YJ6A 3C3CA 4M1SA 3KKKA 2DPHA 3SBOA 3BL6A 3VR3A 3LX6A 4J94A 1R7RA 3DO5A 5L3SA 5L3VA 4PSKA 4JBIA 5JW6A 1X1TA 2O1WA 5FPTA 2YN0A 2KB0A 3I52A 3QZUA 1F20A 5C1DA 3RAJA 4WE3A 2XHZA 1OAOC 3J81A 3B9RA 4Q1CA 3VGJA 1HRDA 3U4IA 1VA4A 2HA2A 1D09A 2JB9A 1EWTA 1ECCA 2A0XA 2WWIA 2H1HA 4CCAA 3LMKA 3HJGA 2QRJA 3REQB 3W7BA 1MORA 2IW3A 4N7JA 4CQMD 4O0LA 2VP9A 4DCTA 2V0GA 3BGOS 2HU5A 2BRUC 1RBZA 4EY6A 3TW8B 1EA5A 3H83A 1Q15A 1L5OA 3N2NA 4ZYXA 3ZI7A 1PGQA 4Y6LA 1JKXA 2HMWA 4FR7A 1RADA 4L8LA 5CVTA 1BAPA 1TD1A 1VE9A 2NXCA 3F3KA 3MQ2A 3MRTA 3EOBI 4J2TA 1IHPA 5DB4A 2EWVA 3UK6A 3HJBA 1BJTA 1U5BA 3BJEA 1M34A 1G3RA 3D8UA 3ONEA 4INOA 1U8TA 5FOWA 1DUSA 3WWOA 5C37A 5HE8A 4IH1A 1T4CB 1NL3A 3MRXA 3ODPA 4DZTA 3RW9A 1H6CA 4RFSB 2O5VA 5IF3A 1T36A 4AJ2A 5LQSA 3AUFA 1W7AA 5JWRA 3EWIA 5KTOA 3L46A 4V03A 1L8OA 5BNIA 5IWAB 3DUWA 3RHZA 1VSBA 3HN7A 5EOVA 3BIOA 1Y6JA 5CVVA 1ZM2A 2GILA 3R5FA 5AKYA 1XBTA 1E9SA 4GLLA 1UC5B 3OPYB 3HPQA 1SUDA 2DUUA 1WSAA 2WE8A 2ZTHA 4X1IA 5HMLA 1SD5A 1O97C 5DOVA 4KQWA 4ZHSA 4HI0E 3GH1A 1MABA 4JSRA 3CPHA 4TXMA 1Q83A 2Q4DA 3RRNA 1UZUA 4GPEA 3DXZA 4PFQA 3RS8A 4JYZA 4W5JA 3SIPA 5DHAA 2IYPA 4HNAA 2QPLA 4LZZA 1UWVA 4NG5A 4PPQA 4DQDA 2D3TA 4EH1A 4JUBA 1XZ8A 2ZJYA 3ZHUA 3MF4A 1K8QA 3WYAA 2O0LA 5MN6A 3VA7A 1FJXA 4URYR 1XDBA 1F0NA 2ZTLA 2ZZNA 3KV3O 2CJXA 3D7LA 2IV3A 4IFTA 1R0XA 3UANA 1CR4A 2JFWA 3HNOA 3K2EA 1RVV1 5CTJA 4TRMA 4TZTA 5HKOA 2P9HA 4KNWA 3VU1A 3CUSA 4QUKA 5FUBA 1ADBA 4BO5A 3QVSA 4WX2B 2KMLA 4L1KA 4X3CA 3RBVA 6Q21A 4TUYF 2OTCA 4B6PA 1CUIA 2NO6A 2VQ6A 4KR7A 1JKJB 4BFVA 2BZSA 4AZVA 4NE7A 1E3WA 4RSRA 4HNRA 1EP9A 3SAJA 1YULA 3OHSX 3ZZUA 2I34A 1KEZA 4LJYA 5C18A 3PK0A 3A1SA 4CF6A 1LTHR 1N2CB 1NATA 2KYRA 3PR1A 2XEDA 1WWKA 1PS0A 3B5EA 4MWBA 1KH1A 2YTZA 4NU0A 2P2YA 2XT0A 4PTLA 4CIAA 3QBTA 4LXIA 3BK1A 2A33A 1A76A 3F74A 5IMSA 1P0IA 1VG0B 1S2NA 1X6VA 2ZBVA 4MARA 2ZJ2A 1ZMOA 1FA9A 3VAZA 4HHEA 5FI3A 4BN4A 1CF2O 1WDKA 3OJOA 1WB5A 3TLEA 3NOVA 5JCPA 2ZJ5A 4OM8A 3E9YA 3EGXA 3IELA 3L05A 3EXG1 4OQPA 1X7HA 3ZCQA 2SKEA 1KJIA 4UNSA 2ATCA 3B6EA 4LXHA 2YV4A 4ZKDA 3K1TA 1HL7A 1P1FA 2I1QA 4YECA 3ZXYA 2CHUA 1RIFA 5BUCA 2BEWB 3RG8A 1SQ6A 3E70C 5ALZA 4CIYA 1P0MA 4NEGA 4DN6A 2NZFA 3PHLA 3FNBA 1DAIA 4E3ZA 2BMVA 1RZ3A 1YR8A 5BSHA 1RE1A 1JEYB 4ICIA 2CJYA 4M0CA 4ZDIA 5CT6A 2ZYUX 4QL3A 1T35A 1G1MA 1YAJA 4CXMA 4Y6QA 1I80A 3AF5A 3MS4A 2CXOA 1N0IA 1H22A 7YASA 3LT5A 2VCEA 2QORA 5I9SA 1I3LA 4EEZA 1G20B 1ZK1A 1BWSA 2XUIA 1EP2B 2O2DA 2OESA 3G7SA 4ZC8A 2G7MC 3EG5A 4I1YA 2AJLI 4YXWD 2CMFA 2NTNA 4GKVA 4IZOA 1TEVA 5HE9A 3OSZA 3QUTA 3WDLA 4AJJA 4GMFA 4QRHA 1YI1A 5HZHA 3MLAA 4ZARA 4GXTA 3TO5A 4IZ6A 5FWXA 4B82A 1OBFO 2W2PA 4C4ZA 1B2LA 4WKGA 1P2TA 5AVSA 1ZJ4A 4G2NA 6REQA 3HJCA 3TI7A 4M7PA 3PKZA 4CCSA 1PZXA 1TMGE 1U6JA 4E1AA 1PJ4A 4O1HA 1ADGA 3CPEA 2AG6A 3K5PA 3Q98A 5JWHA 1MCZA 3QX8A 4DCMA 1Q0LA 1UKEA 1VXOA 4JL8A 4WXEA 3RRXA 1UEJA 4C14A 5KX5A 4IQ4A 2XY4A 3RIHA 5HOQA 2GAFA 2YL2A 3E53A 3KKPA 1UMBA 4KK4A 1DAFA 2LGJA 4MW1A 4QXQA 4UM9B 2PX6A 1GU0A 5L95A 2ZM5A 3C1AA 3F9RA 5ACTA 3JATB 3UA3A 1MX9A 1GZ5A 4RZSA 4BEWA 2ZR7A 4ZK2A 2ERCA 1O4WA 4OAPA 4OGFA 2FN4A 1PT7A 4NC9A 3AP1A 2NXWA 2VPYA 3AHCA 2WAAA 1VMKA 5I47A 2BKLA 1CDEA 5E95A 2H59A 1GL6A 3TL3A 1AGNA 5LXTB 3RT7A 2F9MA 1PJRA 4W1SA 3UHAA 1M6YA 4RJTA 2OCLA 4FGSA 4CMIB 1RU3A 2VK8A 3OLVA 1KMMA 2HCTA 2NTVA 2PFGA 4JI5B 1Q21A 2CNWA 1PGNA 2BDUA 2VHEA 4UHDA 3SW3A 3C8MA 1O7JA 3F2IA 3GLFA 1WCYA 3G0GA 3PICA 3QVLA 1BA2A 1PD0A 5C1OA 1BN7A 1UZAA 2NNWB 2AD5A 2P1ZA 2NOAA 5FCDA 4HWPA 1NNEA 5JJLA 5FAXA 4D45A 5HGXA 3R5JA 2XRFA 1EHCA 1WPQA 1OIXA 2ZYWX 4EUNA 2O1XA 2IU3A 3KSDO 5AYVA 2R7AA 1VLQA 5EJIA 1ICEA 1YZYA 2H54A 1K8XB 3HJTA 2AHRA 3RSLA 4DL9A 1JR4A 1A7KA 2R7NA 3HUDA 3UUGA 4CEHA 3DPIA 1E5VA 4OV6B 3TVDA 4CCYA 3ZQKA 4BB0A 2QN9A 2RARA 3RWBA 2EEZA 3NKLA 4V1CB 2GD6A 3ND5A 3EPLA 2F48A 1E3TA 4GD3Q 1K7CA 1QS0A 2HJHA 3BCRA 3K9CA 3I04A 1CK4A 2WWHA 1G59A 2QTBA 4TZKA 2P8JA 5FNVF 1RI3A 3WLAA 3DZJA 2Z2XA 3VKWA 1MO2A 1HFKA 4L76A 1SXHA 4OXNA 4XPZA 3K0FB 2NU8A 2RB4A 4N9WA 1ZGCA 2FSVC 3CLSD 1IIRA 5JHHB 3ZJVA 2HC9A 5C1PA 3ABIA 4XGNA 4MUKA 4AKSA 2IZ1A 2HA4A 2XECA 1W88B 2WSLA 3AF0A 5DBOA 1F06A 1DTEA 1YVEI 4EYGA 2Y67A 2VHVA 3BJRA 4ZJPA 3VPSA 2XYVA 4JY7A 2Q1UA 4N65A 4RETA 1IULA 1QQBA 3F9OA 3LRTA 1PZNA 3GFTA 3B1YA 1T8PA 3QEAZ 2PYZA 1PZEA 3CUTA 3HP7A 4OQLA 2GNPA 4ZIRB 1G7TA 2BC9A 3VU9A 1CUAA 4TT8A 1NW4A 4UVDA 4B81A 5ERXA 3S2IA 2BBTA 1U0EA 5F12A 4HPJB 5JV5A 2H5LA 4CMKA 3JV7A 1P80A 1J8QA 3JZIA 4ZGGA 3FLEA 2WVGA 1QQ7A 3K1JA 3RUFA 1RZRD 3SHFA 2C5GA 3NBAA 3Q2IA 3HTXA 3CVUA 1YB4A 2PUWA 2W6QA 2Q49A 1KKMA 3TPCA 4EMSA 1ZJWA 1JEDA 3GR6A 3I76A 1NQAO 3F4BA 1FUIA 2QY9A 4K9MA 4M1YA 2I6GA 4DV2B 3PS9A 2PEZA 1FEZA 1NX9A 3AX6A 4L9SA 5LVAA 3GP8A 4F3TA 3M82A 1S3FA 4AY4A 4OQZA 4AJ4A 4ND2A 4UNRA 3CKMA 3ACBA 3EXEA 4KN9S 3RLIA 3T1QA 4B3CA 3FWYA 1BVTA 4EECA 1H2RS 2ZJ6A 1K7SN 2ZUWA 1P9LA 4AMVA 4BFYA 1PFKA 3QU9A 2ECOA 4BMVA 4RF2A 3TOVA 4FMCF 1Q6YA 4YX9A 1SUBA 2H1CA 4AK9A 5A4DA 5J5CA 4B2LA 3A9WA 5AW1A 2H7XA 2FPIA 4FOTA 2Q27A 4IIJB 5DX0A 5BSUA 4YP5A 1S8NA 2EQAA 5LDHA 4U7HA 1YQDA 4NBSA 1NC1A 2XYGA 1OR8A 3T54A 2C99A 2E82A 1Q91A 1N2ZA 4WADA 3TMKA 1E2QA 4ARIA 1KO4A 1Y6QA 4MV0A 1Q22A 3RQIA 3TSCA 1VG9B 1FDIA 3UUEA 1N2HA 1M67A 3PX7A 2NP6A 3WB1A 3KQUA 1PQ4A 2QBYB 3VRHA 4P3KA 1K7XB 4BUZA 4MQFA 4EFMA 4KL8S 2L18A 2JLXA 3OZIA 2ILTA 4EG8A 2CD7A 4RQBA 3WE7A 1IAQA 4KXLA 3QPWA 4IZIA 1CBUA 1UJMA 4N7RA 4YP9A 5GADl 1B4DA 4IHJF 1PZFA 4NBKA 4XR4A 4X1YA 4BO3A 3ROFA 4D8VA 2PX0A 1FFDA 1A9XB 4D4JA 4MJ7A 4EHDA 2BMAA 1P91A 3DGFC 3N5CA 2IS6A 2XXAA 1PL8A 1OFUX 1UP7A 2XRYA 2NZWA 4B0PA 4Q0MA 3IBYA 4XSHA 3UCEA 2WSMA 2QP9X 1E7WA 2LNDA 2W2NA 2CK3D 4GZ3A 4QOHA 1W4RA 2ZBPA 3EIUA 4E31A 4AMYA 1CZLA 2YYYA 3RNOA 4B7AA 3GCXA 3L0YA 1Z0IA 3GH3A 1QOZA 3LCMA 4M7OA 4AXXA 4E30A 4ZTUB 4WXHA 2V6MA 3OCYA 3ELDA 2WJGA 5HIQA 3ND9A 4Z9BA 1CP2A 5GZ3A 4I1VA 3T3IA 1ISJA 4O3MA 1HOTA 1W76A 1HEIA 3EIOA 3JQEA 1JJTA 5EH9A 3FETA 4H6VA 3C3JA 4NOJA 3W6ZA 4DEYA 3F97A 2J3JA 3IIJA 3QUSA 2ZRIA 3L40A 1JG7A 2JLAA 1UUFA 1EK1A 1YNSA 2MYUA 3DTVD 4H4EA 2IGBA 3Q11A 4LE6A 4XQ0A 4M22A 5K6TA 3OEWA 4R98A 2QMYA 4NZYA 4R1UA 2GLXA 3M6MD 1GGJA 4NLLA 4E5PA 2CV0A 4K8RB 4UM8B 1C7FA 3AV3A 2QSYA 4PYIA 1FFGA 2R751 3G13A 3EWAA 2G0TA 3OMLA 4OA8A 4YRCA 1SY7A 5ALEA 4ASUD 4BMOB 2RH8A 2NVWA 3W5SA 3T7JA 4LGVA 3OZ7A 3R1IA 1V2GA 2WYLA 3HV0A 5BV2P 2GO1A 1KSHA 4L4SA 4YJHB 3TZKA 4NWIA 1SPXA 4KZPA 3PCRB 3BE4A 1HTTA 3TFQA 3VH1A 4CT0A 5DPXA 3TVYA 4IGAA 3VR6D 1GUYA 5EVDA 1E2PA 4H3VA 3W5DA 1CDOA 2WF5A 3WXCA 3E0QA 3WDMA 3CN9A 5EIAA 3R3JA 4CMGA 3SYRA 3AEUB 5FUVA 4J16C 3EDMA 3DLIA 5IK2A 2B4TO 3KB6A 3P4UA 4FDTA 5DBHX 3VNRA 4R1LA 4FB4A 2YOGA 4MQUA 3IBTA 1PL6A 1L7PA 1MBZA 1U1CA 5LBUA 2ONJA 3RGGA 4BWGA 4R8LA 5I8WA 2C8LA 1PR5A 4R16A 2W2LD 1FZQA 4MW6A 1II0A 3CUWA 3EGDA 3FMPB 1Y7IA 4GOOD 5D7NA 4XUKA 3QY0A 4WGFA 1GO2A 4V0LA 4DUPA 3WO0A 3DMPA 1UFQA 3MYYA 3L8YA 3R7LA 4Q4JB 1S5PA 2BV3A 4MUAA 4QUEA 3D6NB 3TKYA 4NV1A 3ZWQA 3ZQJA 1VHJA 3U7RA 4EUKA 4LRUA 4ARZA 4JU9A 4LE1A 1BEZA 4L4UA 4JXZA 1CYEA 4J0EA 1WQ4A 1C7ZA 3JAWB 4MNTA 2C82A 3VZPA 3M5WA 3L0CA 2YXPX 1IE3A 4JI3B 3X1XA 2JFOA 3AIMA 1JFTA 2VEDA 1ZIOA 4EY7A 3F8WA 4KE6A 1Y34E 1OFVA 2NO1A 5EXPA 1ISSA 4MUEA 4R1MA 4U8HA 3JASB 1MJ5A 1WD5A 3SE0A 2BUAA 3PRHA 5H4GA 1YRWA 3BFVA 2C4KA 4C0WA 5EE3A 2FRXA 2RI0A 4BO6A 2WHEA 1JG6A 5L7YA 4BNVA 3PT9A 5ITSA 1WXDA 2MSKA 5A23A 3R24A 4NZNA 3ZW8A 3DHNA 1IHUA 1YC2A 4OH1A 5CT8A 1ZN9A 4J29A 3WNVA 3VJLA 3FF4A 2CJFA 3AVWA 1DG3A 5DX8A 4E32A 1PDWA 3WRWA 4K0RA 2C5LA 4ZVPA 1YJQA 1QIHA 1RQRA 1SO8A 1RACA 5CYPA 3AUTA 1I10A 1BMCA 4L75A 4I3HA 2IF0A 2LUOA 3G0BA 3ZCTA 2QVGA 1SQ0A 4QDJA 2PMCA 3SICE 3GLGE 8ATCA 2XGOA 3OH8A 5IAKA 3Q0TA 3ZU5A 3VYSB 5I01A 2UZ0A 1MB0A 2ZB8A 1PWHA 1DO2A 2IYZA 3ZVMA 4BN5A 1JDSA 1Z12A 3C3XA 1LFAA 4G85A 1E60A 3V4PB 4LXQA 2W00A 4REQA 3SXJA 3KZXA 3UGTA 4CCWA 3ENQA 1QH0A 2X9NA 4B8YA 2R1TA 2Z5LA 4UAVA 3L0OA 4X1KA 5I8ZA 1Q0TA 2PA3A 3R41A 1WD7A 4Y9SA 3AVUA 3BWDD 1PIWA 1KXZA 2OFFA 2OP1A 3OQNA 3K3PA 1NXVA 2A84A 1WLYA 3VSEA 4QELA 2BI8A 3THXB 4PANA 4I5FA 1Y9EA 4J2HA 1K7EB 3BXEA 2YX1A 4CDRA 4TV8B 4J0CA 1YL7A 3FVQA 3H3EA 2OC4A 2Q28A 4NV3A 3RVRA 4AD8A 5L45A 2BGAA 4EYBA 3N3BC 4HNHA 4D9EA 5ICCA 3DFIA 3PD0A 3C2QA 4R9NA 5K8JB 4CUKA 2ZWRA 4ZQBA 3WIVA 2CYAA 2XUDA 2C8VA 4D0NA 3DE3X 5L40A 2PRJA 4IJ5A 3EJ6A 3KKZA 2GWHA 5HMMA 5HFJA 3M5DA 1CG6A 3M9XA 2O8DA 1TM3E 3FPBA 3UATA 4YGXB 3EOZA 4OHBA 1L5MA 4QKQA 4GI2A 2IVZA 2AIOA 3D8TA 1F2DA 4EGJA 4QJIA 3B38A 3BWYA 4YPOA 5BV1A 2QX6A 3EG9B 3PR3A 4X64B 3RSHA 4FP9A 4EHJA 2AN3A 2AKEA 2HF8A 3ZY6A 3VR5D 2VBIA 1X1BA 3OFJA 5KVAA 3LRPA 4MKGA 1H2ZA 1PDOA 1T2AA 1SZJG 4ZOEA 1V16A 4BJ3A 2VP2A 3KTFA 4LWOA 3I2YX 4IJQA 4JBGA 1OSNA 1RPTA 2PSSA 5CU7A 3RWOA 1QAOA 2WHQA 5GVRA 3CG0A 2WINI 2XQIA 3AVVA 1YE5A 2X0RA 2R1ZA 3HRHA 3I32A 4OIMA 4C4OA 2HMUA 4CUZA 3GOHA 3W9BA 4E6PA 3BL5A 2IYEA 5IABA 4EYEA 4D9CA 4XWKA 3MSXA 3IHLA 3FKSD 4M9QA 2PX2A 2I1LA 1AZSC 4MR7A 1XAHA 4KYTA 4UAMA 1DZIA 2VHYA 1H6DA 5KC8A 3QFHA 2NVUA 1EHYA 4GVXA 3PGXA 3PUVA 3CEPB 3OD1A 3V3TA 9LDBA 1G5IA 4CM1A 2JD0A 3V33A 4LDAA 5IYZF 2X0IA 3K0AB 2J46A 1Y7TA 1KFBB 3AOEA 1CJVC 3SMVA 3R23A 1XHFA 4KR6A 3GLIB 4WESB 3N58A 2A78A 2BTQA 3IALA 2J08A 1IBRA 1WDWB 1ZJ5A 2LTAA 2Q41A 3ILXA 1CY1A 2GCOA 4I1RA 2E85A 2XAAA 3F7TA 1YKFA 2H0AA 3UAYA 5CEEA 4QOJA 4HVTA 1K08A 2J4CA 1W93A 3PFWO 4KXXA 3ZCVA 2QN8A 3D3JA 3UOAB 1A96A 2H18A 3PCTA 1JZQA 5I7FA 3LX4A 4RDIA 2VN8A 2ZU6A 1VGQA 3OPNA 4B3DA 4MB2A 3PSAA 3C85A 1U99A 4EL0A 4S05A 2WTNA 1VRWA 4WPGA 3MC1A 5EWAA 3IS3A 4MROA 4H7KA 1CYDA 1OJ7A 3FTDA 5LOVF 5AKHA 2DWOA 1RQNA 2JGRA 1T9BA 1ESNA 3KXLA 4IGEA 4X91A 5BRNA 4MYDA 3IJRA 2O8EA 1APBA 3PC6A 2ZPTX 3ME5A 4GOKA 2GM3A 2PRIA 4P5EA 4AZ0B 2XGJA 2Z4TA 4BYGA 1V43A 4RELA 4AO7A 1E1CB 5FJIA 4Q7QA 1Y5IA 2QIOA 3IERA 4IUYA 1DQNA 1RZUA 2D7JA 3QEJA 3D6TB 2O2EA 4BFSA 4DEVA 3V34A 1H9BA 3DDOA 3H5LA 1PTJC 4KDFA 2C9ZA 2IZOA 3V55A 1MQAA 4AJEA 2HPZA 2HU8A 4BO2A 4UHBA 2XD4A 3AL2A 3ZWYA 3ONVA 5KNDD 4JJAA 4JP5A 3LVFO 4Q7EA 4BMDA 3C45A 1NULA 2Q4TA 4BLOA 1U8UA 3UH1A 5KTSA 3HDQA 2D2XA 4GOJA 3BXZA 4UMVA 1C1DA 5EV8A 1ML3A 2QVXX 4JI2B 3QLTA 3LYAA 2DFPA 5T4EA 3PEVA 1DOZA 2PMEA 4BS9A 2EWMA 1MPXA 2JGNA 5K8VA 1EFDN 4BECA 5IJWA 2JK1A 2YICA 2KE5A 5IZ4A 1D4OA 4IV8A 4RAMA 1P1CA 1XD2B 1QCDA 1WOYA 3R6TA 2D8AA 3NHJA 5IC5A 4MRMA 1V8DA 3DSRA 3KXDA 3G59A 2FMHA 1QK4A 1XMQB 3EGOA 4C9BA 2WJ6A 3EFOB 9LDTA 2QRPA 2JFFA 1Q1GA 5LP6C 2QLMA 1AKQA 1T8WA 3SMQA 1W2GA 2DH6A 4RD4A 2NUAB 4HNVA 4YUVA 3OJ0A 1WP9A 3ZE2B 1KKUA 1NR7A 4M89A 4G0MA 4CFSA 4COOA 1OYYA 3BTUA 3ZG6A 1M76A 5TMBA 1E3JA 1RCTE 3WWEA 5HQJA 1PLJA 1WXQA 1Z2DA 2FFQA 4K9PA 1JG2A 1T1IA 3IBSA 4LMBA 5CUQA 3UJ8A 1WDTA 4WCFA 4X20B 3FUUA 1C2TA 3OTIA 2QRHA 4S24A 5F78A 4Z6KA 3LCVB 1N34B 1XN1A 4RIIA 3TNDA 4W5NA 1L5VA 4WASA 3RU3A 1DIBA 5KWJA 5AKJA 4BUJA 3Q2KA 1RXSA 3ZHYA 1IBMB 4X8MA 3IIKA 2HB6A 2M98A 3GAFA 3D0QA 4AIIA 3ZE8A 3G9UA 3NB0A 3U44B 1M6WA 4OUDA 5AEBA 4PC2A 2ZE7A 3FDZB 2X77A 4UEQA 3GFSA 4ZEXA 4A6EA 2D1FA 1K3TA 1IWBB 1KJ9A 1ZP6A 4Q66C 1A3CA 1F0PA 2HSZA 4WBNA 3W4KA 3CKYA 1QCCA 2C8JA 1RM5A 2PVPA 4Y6GB 3WGVA 1KAEA 2CEAA 4YVFA 3AZOA 4TKUB 2VAMA 4YRGA 1KZ1A 4PPGA 4ZREA 1LSUA 4QD3A 1O03A 4OP3A 4E5YA 1RI1A 3I42A 4LHEA 1KK2A 3EISA 4WLFA 4EL5A 2AUTA 4YPVA 3R3XA 3CVYA 5DHFA 5FTJA 3ESXA 1KMHA 2VWHA 1J07A 1U4SA 5KWEA 3QTTA 4TROA 5AVKA 4BBAA 2IYSA 4TQAA 4HKYA 2JGIA 2J6CA 2ZXEA 1AURA 3CEHA 4L6IA 1QGAA 3WK8A 3ZZMA 5LP1A 5HIPA 3O93A 3T7DA 1TKCA 4JS0A 1VIYA 1SUAA 1XXHB 3T7TA 5JAPA 1IONA 4ML3A 2Q1XA 3ZWCA 3EPPA 5DBFA 2QYOA 5IEBA 2QZJA 3K53A 3KD3A 5TC4A 2AX3A 3H9JA 3G2PA 5BMVA 4BVHA 4BNTA 4DC1A 2AK3A 4ENQA 4I4TA 3NHLA 2I6UA 3O8OB 4UE6A 2X0KA 3LC1O 4FSHA 4PG5A 3H6KA 4GEKA 3W90A 1KI8A 4ZVLA 2HNKA 3LZCA 3LCJA 1O9HA 3SM9A 2ARKA 4NFLA 5ADUS 4EHIA 1PI3A 1GSHA 1L5FA 1FE8A 1K5PA 2H52A 3CQ9A 3LM8A 3OOWA 4WL0A 3USES 4FM9A 5AK3A 3RFTA 5K3OA 3SHQA 3QYPA 3IC5A 5BSKA 3X2XA 3GO4A 1AGYA 2HLNA 4GMGA 1IATA 3GZNB 5EJGA 5TY0A 3HB9A 3IBFA 2ZAIA 3D6FA 3D3QA 4RM5A 4HGZA 2OG1A 3BH7A 4D5GA 1QJCA 4WCDA 1A98A 2WR8A 2FEKA 1EIWA 1X77A 4ZJZA 1U0GA 1ZL2A 2RHHA 2Z5GA 4IUCS 1A7UA 3BMQA 2O23A 2PL5A 1WVGA 3LD9A 4MQEA 2YWDA 2WF6A 1I8TA 2EU8A 1CU1A 1U2DC 4J0IA 3R9IA 4ZZIA 3G0IA 3A3PA 4F06A 1BQ3A 1P7YA 2IH5A 2XB9A 3QFTA 2B9VA 2QTFA 4BKMA 5B3JC 4A2PA 1Q7GA 3I3SR 2AOVA 1UKAA 2JI8A 1KZ7B 4Q1DA 2V7PA 5IUKC 2W58A 4ARVA 4E22A 1XM8A 5A9SB 2AR0A 2ERXA 2B69A 3N2KB 5AI6A 1V9LA 2ZRNA 1A4RA 3WJAA 2WJZB 4RA6B 3Q7TA 3D8RA 4FCVA 5AKGA 1OX5A 4JN6B 4F9TA 2ECQA 1NBMD 4WVFA 3STYA 1V9SA 1M2OB 1MC4A 2ZM6B 5H83A 1R37A 3OHMA 1O1YA 2BGGA 4CI0B 1L8XA 1H8EA 2DKNA 1DJLA 1JQ3A 1BCRA 1PLLA 1QVZA 2AFHB 1RHUA 2RK4A 4GZ6A 4MINA 1EX1A 2AFIE 2IEIA 2FRDA 3C8DA 4UHKA 1G66A 1S2LA 1ULUA 4EABA 1ZJYA 5IM4A 5BV7A 5ACUA 1WEHA 3CF4A 3U7QA 2EKPA 2FGJA 4JNCA 3EPKA 4NU5A 4BP9A 1DJNA 1IZ9A 4LNHA 4TYFA 3WBFA 1QRSA 1WR8A 4AJLA 1XDSA 1GITA 5EPUA 2IKQA 4D3ZA 3KQWA 4OQQA 5PNTA 3S2UA 4NHOA 3UHOA 4PHFA 2QJWA 1NQWA 1JEEA 3VMMA 4FEEA 2CLSA 2QQ5A 3BC1A 4LVNA 2G9NA 2V6JA 5JALA 5EWLA 3IIMA 4Q12A 2PSJA 4UCXA 1ESMA 2OZKA 4Y67A 2DR0A 5K3AA 3ZHCA 1TA9A 5FBVB 5D3ZA 1Z2OX 3L4SO 1YIDA 2RGRA 3EZ7A 4C0AC 3L82B 2ZJFA 5KNDH 1O95A 5EWJB 4KPUA 5KYWA 4GLJA 3OC0A 6ABPA 4RIHA 4I55A 2SBTA 2X8AA 3MNFA 4KJZA 5GM2A 4H1HA 3NQ41 1MIHA 4GOXA 1UDBA 1RYFA 3BGSA 1NBOA 3PC8C 3HB5X 1UC4B 2B1RA 4YRIA 4CKEB 1Z3IX 2D3WA 3BF8A 1CR0A 1OGYA 3CW2A 3EMKA 1A9TA 3IODA 2XWPA 1BHQ1 2FPOA 3ZC3A 3RSQA 2P0AA 4G1FA 1SC6A 3HXKA 4MKZA 1CUZA 1G60A 2RK3A 4B3XA 1ZKPA 4TMTA 1A9OA 4DOMA 1KEEB 4B3MB 2QZSA 4BJHB 5BNZA 1VOTA 1DFIA 1RWXA 3ZUPA 1RM3A 2NU7B 3BMOA 3NEJA 1KDTA 3N8DA 4QYMA 1J7KA 1NRJB 1SELA 3ZBUA 5KREA 2IHNA 1CUGA 3HP1A 2GEUA 1Z2EA 1OWLA 4YUWA 4F8JA 5JTUA 3G5LA 4OQFA 3U3ZA 3B9PA 1F17A 1LBEA 4TMWA 1N3IA 2VI5A 4AFNA 4PCVA 3E27A 2RC6A 5A87A 1KNQA 5EESA 3ZWBA 1AGXA 5J5AA 3SZ3A 1B23P 4V0OA 3LHKA 1TM1E 1WXIA 3GX1A 1CJSA 1YZ3A 3D54D 5F1OA 4B2YA 3RVOA 3ER6A 3JQFC 3MXTA 1ULAA 1A88A 1G0NA 2F1RA 3J80A 4O4IF 4YAWA 3OBBA 5CT5A 4V24A 3SQWA 4CVNA 1GTL1 5AIBA 5KNBA 1Y8RA 1DQZA 3CX3A 4FQ7A 2PGDA 3R0VA 2YMPA 2XWQA 3QI7A 2NM0A 4LFBB 1J23A 4AKTA 4P3XA 5B1HA 2I9PA 2OXRA 4JJEA 1E3SA 3G82C 4OB6A 2B21A 3EC7A 4P35A 3DOCA 2WT4A 5ERGB 1W5FA 1KPGA 2DAPA 2F9LA 4TV9F 1JEOA 1E4OA 1C5KA 4U2KA 5FL3A 5IBQA 4F2DA 1C9JA 2HMYB 1Q3HA 2I99A 1Z0JA 3B60A 2J33A 2WG0A 2QUKA 3KELA 5C4IA 1KQPA 2XCOA 2ZBFA 3IKTA 4J5FA 5KTMA 2BGWA 1P9OA 1RQGA 3B2NA 2OHXA 2CVHA 3NYIA 1NVAA 4O2AA 3UT5B 1I4TD 3FNQA 3G89A 3QQ5A 5L51A 3LP5A 1BHSA 4FMCB 5ECGC 3W8DA 3MUFA 4Y2SA 4J1TC 4JEHA 5TR9A 4DWOA 1DU4A 2YV1A 3LKDA 1U02A 2WJYA 3ESAA 3J7TA 1CR1A 5HBGA 4ZZ0A 5LKRA 1E63A 4LOHA 4MUYA 1P19A 2PTGA 4IDHA 2AKAB 4Q5IA 4XX0A 4RW0A 4KGVA 3SJCA 4ECEA 1YRQA 4ZEWA 3EDRA 3THWB 3EULA 3WGJA 4D3FA 3HDGA 5E9WA 2H8KA 1OI2A 2R85A 2BCJQ 4JQYA 5AW9A 1RQ2A 4HNGA 3P9CA 2ID9A 5EHIA 2ZQZA 4JJGA 1J00A 2AI3A 3QLVC 1ODJA 1NE2A 4E33A 4EHKA 4Y7CA 3IKLA 3JWJA 4NH0A 3S68A 1SBYA 1OXSC 5JJKA 1T25A 2OQIA 2PFSA 3R6LA 3UK0A 1N7JA 4FBMA 4CNQA 3GJ4A 2NZ2A 2FPGA 4RKYA 3AF3A 4EB8A 4Z67A 2BMDA 3V97A 1QOPB 4CLRA 2I54A 3PNQA 1NQUA 3Q3JB 4DSOA 1WQ3A 2XMDA 4KRYA 4IHJB 5FO1A 4PRLA 5DIFA 1FYFA 1LBSA 4XPIB 5FJJA 3V2IA 1EQ2A 1SXJA 1LPNA 4RIFA 4CMBA 1L8AA 1T1GA 2EBHX 4KSCA 1AF7A 2BSXA 3X1ZA 4AG5A 3AR7A 4KODA 5ADHA 1T8YA 2R96A 1GTVA 3LC2O 1RLUA 2H85A 1CLUA 2JI6A 2FMKA 3BQNB 1NTRA 2H1LA 2QUJA 1L7AA 3D3KA 4QPNA 4YRKA 4U6SA 4IMJB 3EVCA 1TA4A 1TMKA 3BWEA 1T8UA 3OZEA 3ZY2A 3AUAA 2QM7A 4A2QA 4Z4IA 2QMZA 3PD7A 2CFUA 1KOFA 5K0SA 3NOQA 1QIKA 1U9IC 2W4IA 3NBXX 3O82A 3QX7A 3NHZA 4D8YA 1UCFA 2FRVA 2I2XB 2JAWA 1RYDA 2Y1GA 4JIMA 3BFJA 2RIPA 5JS8A 4FFPA 4MPTA 4RY9A 3DUFB 5B12A 2J0SA 1VLVA 2GX6A 3Q3CA 2HM7A 4IMIB 3STTA 2WPDD 5JCOA 1IQ0A 1XZAA 4ILEA 4HEHA 4CEJA 1EM6A 1JYFA 4W5WA 4RJ2A 4IXTA 3OCCA 3BSSA 1ZA2A 1Q92A 2O7QA 2OCKA 1I2CA 1QHSA 2DUWA 4AX1B 4GPBA 1HG1A 4QPZA 3OPYI 1Y89A 3OC6A 4YP6A 1D5CA 1GZ7A 2VNHA 3FNRA 3LUHA 2Y77A 4W7HA 1XWIA 1NM5C 5AHOA 2A5YB 5LYJF 2FMTA 3HWWA 5G0UA 4LHXA 1BDHA 2ZIEA 2PT9A 1E94E 2EGGA 3N0VA 1HA3A 1C1XB 2OZLB 2V3WA 3BRWD 3KQOA 4DJJA 1J8DA 2P1DA 3I9V6 4K26A 2VZ0A 5LZ8A 2PZKA 2Y4OA 4HXGA 3CR7A 4J75A 2WIBA 3LCRA 4QU0A 1JWLA 3PI6A 1DJQA 4COKA 3R2JA 4F8EA 4P93A 4J3FA 2GCIA 3S0ZA 1DKLA 1EGVB 5D2CA 4B2IA 2FK8A 3DMFA 1BXRA 1M2EA 3HKEA 5BN3B 1SIOA 2ZWVA 5ARCA 4TYNA 5CXUA 3G0OA 1WP4A 2EJUA 2VSQA 5EHXA 2PUAA 1PNRA 3GG9A 1X7DA 4EYQA 3PUXA 4PHHA 2TMDA 4PZCA 2BG2A 3PEWA 2ADFA 2JGMA 3H11A 5JCJD 4HQFA 4JUIA 1L3BA 4ZMRA 3N0TA 1BDJA 4I50A 4C7BA 1I94B 3H5TA 3L1IA 3LWNA 4JMLA 5CM9C 1L7RA 1B3RA 1W9MA 1KF0A 1XRMA 1CUSA 4BKUA 3GFOA 1QX4A 1MRNA 2YRXA 1R0CA 2X4DA 4RYLA 1SKMA 2ZIVB 2R25B 1YZFA 3II6X 2BVNA 3HA7A 3IX7A 1M66A 2VA8A 3EQ8A 1LLUA 3O95A 1FDOA 3KX2A 4KVZA 4GZ5A 5EP3A 5KYKA 3F5DA 3PQ7A 1QH1A 3JWGA 1GA4A 3L4BC 4Q16A 3HZOA 3GLVA 2Y87A 2C92A 3ASVA 3LT4A 4CEIA 3PNMA 1E7SA 3E3LA 2POQX 5KSWB 1Y3CE 3P9YA 2J6IA 2ZBUA 1CF9A 2ZITA 4UE3S 3I92A 3PNLA 5ICMA 3QKTA 1TT5B 1AD2A 4ZRNA 4RTJA 4GDFA 3LC0A 3KVRA 3CA8A 5EWMB 2BSQA 1E1KA 4OGWA 4YCNA 1CW2B 2B4AA 4MW2A 6ADHA 4G4SO 3RVNA 1KEUA 1ZXXA 2BFNA 2QL6A 3R6GA 4PX5A 2E5LB 1OKKD 3C39A 3HFSA 1OFUA 2BM9A 1Q44A 4NFYA 4V2UA 5JQGA 2I65A 1QG2A 1KFKB 3QVVA 1N6RA 4XFJA 5G40A 1BN6A 2NV2B 5CGZA 3INGA 1IHOA 4HC4A 5IANA 5GV7A 2ICAA 1OX6A 2QNRA 3O3NB 4F2HA 4QSMA 4PAOA 4CU5A 2GZAA 1JQBA 2I2WA 2JIMA 2PCLA 1ZONA 2VBFA 4QULA 5K99A 1ATZA 3AYXB 4C4SA 4BU0A 1QQAA 3DHAA 3PB3A 5K6AA 1U0LA 3RSZA 1VPVA 2OVBA 4KNYA 5JVDB 4P80A 1I2MA 1YK0A 4PS0A 4A7PA 3I2JA 1K6EA 4WT7A 1E96A 1RKBA 4L16A 5ALYA 3BXHA 3DKKA 1QWOA 2CDCA 4AP5A 4DA9A 1VDMA 4PN7A 1J2EA 2R2GA 3WSTA 3OZGA 1G38A 5A2GA 2DR2A 1ODLA 4EQZA 4TN5A 1NI4A 4AD9A 3GMTA 1QZUA 3L8EA 2O2SA 2E4XA 5EJMA 1B1AA 1NXQA 2OENG 3ISJA 4EI2A 4WN9B 3FUXA 4HQKA 3CNBA 3G9QA 2DT5A 4KV7A 1PRYA 1Q0PA 1M5TA 2MIIA 2ODAA 1B8PA 3ICCA 4R1OA 3R7BA 4EB3A 3AY6A 2B61A 3DAFA 4BQRA 5AK5A 1HTBA 4OSOA 3VNAA 3FRJA 3N74A 4LDNA 3FA2A 4LJSA 2FU9A 4II7A 4EHNA 1GQOA 1E6EA 1STOA 5JSFA 5KYUA 3Q3GE 1A5BB 3O8NA 2ODPA 1LQ2A 3SBDA 1UC8A 3EEIA 3VZCA 4Z53A 3ZDFA 4YK7A 2BFBB 4IV0A 3VR3D 1YB5A 5ENZA 3LF2A 3DBHA 3DWFA 2XE8A 4P84A 2GESA 2HQOA 2O3RA 1LPAB 3PDWA 1WB6A 2PZLA 4E21A 3A2NA 1GPAA 3RGWS 1UBHS 1QF6A 3WBBA 2QDSA 4PXYA 4O4HA 3U62A 2C3MA 1KBQA 1JDUA 2GFIA 4JP1A 4MV5A 1FPMA 2BMJA 2E3JA 2Y0CA 3KYDB 2YVUA 4Z60A 2J3MA 2CBGA 4QBIA 1VL8A 3RKKA 4EKYA 1ZN2A 4GR4A 1J21A 5E3JA 2ONZA 3S2FA 1FXSA 1DX6A 3I3OA 1CR6A 4IIGA 5M04A 3PGKA 2WMOB 4QHTA 3RAPR 1T2UA 2WWTA 2Z30A 3OQOA 2XZPA 4B43A 5J43A 4B3SB 5AI9A 2RFLA 1SXGA 2YVKA 4UATA 1Z22A 2AQKA 3RVSA 1PQPA 1GZSA 1MC1A 1MPTA 4EFZA 1UAGA 4FKBA 2VDUE 1I01A 1ZISA 4NK5A 4FDUA 4NAUA 2BFLA 1H3NA 3KFLA 2J9FB 2VT3A 2X3YA 4HUQA 5CNKA 3MUNA 4DCOA 2AN9A 1EHIA 2P5SA 4V1CI 4V0ME 4XR9A 4BNWA 4OHUA 2DE0X 5E8JA 5JROA 5IYZB 2PX3A 2A4KA 2IYRA 1R4NB 3TW8A 3V8VA 3ZV7A 5IFKA 3PU6A 1MXHA 1RVDA 3M6UA 5IAJA 2PHZA 3KZMA 3RV3A 4UDXX 4D4HA 3TBFA 3G02A 5DKFA 2QSJA 2BFZA 1UM9B 2X9LA 3D6AA 2XADA 2EP5A 3R7WA 3VISA 5C4MA 4MGZR 2QM0A 1GPNA 2EZ9A 1AKWA 2NQ2C 3MMZA 4JSYA 2OGSA 4L3WA 3W5JA 1T4CA 4FEGA 2QI9C 4PYKA 3B1JA 4G9EA 5ALRA 1O57A 1ZMXA 2VR1A 4QXAA 2DUJA 2B94A 5AOCA 4XYEA 3A6EA 2BFAA 1A4XA 3NC0C 4PZAA 5E7MA 3KR9A 5FNZA 4E5MA 5ITZB 1Z06A 1LI4A 3HHPA 2O6HA 3FOZA 1M2HA 1RMTA 1T6YA 4NYJQ 1DKQA 3LLCA 4P83A 4MKHA 3TR6A 5C4GB 2RCNA 5LOVB 2H2AA 1H4SA 1Q1AA 1JNYA 2ZKLA 4OJTA 4MVJH 5AESA 2WJVA 2ZI6A 2FR0A 2ASVA 3BHNA 4JITA 1ESCA 4XASA 1NYLA 1DDKA 1O8CA 2CFSA 4B5KA 2BGMA 2WWFA 1OTYA 2QM3A 4BRSA 1OMOA 4HAWA 4YCAA 2QQGA 5EKXA 2Q4RA 3VOAA 1H4VB 3W79A 3RS5A 1RS0A 1KS9A 3ND8A 5DE3A 1UJ4A 1PS9A 1FCJA 3EVFA 3SU8A 5JR3A 4N40A 2GTIA 1CPYA 4JLPA 4HP8A 1Z5NA 3UXYA 2BKVA 4MO2A 1QU3A 4JLAA 3W04A 3C7CB 3ECSA 4L0CA 1W6UA 1FX0B 3GV0A 4UQPA 4JGGA 4Q39A 3TUJC 4RY8A 2HPAA 2P8SA 3RRBA 4CDMA 4DDMA 4C1EA 3AKEA 3A1TA 3PDHA 4PRZA 3GLFE 1JKJA 4QSHA 2AIRA 3WRYA 4GWLA 5JY1A 3NH6A 4LRWA 5LSCA 4L07A 2P9CA 3MG9A 1T5DX 5CB4F 4HDKB 4LE0A 5KJ1A 4KGXA 2I4OA 4XXHA 4JT2A 4ME6A 4M0UA 2GBLC 1VMDA 2H4JA 4XM1A 5EE1A 2QN3A 4PQRA 1RHQA 4B45A 3C3DA 4RM2A 3UO8B 3GARA 5TGDA 1BDIA 1NG9A 1FXWF 1GZUA 2VJLA 1FSFA 2ZE6A 1Z6PA 1S02A 4UDYX 5I4CA 1XL1A 3HR7A 3SKVA 4Z3KA 2PJZA 2JFQA 3ADOA 3T9EA 2HBYA 4HTAA 3RVDA 4JYMA 2XB4A 4WD6A 3MPOA 5FWNA 1TQ8A 1YS9A 1QH3A 1MO6A 1LV7A 2BEWA 5F35A 4EY4A 4M8IA 2GJ4A 3V8MA 1O6ZA 4FGZA 3U19A 1GQYA 2OFWA 4YJFA 5E1DA 5EXEA 1JEYA 4PCUA 4BWFB 1T91A 3QPAA 1CRZA 3LDHA 4FI3F 4NZ9A 4GT1A 4AQDA 2BTEA 5FI5A 4G1VA 5A05A 1CQJA 3KKNA 2BEVB 4RKEA 4YAOA 2XA2A 2C4WA 2CFRA 5ER9A 3F78A 3HKBB 4R2JA 1ESEA 3D8BA 3ZLUA 1G20A 4NL4H 4KPFC 4D25A 2EDAA 1N32B 3AKCA 2JHCA 1B1CA 4GF5A 3HO1A 1IEVA 3Q8KA 5E3IA 4Q37A 4NMHA 3LT1A 5TJHA 2ZWMA 1T2VA 4I8IA 3ZNOA 1A0OA 1PVVA 3M7IA 3QV2A 4KYUA 1X7WA 4U2BA 4XW2A 2EJTA 2FF5A 5L3RA 4O2BF 2J0VA 4TKVB 5CGQB 3BKXA 1Z4MA 2NXEA 1JR3E 3IQFA 3VNSA 1MA0A 5HF8A 5E0OA 1JPNA 4BVFA 1JKIA 1JXMA 2WYWA 3AOGA 4RIGA 1G2QA 5EJ2A 1YOVB 3G8AA 2PLRA 5IJAA 5INTA 2H48A 1XYYA 1TYCA 3BMXA 1AUOA 1TZKA 2Y71A 5EFZA 1Y3FE 2GSDA 4IYRA 3INYA 4UQOA 2PRYA 3FHCB 4ZO6A 4RIEA 1X38A 1I0LA 1Y1RA 1H1LB 1PR4A 1IU9A 1YZKA 3OJWA 5K4AA 5A5FA 4C1DA 2OV2A 2CNWD 2ZCUA 3CW8X 3GCZA 4PLHA 3KQTA 4YNBA 3ZHSA 1WNFA 3NALA 3ZCUA 2A3RA 4H7JA 4MVJF 5KTKA 3K8OE 5FQCA 3P9RA 3CLKA 4B3IA 4EJ6A 4FNAA 1T0IA 1NIPA 3OKAA 1R0SA 2K6GA 4FLEA 3K32A 1T2NA 3JATA 3HSKA 4LSZA 4S35A 4C6TB 4RPHA 4PR3A 1ZUIA 5F9HA 1XVTA 4E07A 1EFTA 3ER9A 3KP1A 1UT8A 3OESA 4M9XA 1T10A 1DAHA 3VZRA 4H59A 3QX9A 4KPEC 1Y4AE 2PEYA 5ALJA 3WNZA 4QBTA 1VZ3A 5DJ5A 3J7AC 3Q72A 3IR6A 1Z5GA 1UXGA 1U2QA 3KWJA 2OD7A 3T7CA 1IJEA 5FLXA 4CMCA 3CLSC 3UMBA 3RI3A 1CDZA 4UHCA 3ZV4A 3RSSA 3EMVA 4B4DA 2AOTB 2P2SA 4UNQA 2WVAA 3RAEC 2GEVA 4XUGB 3MHPA 3LHIA 3WGOA 5EP1A 5AM2A 2I33A 1WPGA 5ACPA 1YJ5A 1ZGJA 2PSEA 2HWUA 2VDWB 5K7SA 3BRQA 3FMVA 1KO1A 5IDWA 4DIUA 3OZFA 2VHXA 2FSSA 2VTEA 4CM3A 5KOJB 4V3CA 4I19A 1UWKA 1WMSA 1SG9A 5L9AA 1QYXA 3KSBC 3SEFA 3KKQA 5CA0F 4LUCA 4KIUA 3KYCB 4RKQA 121PA 2PGNA 2QRNA 2PRZA 4N41A 2ZIZA 1R27A 2YJZA 4FSDA 4V1CA 1MRSA 1SC9A 3DW3X 1ZNYA 1EFRA 2G5CA 4D43A 2QXYA 4ER0A 3GAAA 1BC2A 3AVPA 1EK2A 3D8HA 3A9SA 2PS3A 1THZA 1O6FA 3DVRX 4KO8A 4OTZA 1UQTA 4L9RA 4DHEA 1XCGB 1Q5PA 4Z5ZA 2FG5A 2VH5R 2OGWA 2GPYA 3E4CA 1GKYA 3BSYA 3ADDA 4DB2A 3RDPA 2GLUA 4FYMA 4Y0AA 5CDFE 5C5IA 1EDEA 5AJHA 5JFGA 5HCUA 1XLTC 5JEDA 4F2WA 1JQJC 3JR7A 2GLTA 2IY9A 1C3OB 5KQPA 4E5NA 2A1TR 3WWPA 4EO7A 5A4IS 4YI5A 1I4WA 5EJ7A 5LCAA 3KYBA 4B44A 3V5NA 4CM9A 3R0ZA 1E6MA 1L5SA 2I8LA 4MUMA 2BZ1A 4FFSA 4RD6A 4BRZA 3OT4A 4Y2VA 4MVWA 3GFVA 1G4AE 2H07A 4QFCA 1KI9A 5JSYA 4D5EA 4ENVA 4LDJA 1PT6A 3TR0A 3VR0A 1T9DA 4CI9A 1D2HA 4WLUA 3O94A 3W1VA 2AG5A 2E1RA 4KBGA 4F04A 3ZW7A 4CU2A 4ARSA 4IQFA 3DDSA 4ZIRA 3ENKA 3MZ0A 4A5OA 1SKYE 2EG9A 3WQHA 3DXFA 1IXRC 2SECE 1OB5A 5ENVA 5JDCC 5CJPA 3CSDA 3O1HB 4HT3B 1UZLA 4MGHA 3W5BA 4RVGA 2FQ1A 1HOXA 1JEQB 2P2LA 3PI7A 2FR8C 3R77A 4INPA 2CN1A 2QKYA 3KT0A 1NT4A 2AJTA 3T5TA 4FYKA 3QYJA 1KORA 4LJ9A 2O1SA 4BC0A 3IXLA 4KWIA 1DCFA 3LJKA 2AOWA 1GA6A 4GX2A 5FWAA 4UNPA 6PFKA 5U4XA 1YI8A 3KOOA 3D7SA 5G3YA 2J6BA 4CHLA 3CCCA 1ZK4A 2WE7A 1IB6A 5K0EA 4N9QA 3OIWA 3EXAA 4NCXA 1P8AA 2QS9A 4BCDA 3AM5A 3KEQA 3GFPA 4M60A 5FR2A 3IQXA 4BNMA 3ZH2A 1SD2A 3D2CA 5L6MB 1EWQA 4CR6A 1R9GA 2ACKA 3GPBA 4TM7A 4ECAA 1I7QB 4PVCA 3I1FA 4I99A 4D74A 1XTVA 4K86A 5IKPA 3NVDA 4EM6A 1QIGA 3I64A 1P4JA 5I7VA 4W5TA 1QYCA 3B7GA 2EFGA 4WRRA 2Z43A 1JIXA 1TL7C 3C43A 4NX2A 5JSQA 1RQXA 5JH7F 2W6MA 1KC3A 5D87A 3BZUA 5DM4A 4HN4B 4OD0A 2OLKA 2GOYA 4I7EA 3R5HA 2R00C 1E4EB 3LIPA 4IGIA 1Y1PA 4JLWA 1VRVA 3ZIUA 4R68A 4R51A 3RK0A 1ZLYA 3OE1A 3OQPA 4J9VA 1SMKA 2GERA 2IZ6A 3NTRA 1UDAA 1WCV1 2F7SA 4FEYA 5M5BA 2ZANA 1PJZA 2W93A 2ORWA 3B13B 3AZPA 1LLFA 4LN1A 2QBYA 1DXOA 2HI0A 1EUCB 2COEA 1IPHA 2IQIA 2BF7A 4K2AA 2GAJA 3ZX5A 3DULA 1NVBA 3DE4X 3W8FA 5JFOA 1U3VA 1X9HA 3IJPA 3DCIA 4MKFA 4O4IB 1QLHA 1BX0A 3IT2A 4MVCA 1RYZA 4C5BA 3JVIA 3RHSA 5HWSA 2Z6UA 5C8VA 3A9UA 2AZDA 3QG5A 2PH1A 1IJKA 1G16A 3IP5A 3S99A 3IP1A 1WZCA 1T8SA 4JODA 3W1WA 4C06A 4JASB 2O3JA 3I9JA 4DA6A 5C81A 4DA4A 3I37X 2B6NA 1XZCA 4ZVSA 4YSLA 5DV9A 1A8SA 3L0PA 2WP8J 3FZEA 2WB4A 1TCAA 1RTKA 4AJHA 1XF9A 1YB2A 4BNHA 2P97A 1YA6A 2HB9A 4TV9B 3V4ZA 4D9FA 1KZ9A 2GFHA