5AHOA

Crystal structure of human 5' exonuclease apollo
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
314
structure length
314
Chain Sequence
SMNGVLIPHTPIAVDFWSLRRAGTARLFFLSHMHSDHTVGLSSTWARPLYCSPITAHLLHRHLQVSKQWIQALEVGESHVLPLDEIGQETMTVTLLDANHCPGSVMFLFEGYFGTILYTGDFRYTPSMLKEPALTLGKQIHTLYLDNTNCNPALVLPSRQEAAHQIVQLIRKHPQHNIKIGLYSLGKESLLEQLALEFQTWVVLSPRRLELVQLLGLADVFTVEEKAGRIHAVDHMEICHSNMLRWNQTHPTIAILPTSRKIHSSHPDIHVIPYSDHSSYSELRAFVAALKPCQVVPIVSRRPCGGFQDSLSPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structures of the Snm1A and Snm1B/Apollo Nuclease Domains Reveal a Potential Basis for Their Distinct DNA Processing Activities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords 5' EXONUCLEASE APOLLO
total genus 87
structure length 314
sequence length 314
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07522 DRMBL DNA repair metallo-beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12650 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5ahoA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5ahoA01
2BGAA 3IELA 5ACRA 2A7MA 4GCWA 2UYXA 1P9EA 2WRSA 3X2ZA 2E7YA 2WYMA 2GCUA 5EVBA 2I7VA 2GFKA 4C1GA 2BTNA 4XWTA 3S0ZA 2Q42A 5LLDA 1BMCA 3IOGA 4F6ZA 5FQBA 1ZNBA 3PG4A 4RBSA 4EYBA 1X8IA 1WUPA 1Y44A 3BC2A 3Q6VA 2GMNA 2FU6A 3VQZA 5EVKA 2FK6A 3AF6A 4TZEA 5HH6A 3RKJA 2P97A 5IQKA 3T3NA 4RAMA 2DOOA 4DIKA 1WRAA 3SPUA 5AHRA 4BZ3A 4B87A 2YNTA 4EYLA 1BC2A 4KEPA 4J5FA 2CBNA 3SRXA 2YCBA 3TP9A 1YCFA 5EHTA 4EY2A 2NYPA 4YSLA 3IEMA 4GYUA 4D1WA 3G1PA 5HIPA 3LVZA 5A0TA 4F6HA 3ZQ4A 3IOFA 4EFZA 5EW0A 4TYFA 3I0VA 1JT1A 2BG6A 5ACTA 3T9MA 2BFZA 5A87A 5A0VA 2QEDA 5KILA 4FEKA 3KNRA 2WYMC 4HL1A 5KIKA 1VJNA 4RM5A 2H6AA 2XR1A 4YSBA 3I13A 3SFPA 5FQCA 2BFKA 4TYTA 3X30A 4C09A 4WD6A 1JJEA 4Z5YA 4RAWA 5DPXA 5ACUA 3H3EA 4LE6A 5LCAA 3AF5A 2I7XA 2ZNBA 3ZWFA 2R2DA 5B15A 2BG7A 4C1FA 2ZZIA 1X8HA 3IE1A 4D1VA 4HL2A 5LM6A 2YNWA 3F9OA 5HIOA 2QDTA 3L6NA 2Q0JA 2OHIA 4U4LA 3DH8A 4TZFA 4UAMA 4KEQA 1M2XA 5LMCA 3ZR9A 3R2UA 3VPEA 2I7TA 5AXRA 2M5DA 4AX0B 5ACSA 1A8TA 2YZ3A 3ESHA 2WYLA 3BK2A 2BG8A 3MD7A 5LE1A 4GYQA 1KR3A 4H0DA 4HKYA 3ADRA 5K4MA 2YNVA 2DKFA 4TZ9A 3A4YA 3KL7A 2GFJA 4AWYB 2FHXA 4UWPB 4ZO2A 3PY5A 1MQOA 4NQ2A 4Z7RA 1JJTA 3IDZA 3IE2A 3SW3A 2BIBA 1A7TA 2XF4A 2QDSA 5K0WA 4V0HA 1L9YA 4AX1B 4AWZA 1KO2A 4EXYA 2YNVB 3X2YA 2BMIA 4UWSB 5ACXA 2YNTB 4EYFA 5ACVA 4O98A 2HB9A 2P1EA 2BFLA 1SMLA 3BV6A 1QH3A 5HH5A 4C1DA 4Z5ZA 4TZBA 1DDKA 5EVDA 5ACWA 5AHOA 3IEKA 5K4NA 2BG8B 2P18A 4Z60A 1XTOA 5B1UA 2BG2A 1DXKA 4P62A 1DD6A 4RL0A 4ZO3A 3FAIA 1ZTCA 3SBLA 4XUKA 2BR6A 5EV8A 4EXSA 5AEBA 3RKKA 2ZO4A 2WHGA 2AZ4A 5HISA 4UBQA 3RPCA 3IE0A 5ACQA 4BP0A 2BFZB 4CHLA 3I11A 2OHJA 1ZKPA 4PVOA 4NQ4A 2ZWRA 1HLKA 5LCFA 5A5ZA 4PVTA 4C1CA 2OHHA 4D02A 2Y87A 1XM8A 4D1TA 3T3OA 2FU7A 4NQ5A 3DHCA 5HH4A 5EH9A 1YCGA 2FU8A 2YNUA 2NZEA 3DHBA 3JXPA 3X2XA 4YSKA 3PY6A 1BVTA 4RL2A 5AYAA 5LCHA 2FHXB 5LSCA 4UWRB 1YCHA 4Z67A 3SD9A 3DHAA 4UA4A 2NZFA 4UWOB 5EWAA 1VMEA 4AD9A 1WW1A 2FM6A 5B3RA 1K07A 1X8GA 3I14A 4XWWA 2GKLA 3KNSA 4DILA 2QINA 4J5HA 5LS3A 2QJSA 3WXCA 5ACPA 5EV6A 3I15A 3FCZA 1KO3A 4FSBA 2P4ZA 3AJ3A 4C1EA 3ZNBA 4D1UA 5AXOA 3P2UA 5K4KA 5FQAA 2BC2A 3QH8A 2AIOA 2FU9A 3BK1A 4JO0A 2Y8AA 2Q0IA 1VGNA 1WUOA 4FR7A 2Y8BA 4ZEJA 4NQ6A 5HIQA 2NXAA 2Q9UA 4C1HA 4ZNBA 4Z6XA 2VW8A 1QH5A 2M5CA 1E5DA
chains in the Genus database with same CATH superfamily
3E9DA 1NQTA 1F12A 1VL6A 3KKQA 3AI3A 3BIXA 4XIGS 1RMQA 3AEZA 3IELA 1P6XA 4Z6KA 3ADRA 4ESHA 1WCIA 2G7MC 4J29A 4DQUA 4EHJA 3HO1A 4IIGA 4DAEA 2JJ1A 1KJIA 3SS9X 4DLYA 3KZVA 5KYXB 2CK3A 1WKBA 3FPLA 4DQKA 1XK7A 2FPPB 1CV2A 2YV5A 2I7CA 4O63O 1H4QA 3CN9A 1TIBA 1J21A 1UBJS 2QR3A 3KJQA 3EXFB 1Q19A 4HUQB 4KK4A 1P9EA 2WRSA 1AN0A 1W29A 2EWWA 3FBWA 1P17A 2R1VB 4H4CA 1MFPA 2ADOA 4OP2A 1WB4A 4HLUA 1GKUB 1LX7A 3Q6MA 5DIFA 2VJMB 4UDYX 1Y8AA 2VYND 4GPIB 4C22A 3KOXA 1LK5A 2XF2A 5FQNA 5K9ZA 2O8EA 1E2DA 1F2VA 4I8XA 4Y1RB 1EFKA 3L0BA 1Z06A 1M7BA 3GMTA 3R3YA 1TTQB 3VKUA 3PL5A 1YZ3A 5I45A 3K2QA 5KO2A 2F1HA 3FGPA 2Q3BA 1D1TA 3E58A 5M34A 2NO1A 3BRCA 4JOBA 4ARZA 1QH9A 1ZJZA 2MINB 2WUEA 2GTIA 4QEZA 4E5SA 3AR3A 3SC2B 3WSVA 3ZWCA 4OEHA 1WUTA 1MX5A 1VSBA 3GEPA 5ECDA 1JR3A 5SZHB 1BZYA 2MWMA 1J8YF 2OSVA 2X1MA 4P31A 1U0BB 5DGCA 2YHSA 3FTFA 1EUDB 3MMPA 1GL9B 3X3HA 3RKJA 3ZNQA 1CDEA 4GGPA 1Z38A 3CEHA 4OOEA 4YUVA 2C5EA 2HV8A 4WINA 1ULAA 2I6TA 2XV1A 2WUVA 4UNPA 3ZIAA 4D79A 1N2CB 1YRAA 2FW8A 1HKUA 2MTBA 2WVGA 3PFGA 2D4AA 3GEGA 5TXGA 5DXJA 4CTJA 1M2VA 1GXSB 4DMRA 1O77A 1XT6A 2M32A 3OH8A 2NO9A 4ZI7B 1ORHA 2FPUA 1NRIA 3AJ8A 3N39C 2C2XA 1E1YA 1TLLA 2QDKA 1Y4SA 3PEEA 4NPHA 5TV2A 3TMAA 2V7VA 1Z2NX 1G7RA 3HYSA 4AMYA 2JA2A 2EQ5A 4GWLA 2P3OA 3WGNA 3PCRB 2V55B 1N0IA 3G2NA 1HDYA 4YJKA 2ZIXA 1N2GA 1BCRA 4PN7A 3AM4A 5CT9A 3U3MA 3ZHZA 1MOPA 1M5TA 2WKQA 2J0UA 2GCOA 4D0LB 5AFSA 4B7CA 1NTRA 1XKQA 1R6VA 4OH7A 3OTWA 5B6IA 3P0EA 3A6KA 4C5CA 5JSUA 1F48A 4Z8YA 1U0OC 3HP7A 1TX4B 4AMGA 1IVNA 2E1PA 2QT0A 4I9GA 5CW2A 3T1OA 4N48A 3G1PA 1WZEA 4QSHA 4WK0B 1J00A 1JJAA 1JSZA 1KEUA 1A9PA 2XY4A 3AKCA 3JSXA 5FOSA 4EECA 2ATCA 2PYDA 2A9PA 4ZHQA 4TWJA 5BOSA 5IZ4A 2BBTA 4J43A 4L02A 1FFDA 3MAAC 5IVHA 3NJ8A 4QU9A 3ZQKA 1NVMB 2RHJA 2SBTA 1UJ5A 3VVBA 3ZQ4A 1XZ8A 1KH1A 1ODLA 3KV1A 3L05A 4P33A 2WC1A 4DLZA 2FEMA 1ULTA 4P1ZA 4HZUB 1XZCA 1RQ7A 2P67A 1GARA 2C4HA 3P19A 3JQBA 4RGQA 4TN1A 5KNDD 4QG3A 3OQNA 4IIJA 1F2TA 1GRQA 3B5JA 4XFKA 1FSGA 3H6HA 1T34A 5K3FA 1E96A 3ER9A 3OU6A 4KFRA 1G0OA 2QRVB 4FEGA 1AKQA 3BE8A 3EGVA 3E3OA 5FPPA 4JYPA 3HJAA 2WUGA 2E5WA 3LWDA 3ZHVA 1YS6A 5EL0A 1UANA 1WW8A 2DHEA 1Q1AA 4L2IB 1QZXA 4QBIA 4EM6A 3TTXA 5J9FA 2FMHA 3MS2A 3ZW9A 2IPMA 3VHXB 4JJ7A 3RYCB 5JNUA 1FFYA 2IY8A 2C1XA 2GZDA 4EO4A 1KBOA 5BOSB 1JFSA 1I94B 4LJ6A 1L5SA 2G67A 1N7GA 2PFGA 2IYUA 2PZKA 3AB8A 3I6IA 5DW3A 5FYDA 4BJ3A 3ZVKA 3MELA 5GJCA 4C1BA 3SIRA 2GYUA 4XTRA 2XUZA 3NNNA 3JZIA 2VBGA 4KX5A 1KBZA 1X7DA 3SSNA 3OLYA 2NNWB 2CGEA 2BFCB 1FXUA 4LE0A 3QPCA 3ZWFA 4G0OA 1KMQA 1SVMA 4GP6A 3VSAA 3BTVA 4OGLA 4JI6B 2I2AA 4ARUA 4UZSA 3D0KA 5J63A 1Y3HA 1KVSA 2B94A 2F90A 4J03A 4UEOA 4YP6A 5T4HA 3WOHA 2OD7A 4OHBA 4C7MA 2QRVA 3RARA 4KREA 5CVJA 3DUFB 1IB6A 1D2AA 4M0LA 4N3NA 3LA8A 3DWIA 3W5AA 1MC1A 2QI9C 4MLPA 2HJWA 2NN3C 3ZH2A 1U3VA 4KPYA 2ZYVX 1UPAA 3BUSA 2AW3A 3IULA 4D1VA 4UVGA 4A2PA 5HX7A 4CIXA 4MJLA 3COYA 4URHA 3RT1A 3M8KA 3L7AA 3M81A 2IXGA 3GX1A 1SK9A 1P39A 2O07A 2QDTA 3TLBA 2JGMA 3AR4A 3RVNA 3UWOA 2DZDA 1F8UA 4M1MA 1BIFA 5EE5B 4Z0NA 4CEHB 3KJXA 2NXNA 4FLMA 3TWOA 1HV8A 1P7CA 4XQ9A 1YCDA 2DR2A 1DAGA 1JSXA 4AP6A 4HX2A 5AOCA 3VRHA 4XWOA 4BN5A 4D57A 1KOGA 3ZHOA 2ANCA 4LZJA 3RI3A 2JVKA 4M76B 1KA9H 2DBVO 3HBAA 3VSCA 5LBUA 3PUIA 4C4SA 1LVUA 1P5RA 1UJ4A 2X0IA 1GCGA 2AEFA 3I5XA 2BLLA 1R12A 1U2DC 3IAEA 2V65A 1O4VA 3E3MA 3ZHQA 4P0QB 2E6UX 4L5YA 2FN8A 5K99A 5JE8A 3A25A 3I09A 2F7SA 3P0HA 3OZDA 3DMYA 3IAS1 5DM70 4WCFA 4DV3B 3CB4A 4YGYA 4WY8A 4AX0B 3PC4A 4NV3A 3CISA 4DCUA 4FR7A 2MYUA 3HRIA 4IKEA 4ZOEA 5D8DA 2VP4A 4F2PA 4QTZA 1E5TA 1IPHA 2HSZA 1Y3DE 5DASA 2KI5A 4JB2A 2A3RA 5CJPA 4CM6A 1OYWA 4D9BA 5JVDF 3RIYA 1O6ZA 3ZXUB 2YXPX 3RW9A 2OCDA 2JFPA 4V02A 4G5QA 4JJ8A 3UANA 4AFNA 3IRUA 1HDCA 1VG0B 4BBAA 3RSSA 2BLNA 3AVXA 3RSGA 3A9RA 4LJRA 4JBYA 4D6YA 4ETMA 4YAGA 3ZN2A 4W1QA 4RSHA 3IRVA 1LNSA 4JJAA 1P7YA 3L4BA 1RYBA 5H5JA 1K06A 3DXZA 3IJRA 4L5BA 4UVIA 4IXDA 2FQXA 2XCQA 3H1BA 5KBYA 1ATIA 1QH1B 2B4KA 2ZOSA 1T1SA 1U9YA 1Y6RA 2HJHA 2ZBFA 3GLGE 2GASA 4D8TA 1IUNA 1VJ1A 4DXAA 5D51S 5G3ZA 3G8AA 3NIBA 1FTYA 4JLWA 5K0JA 1RWPA 3W1EA 1Y8QB 4TT3A 1R6DA 1YACA 1F2UB 3AV0B 1G8FA 3X2SA 4DCTA 5BRNA 4DLRA 1REQA 2YJ6A 3VAYA 3PEWA 4OFBA 2HX1A 3PFHA 4U0KA 4ZOCA 4DIUA 6CHYA 3R9IA 1E79D 4II2A 1XBTA 5K0WA 3IOMA 2HDNB 1FP1D 3G5UA 5L4NA 4M3NA 3WKEA 2OSBA 5CK5A 1BQ4A 2ORYA 2R8OA 2WSMA 3EIEA 1K89A 2Q4DA 3IODA 4A2CA 4YDQA 1XNQB 1RSZA 4KTTE 4AWZA 4MVJG 3NDPA 4A1FA 1CUYA 4R1UA 3HM9A 1HEIA 3ZLUA 3OJ0A 1NVWQ 1AKTA 1U3TA 1L1RA 1RI2A 1YZNA 2G71A 3IAUA 3OEHA 3SZLA 4C3OB 1V1MA 4IGFA 1MDBA 3FR7A 4IQ8A 3OSZA 2Z5VA 4O0MA 2OAQ1 2XKAA 3R0VA 3ND6A 4ZJZA 3ORRA 3JAKB 1UODA 1JDPA 4EG0A 5ABPA 3NNSA 4OUKX 2GRAA 4KZKA 1OQAA 2ZXUA 2X0KA 3V7UA 4F3TA 1TYCA 2GWHA 4NAVA 5JNTA 3U61B 3ILHA 2WTXA 2X23A 4KPFC 4RHXA 5FUYA 2HWXA 4GYWA 3ANTA 1BRTA 3GGPA 2IS1A 1VCHA 1YS9A 2V45A 2SKCA 2GZMA 4ZVPA 4HK4A 1LDGA 2FZVA 4KQJA 2P18A 2EWMA 2PUBA 5B1UA 1MX1A 3B9PA 6NULA 1IVYA 2CMFA 2HBYA 2ZSHA 3EVFA 4B35A 5AKXA 3A1UA 3U62A 3UJNA 5M7EA 2H1IA 4R71A 1J2EA 1ZL2A 4L8GA 3SBLA 2C0QA 1L7EA 4JLSA 1XTPA 1YR3A 2X19A 4BECA 2PL9A 3VDQA 4D92A 1KQFA 4NCKA 3FYDA 4LWOA 3JQEA 4EXSA 1M2KA 2A78A 4S1NA 4M9CA 4QUHA 5HJ7A 2DG2A 4DR5B 1D9XA 2VAPA 1E3QA 4DM4A 3U4HA 2VA9A 1LLCA 4IV0A 2XNCA 5AKGA 3LUGA 3W78A 3LYUA 4C0QC 2WU1A 2OFOA 1AB6A 5FWXA 3PWSA 2YWJA 3DV2A 3G1TA 4O4HF 4QXOA 3SEFA 3G2IA 3HWX1 3L7YA 2V1XA 4N65A 4ZN6A 3WJ1A 3VISA 3VKVA 1E2QA 2PD3A 2QTVA 3NV9A 1J39A 2EF1A 4I4CA 4ND3A 5ALLA 2MCFA 3UM9A 4C4OA 4EGQA 4O3FA 3M34A 2J09A 2WWHA 1MLDA 3HBNA 3SNKA 3II6X 5GADl 3HJRA 1OYYA 1X87A 2CLFB 2Y2UA 2ECFA 5DHPA 4ZCLA 3WGZA 1QU3A 2R00A 3CH5A 3TD9A 1JHZA 4N6OA 1DBVO 1PL6A 1R27A 1PN3A 1R3DA 2V59A 3TQHA 5EUMA 2JCSA 3VZSA 1F1BA 2I0FA 4OQEA 5KPDA 3I0MA 4OH1A 2H1OA 4MP3A 3I52A 3W1WA 1Z5ZA 1Z2EA 4OM8A 1YZUA 5JASA 4E2WA 1CUEA 4HZIA 4B7AA 5ER9A 2MU1A 2YJZA 3T4UA 2GJSA 4LOAA 3LYLA 3SJ7A 5ALYA 1OA0A 3MQ4A 4YO8A 1EFVB 5D7BA 2Q99A 3H6GA 1NKSA 1DRKA 1P8AA 2DUUA 2QRLA 2WJJA 2Q27A 1JHXA 3NRCA 4HWPA 4IXMA 1Z7EA 5JQGA 1I3OA 3BD7A 3DHNA 2VDMB 3VTKA 2PXXA 4MUXA 1G55A 2PRYA 2HA2A 1N5KA 1W2GA 2OQRA 3N8HA 2XGOA 2I65A 2DBRA 2VC2B 2C8JA 1UDBA 3OFJA 4LMAA 5FOUA 3S4YA 4EAQA 3HZZA 4EJSA 2C00A 1IZ7A 3CLHA 3E9ZA 2W93A 3NDJA 2ZRCA 3BDAA 4G1VA 1PW7A 1G4UR 2POCA 2P1RA 2X3UA 3BJRA 4P7KA 3T1VA 4B2YA 3NHLA 3K8ZA 1Q7RA 2GEJA 2ATEA 1W4RA 4DR6B 4XR4A 1JG2A 1IULA 1SXHA 2ZULA 2FCRA 4PXYA 3F78A 2ZU6A 2XMRA 4UFPA 3CZ5A 4XXHA 5C8YF 3MJFA 5JAQA 5K7SA 2IRWA 3CXRA 4BZZA 5K0SA 2FJPA 3EGIA 1NSFA 4PSCA 5ALRA 1O5IA 2L19A 5FO1A 1JHYA 2HLNA 4AD9A 3F5DA 4E5YA 4EI7A 4MWSA 1Z6ZA 1FTQA 1QPGA 1ZRNA 5EQDA 1PP4A 2WD9A 2P90A 2WPDA 3DL0A 1TIKA 3C1AA 4DILA 1DL5A 1NF8A 3TSWA 4W1RA 4DA7A 1CWUA 1ZYUA 1JIQA 4PPGA 1XRRA 2AEJA 2FSSA 1QHHB 4RYDA 3G3EA 2EV9A 3RKSA 4BHTA 1G3IA 2D5CA 1KP3A 1MJHA 3P0JA 2XMDA 4EY4A 2GN2A 1WXEA 1E62A 1L5MA 1Q57A 5IUJC 2ZJ3A 4RWEA 1K97A 1XN1A 4C0KA 2PH7A 1EIWA 4KE7A 2JZCA 4RA6A 2WTBA 4PR3A 3T5AA 3O4HA 3EPKA 1KMHA 1Y63A 1RMTA 1ZOLA 2C88A 3H65A 4QX6A 4KN6A 4Y7CA 5CT5A 4BU0A 1I7DA 4L57A 3CVUA 3ZD6A 3AVWA 1KRWA 3L40A 4Q3NA 2LBPA 4U1RA 1DUVG 1LFDB 3QSGA 2H1VA 4TUYA 4E32A 5C5DA 1G8HA 3S8MA 1I2AA 3BHMA 3OZ7A 1WMFA 3K0CC 3HADA 3H4IA 1GGHA 2VDKB 3O8RA 1G98A 1Q83A 3QU7A 3OZBA 5JYEA 4O59O 2DPLA 1Z9BA 4C2UA 4CT4B 3BXEA 4NU8X 1DBQA 3NAMA 2F8LA 4R8SA 2HCTA 1NKVA 2GM9A 1U7DA 2IYSA 3FOBA 3LKVA 5EP3A 3RADC 4JO0A 2P35A 3AY3A 3PB3A 2F4VB 1WUOA 3SX0A 2IBSA 2QUKA 4BJ5A 1JU4A 1QHHA 4DL9A 3IPLA 2AJBA 4AJPA 5TMEA 3KZKA 2LR0A 4S3MA 3KQNA 2G4CA 2GD6A 3A3PA 3UAWA 1M2HA 5BMVA 2D0IA 1B14A 1VIYA 3H2HA 2XZOA 2RJOA 4R98A 4R2JA 4V03A 4YV2A 1A8SA 3GJ6A 5HFAA 4C1HA 4YQZA 3TW8A 1U4NA 1G4HA 4RJ2A 3NH6A 3ENKA 1XD9A 4ZVUA 3V8NA 4DHWA 5BXYA 4G9BA 1ZVMA 3I0ZA 5EMMA 2VDNB 4DB2A 1V6AA 4MA4A 5CURA 1KI4A 5DW0A 4QT4A 3K8YA 4HNAA 1W5TA 2RGNA 4TUYB 2GK6A 2R68A 5F35A 3FPEA 1OXMA 1ISJA 1TCCA 4NPCA 4XYBA 4NMLA 3TL2A 3G49A 5T4FA 4JLAA 2JLBA 1XN4A 2XRYA 3D8NA 3WHKA 4PNEA 3ICWA 1K4KA 1ZWKA 2HK9A 3AI7A 4GF5A 4QRIA 5E4TA 4B7UA 5ACRA 3D8TA 3EMVA 1Y80A 3I45A 3D7SA 4N8EA 2RG7A 1HYGA 1RYYA 3FMIA 5CLHA 4GS5A 2OG1A 1C3EA 2OAGA 2O0MA 5DB4A 3V1TC 5CCEA 4ZFNA 4P4GA 3KOMA 1DKMA 3NVMB 4PAWA 2CXTA 1PDVA 3NIFB 1NAIA 1G9SA 2M1XA 3Q1KA 1NMXA 3IVRA 2PH1A 4RPKA 2QJOA 4O1IA 3ZU3A 1AG9A 2VN8A 3FKQA 1W5FA 1YL5A 3G85A 3B6ZA 5JXGA 1EGVB 1GGJA 4XWTA 4P34A 4UUNA 3CCCA 3H9UA 4AROA 4IUDS 3QW2A 2NZXA 5JS6A 5D5QA 5LZ2A 3R20A 2ZIVB 2OORC 4F8YA 1XQVA 1WW2A 1MC4A 4DS3A 4GIBA 5DM0A 2V0GA 3TQRA 2L42A 1YZYA 1AUPA 3JQBC 4JHLA 4KMSA 3W04A 3ZE8A 3TXYA 4JUAA 2GARA 2GT1A 5EWMA 5CLLA 4EDFA 2IJGX 5AHXA 5AIAA 2YRFA 2AN3A 3QEKA 3A9VA 3AVVA 3FYUC 4FYPA 1UF9A 3KDAA 4D8WA 4OHOA 4FOTA 2V7QD 421PA 3N2IA 3N1UA 1NR1A 4PFKA 1JW9B 3L8ZA 1PJ3A 2HF8A 5C4IA 3HJGA 4I5IA 4C3ZA 4PE5B 4HGRA 5JY1A 3U44A 1MEOA 1NVUQ 3LQ4A 4MDEA 3L79A 5KKAA 4B3JA 4YT4A 1ZMBA 4OVKA 2LKCA 3EVZA 5CDSA 5K0TA 1FDIA 2JGNA 5A4MS 4EJ0A 1GZSA 2QVCA 4KXWA 3UHAA 4LXUA 4CCYA 1XCMA 1T9AA 3QKSA 1EP1B 5JCXA 4FQ8A 4Y0VA 2GHTA 4AG6A 2QMZA 2WG1A 3N2GB 2QSYA 3P27A 3E15A 4PZ0A 4KEPA 3L8GA 3NC4A 2JGLA 4B3CA 2RAFA 2DP4E 1JFVA 3Q8KA 5H3LA 3QF4A 4G0VA 2X14A 4RY9A 3R3VA 4FJ0A 1ZRSA 4E4TA 2WNIA 3TDMA 4Q21A 4YJFB 2GI4A 5GVRA 4BFTA 4EY5A 3OURA 3DMDA 1EUDA 1CJUC 3M6IA 2QQ5A 1IN6A 3DMTC 2HQRA 4PFQA 4D6PA 2F55A 1SIBE 3R24A 4GMHA 3O6VA 1N2CA 1BOFA 1XUOA 3WNVA 5I7FA 3ZLBA 4NU6A 3SIXA 1LKZA 4L74A 3ONFA 2XTMA 2GEBA 2OA0A 2ID4A 3QLUC 4MWDA 4TRNA 3PNOA 3TQFA 1I3CA 1BXGB 5KMGB 2PT7A 2BBSA 1HLGA 4RD1A 5B6JA 3IEIA 1F8FA 1E1RD 3I72A 4FYXA 1OKKA 2JBWA 1GPJA 1LZKA 3NB0A 2Q21A 1PZXA 3PHIA 3RSCA 2WT9A 5DYNA 1A69A 3MCWA 3IOFA 1Y9DA 3VBEA 4UM5A 4E3ZA 2WFLB 4DA4A 2HBQA 1W5SA 3ELYA 3H17A 3GROA 4NEGA 4LTMA 1CJKC 4IJWA 4JLVA 1V37A 1GZ5A 3OFKA 1IBLB 2DFTA 3B7PA 3WQSB 5K6AC 2CSXA 3T9MA 4OX9Y 1D03A 4XD7D 5GV7A 2X0FA 2BP7B 1RNLA 5JYDA 3Q8XB 1JZTA 3T7IA 2QX7A 3QTLA 1LI7A 3M6VA 1JDJA 2HF7A 3DTVB 3OZSA 2HHHB 5A0VA 2HOQA 2NU8A 3KYDB 5BW5A 5BYKA 2ZVJA 1RYNA 3ETJA 1D5WA 4KODA 1O08A 5JQGF 4KHPB 3PTAA 3SJAA 3LKBA 3RUCA 1ISIA 1CNFA 3IILA 3C8MA 3FMPB 1C3OA 3D6HA 1CUZA 1ETUA 5IPFA 1NQWA 4UUMA 2HFJA 4H60A 4J16C 2TRSB 4W6ZA 4X00A 3SHVA 1U81A 1JJVA 3WGTA 1VKZA 2Q7XA 1J5PA 2I62A 2Y71A 4EA7A 4E5PA 5D6OA 1MVNA 2AXPA 1CQXA 4MW4A 1M33A 1CQIA 4XRGA 4D80A 1RPNA 2AF4C 2COKA 2XA9A 4YT8A 2R0QC 1ZM2A 1O94A 5EWLA 3EN0A 2NPOA 4CFYA 3AJEA 4EG8A 1OIVA 1P2DA 4MYDA 1X8LA 3RJ5A 1GPWB 1IJKA 2A9OA 1G64A 2C98A 2QSJA 2V3VA 2VLBA 3FVWA 1P7VA 2Q6IA 3UMBA 4QE3A 2W6IA 4YRRA 1ECGA 1WPRA 2I2CA 3ZJVA 4V39A 5B15A 4HMPA 2VNAA 2XCSB 3ZGLA 3DEJA 4NAHA 1XX6A 4CMEA 4FB5A 4ZDKA 1WNFA 4UNNA 1T8TA 4OGWA 1Q2XA 3QP9A 1HDZA 3V1LA 5KOHA 1X8HA 4YREA 3IE1A 2HSDA 2J3LA 2EQBA 5KNBH 2RIPA 4HWSA 3FPFA 4LQCA 3DHWC 3EQ7A 2H52A 1LZLA 2W2MA 3OF3A 1ZQ1A 3W0LB 5D1HA 4XYGA 2ZE5A 4QRDA 4AO8A 4DQXA 5M29A 3HXQA 1GADO 4P36A 1AT1A 5IANA 2VJNA 2YNWA 1GGFA 2D06A 3KEQA 2JFBA 5DV9A 5FH9A 4F3CA 4R7GA 2GCIA 4F6ZA 1S4QA 1T6XA 3H7AA 3LP8A 1AQJA 4OSPA 3CJQA 2JL1A 3PTLA 2IHUA 4IHJF 1QGUB 4K6KA 5BNTA 1JG1A 3B78A 4FOLA 4CQNA 2ZJ6A 3L6NA 1G0NA 2PLNA 2Q3MA 1RWVA 3QX7A 4HDQB 4R51A 2EGUA 4YJGA 5E0KB 3TSCA 4XSHA 5JT1A 3JZFA 4B75A 4ZQFA 1DARA 1OOEA 3R09A 3OJCA 2PTGA 2OD2A 2BFWA 2DWQA 4PZPA 4U6NA 4XEHA 1ZOOA 5DNWA 3KLPX 5T3UA 1P2TA 3ER6A 4KEQA 4UU1A 1ZJJA 4GOKA 4MQFB 3INRA 3NNDA 5BT8A 5CA1A 1Y4DE 1DIHA 3B7WA 1QYIA 3NBUA 1J2YA 2P6UA 2QW8A 1NDQA 3O5AA 2PN1A 4DZTA 4EW1A 4JODA 3OCWA 4EHFA 4HB3A 2ET6A 1OI4A 2R44A 4F0JA 3EFOA 4KRYA 5FB3A 4BV8A 4D4KA 2CF5A 5LD2B 3TLYA 3RIGA 1Q0ZA 5JFGA 1NMSA 1U7HA 2NLOA 2J3MA 3ADKA 3EEBA 1JEYB 4EY7A 2Q0QA 3F8TA 3VR1A 4MSUA 4LHEA 1EAMA 2ERXA 2XZPA 4MKZA 3V5NA 1OW3B 3TJMA 2O8NA 4KVAA 2FFAA 1CU1A 4TXMA 4M1SA 1YJQA 4R8RA 3GB9A 4QA9A 3IL2A 3UCXA 3OJFA 3F1LA 2H1RA 1Y5LA 3KBBA 5TJ9A 1FFCA 3KOOA 4HH1A 1KRXA 3ZCTA 1WUKS 4UNRA 1EGAA 5JNSA 3ZWAA 1C8LA 3VYVA 1MT3A 4Q6WA 3GO4A 4C29A 3IQZA 3KZNA 1RAIA 3JD3A 4G0QA 2V8BA 4R1QA 1YT5A 4BEVA 2WFMA 4C06A 5I7AA 3ZWPA 4EFDA 5DNUA 4PHFA 3VAZA 3WFZA 1ZA2A 3DXXA 4HJXA 2F1OA 1VL5A 3CRMA 4WAUA 5CH5A 3R3WA 4LFCB 3DKPA 1ETHA 1GR0A 1X7GA 3GCGA 4UTNA 4QFMA 4FYHA 3PHHA 2HPVA 5ULLA 5C5IA 1L5NA 5LJIA 2QYHA 2XGJA 2WIDA 1DC5A 1RXYA 4N7BA 3EFOB 4IINA 5CX1A 1T5DX 1VPLA 4IICA 4DJ5X 1QOQB 3WO0A 1GAEO 1FU4A 1YU9A 2AE2A 3C3DA 3MRTA 1MOSA 1O58A 3ADBA 1PSZA 3IJPA 3A9WA 5T5QA 4E21A 3GJ3A 1F8YA 3PP8A 1R2QA 1BKYA 4IDAA 4ZT7A 3ZWMA 2JLZA 1P2GA 2I03A 4C4ZA 2E82A 2OCLA 1DAOA 3ZHRA 3QOFA 2I3DA 3LCVB 2OZPA 5IMSA 2JGKA 3HZOA 1MR3F 2ORIA 1DXQA 3LWNA 4KFCA 4ZALA 3H9BA 3G2KA 2HMTA 1JLLA 1EUQA 3OEWA 3LRTA 4IIHA 2B4TO 2XUKA 1M2JA 3UMYA 1SQ6A 2R00C 2AZDA 4RH1A 1YV9A 1DAFA 3AETB 4BLWA 1R4NB 5IJ0A 1TKBA 2O8DB 1QFZA 1GTMA 2IP2A 3FR8A 4ALNA 2ROQA 1AS2A 3TF5A 4OU5A 2A57A 3MIZA 1SKBA 3NQ41 4LGMA 2YNTB 3V8MA 3T7RA 2X9GA 4AC9A 4RE6A 3BV6A 1L5ZA 2WFAA 3WK8A 1XU4A 4NFLA 3C6YA 4AP9A 5EJ2A 2A2ZA 2E4XA 1NW9B 2W4QA 3RODA 1NR5A 1VGVA 3H2BA 4IHAA 4W9MC 1Q7EA 3WYDA 1N9GB 2HSJA 4X6XA 4Z5YA 3OLWA 2M6LA 1COZA 3M6XA 4X6LA 3RTCA 1LRLA 3VH2A 5ACWA 3IEKA 4ECEA 1N1DA 3L07A 1YNSA 3PXUA 4PR0A 1K86A 1DFHA 3OAAA 4MYUA 4C0AC 1N36B 3RYIA 3WXMA 4OXQA 3MT9A 1BYIA 2IP1A 1DD6A 2VH5R 2NVBA 2NPFA 1HE8B 3PHGA 1DRJA 4LZLA 3L8EA 3N6RA 5LLTA 4ATNA 1YO6A 5HQJA 2O23A 1YIOA 2VDQB 3HE3A 3QLVC 2R97A 3NVAA 1ST3A 5IJ0B 3S2ZA 5CITA 1Z5PA 4LMBA 3EX7C 2ONYA 2CBXA 3EASA 2X2PA 2QA5A 1NJGA 1QDLB 1NXVA 4HDRB 4JVOA 4BAGA 1RPZA 1G2OA 4XFDA 5K0NA 4CIYA 3JARB 2XT0A 3IIKA 3UICA 5T8KA 2WHGA 3KR2A 4L75A 4JJEA 4UBMA 4XW2A 4RVOA 5EUCA 4P92A 1LF5A 3D0OA 3TH5A 3A1DA 2IKQA 2PRIA 3DDHA 4F91B 4AS1A 3WWPA 1H2FA 3AFMA 4NBLA 4IWNA 4NU0A 4OSEA 1Z2AA 1W87A 4MINA 1V5IA 5JALA 3L02A 4BRWA 3RUDA 3WK5A 4ETNA 5J2TB 3IHLA 2D7JA 4GEKA 3F0TA 3PF8A 1BE6A 1GGVA 1NQUA 1I4EB 1YZQA 2OGWA 3NEAA 4MIOA 5A3VA 3UAXA 4ZOLB 4EGJA 1XAGA 1Y9ZA 2PZEA 3L7IA 2C2MA 5KYWB 3I61A 3I1FA 3MD9A 4IX1A 3ZDQA 1PVVA 1FB5A 3FPCA 4GBGA 2GN9A 3ZJYA 5A7FA 2C92A 2GPYA 3DZ8A 4LWPA 4CV3A 1UP6A 3P2MA 4K05A 2XIQA 4Q19A 2PGNA 1XLTA 2IYLD 3L0ZA 4PAGA 4PLGA 1X9IA 2FX3A 2Y1KA 4ZPXA 5IM4A 4HDRA 4LVCA 1C7EA 3BJEA 4XLTA 4EW6A 8LDHA 1E79A 3GC6A 3CM0A 5CPBA 1EK5A 1T2UA 3FJYA 4JT4A 3GFGA 3K1TA 1XZIA 1XM8A 1SCAA 2W2KA 4ZAFA 4TKVA 4WGFA 5AVOA 3G2PA 1K63A 1KK0A 4NBRA 5GGYA 2XYGA 3S2YA 5HS4A 3CFYA 1XDGA 4JBXA 4LMPA 3B6MA 1C7JA 3ZZTA 4AX8A 4ND5A 3UWMA 4RLHA 1JBKA 4CU5A 5C8XA 4FM9A 3PZBA 3NW9A 4WJKB 3EF0A 3IUMA 4EBFA 5LUBA 1MQAA 2D74A 3PUXA 4MZDA 4OLAA 3CQ9A 3PY6A 1V47A 5DYTA 3GWGA 1Z36A 3ESQA 1Z8HA 3CRRA 3GCXA 3U37A 2QMUA 1JYEA 2V6BA 4B7ZA 5CYPA 3I28A 2Q0XA 2KLBA 1S2NA 2YWCA 1BXKA 1L9XA 3KQSA 3KTDA 2FPGB 2C96A 2IH2A 2RGBA 3SMVA 2ZCJA 4D99A 4D0NA 2BMVA 2VXCA 3K72B 5ALVA 2PIAA 3VKHA 2FZCA 2NZFA 3CEAA 1QS0A 3N6XA 4J6EA 4PCLA 5A1JA 3H19A 5DTEA 5P21A 2PT5A 4NZYA 1EFVA 4D8YA 2A58A 2CDCA 4H0NA 1AQYA 2HAEA 3KAKA 4G07A 3W79A 1SB8A 1T2EA 5BW8A 2XI4A 3AEUB 3PX7A 2O2YA 2VUUA 3T0GA 4S35A 2B21A 2DWPA 4FHZA 3TD2A 2VP5A 5I7WA 4AN1A 4LSWA 1II8B 5ITWA 3KC2A 2PUWA 2OV2A 5EHGA 2ZYAA 4IO0A 4ZQGA 3T95A 2CD7A 1QHXA 1SHLA 2Y6VA 3JVUA 4H0FA 2QT9A 3FMGA 3AEKB 1E8MA 3HB0A 2NU9A 1FDTA 1ZVQA 1JEEA 3QA9A 4LXHA 2CLCX 3DCIA 1RZRD 3ZS8A 2ZM6B 3HN7A 5DHSA 5KC9A 4P0PB 2GNOA 2Q45A 1NF2A 1RABA 2XNSA 4HGOA 2V0CA 2Y1DA 5HNKA 1YONA 4M9XA 5JDCC 2R6R1 3TFQA 1NE2A 4LNHA 3AOEA 2FUG1 2H11A 2GX6A 2IOFK 5L51A 5MGBA 1J2TA 4B4UA 2P4ZA 1RTTA 3H3JA 3PK0A 1DEKA 3QBEA 1BGXT 1MFZA 2W83A 3SFTA 3KHKA 1UXOA 1MJFA 4IRUB 4Q3AA 1QS0B 5E2AA 4Z1MA 1VZ3A 3H3FA 1WULS 4IHJB 5BSKA 1QPZA 5FWYA 2OYCA 4ZVMA 2I87A 2P9TA 4BNLA 2VO1A 5I7SA 1WP4A 4P53A 4H7IA 3IDSA 4AJOA 3C6QA 3Q2KA 3S2EA 2O59A 1IJBA 3CO0S 3RC9A 3UJ8A 4MGEA 4WFIA 4ZI3A 5HWSA 4R0VA 3DPIA 1KIMA 1M6VA 1VBKA 4MP8A 1PDWA 1RPTA 2DFNA 4R2HA 4EJSC 4AM8A 4REOA 4WVFA 2YRXA 4MVWA 3FA2A 1G42A 1R88A 2Z09A 6ADHA 2PD6A 1KMHB 4BO6A 1IBRA 5DTQA 4NAUA 1FVFA 4IF4A 1TCAA 1LJLA 1P2UA 1AHHA 3NKLA 4N5DA 3KJEA 1KNQA 1SCJA 3QMMA 4V24A 1KMCA 2Q6TA 5G0SA 1KEPA 4PY2A 1G6KA 1Z34A 2CUTA 4G0MA 3RWOA 1E5DA 5HR5A 3CMMA 1DIRA 2XBMA 4KRXA 3KR0A 3BMXA 3QIAA 5L4LA 4ZKEA 1P9LA 4DVJA 1KWGA 3M3PA 1LB1B 2BGAA 2HH9A 2BBWA 3LDFA 4FMCF 1U2PA 3CY6A 3DOIA 2G08A 3QRWA 3LBIA 3FFXA 4WKPA 3THSA 1RKVA 1O6GA 3AHJA 3T3MB 4AZWA 2Q5LA 5HVNA 3CPEA 1GUBA 1XD2A 2VJCA 4LSMA 3W3AD 2OXRA 2J87A 3E61A 3EHDA 9LDTA 4HGYA 4IMRA 2A1UA 3DMNA 1DFGA 3L3BA 5EWJA 1OH7A 4C0SA 1YRYE 3RVLA 2ZWPA 4MQ6A 1WBDA 4PS1A 4GKKB 1XAIA 2JJ2D 3NOVA 1FDRA 3IUPA 2WYMA 3T7DA 2BI4A 3Q3HA 3UGQA 2RMKA 3VZPA 4C01A 2FGKA 4UM9B 2CLOB 1L7XA 3N74A 3PWZA 3AR5A 2FX2A 5JMTA 1MOZA 2J7KA 2QVXX 1WMBA 5IG2A 3OBIA 1OLSA 3I3OA 5BWMA 3FKJA 3TFWA 3T3PB 1ZI9A 3B70A 4F8JA 3HDJA 3G7SA 1JFTA 4Q9DA 1UT5A 5A2GA 1W4ZA 2JZOA 3M7IA 1H3FA 1WD7A 1VBMA 1Z6YA 3WLOA 4I8IA 5ED0A 3FHLA 4A6PA 2AH5A 2ZLBA 3ABOB 4QYTA 4W63A 4O2AF 4ITVA 1V5GA 2RGYA 1GV0A 4KEAA 3ZOKA 3WA7A 2GMNA 4Z9AA 2WJ6A 1NZDA 2VS1A 1HL7A 1NVTA 4RH0A 4YJHB 3H2YA 1Z2CA 4C76A 4QO8A 3OZIA 4YV0A 1AGRA 1WKCA 2EFHB 4GPEA 1TFUA 3SEAA 4J16A 3FIUA 4JEHA 4IIEA 4YRIA 2E48A 1QTQA 3JQ7A 3JASB 4W8GA 1TFRA 1A2OA 1RKUA 2QTAA 4C0XA 2QTMA 1TF7A 2PHZA 3KB2A 1JJEA 5C7OO 1XPOA 4FX2A 4JLUA 3DBLB 4HDNB 4ZJPA 4BNUA 1QVWA 4N40A 4DEYA 2EW8A 4M98A 4RK0A 5FLEX 3LO8A 4BOYA 3PNKA 2IZOA 2JKZA 4WLFA 3P96A 4O1MA 5BR1A 5G4KA 3F7MA 2CFIA 3EQ9A 3QV1A 4GPD1 3VTAA 2GZ1A 4MH0R 4JDPA 3BTSA 3TOZA 3NMUF 4YCBA 4OBWA 5AM2A 1F17A 4RMIA 1XJ0A 1YCFA 1N0VC 4HDSA 1OVGA 2QN3A 2GNAA 2VF2A 3CTPA 1O0BA 3OLQA 1WBBA 3CWQA 3DBRB 3H9EO 3U0BA 4YR7A 2I4TA 1XNHA 3DS8A 4NOJA 1B16A 3FCXA 2M9MA 3AJAA 3FWPA 4JOSA 2FQYA 2BUCA 2D0OB 1LJ8A 1QP8A 5CHEA 4B6JA 5IXSA 2GWRA 3DAGA 4MV4A 1XRSB 1G20E 5HE8A 5ENVA 5LZ8A 4GYUA 5BQXA 4YCDA 4EGSA 4S24A 2R8RA 2GSWA 2AJTA 1VYHA 3FYTA 1Q0LA 4PYKA 2IK8A 3BYZA 4JBNA 5EMKA 3AL3A 3GY0A 2LVBA 2WDZA 1DIGA 4KQIA 1N0WA 1N7IA 2ARKA 4JBHA 2QUIA 1AKEA 2I1WA 3I9FA 3U31A 3U3OA 4HTFA 1MO3A 4E08A 8ATCA 5LC1A 2QSUA 4GLLA 1XMOB 1BE1A 2ZJZA 2RCNA 1Y1SA 2ZTMA 4MRMA 1XDWA 3VDXA 1DKUA 4I3GA 1FS6A 2ZW9A 3I73A 2P9QA 4KAJA 5KOJA 1MVLA 1IMJA 1UR5A 2XDYA 4NK4A 4PQRA 1BW9A 3AZPA 3GJQA 4INZA 2FG6C 3M3HA 4NBTA 3VQTA 3CSUA 3WG9A 1KI7A 1FYDA 3QBTA 3EXG1 3N8IA 3T7KA 2GN8A 1SBNE 2IL1A 2G5CA 5CYFA 1DZIA 1Y82A 3GUHA 2VJLA 4UTOA 2CLIB 1ZJWA 4TRRA 2Y1FA 4PO9A 1OAOA 2UKDA 4JENA 1XZJA 2H2WA 1NDHA 4WOPA 3LSTA 4ZA2A 4P5PA 2P78A 4OI4A 2BYTA 1P5ZB 1VE1A 2AJCA 1MN6A 2H5EA 4H3HB 3N7TA 5CH8A 5ESRA 4OQLA 4HVAA 1ZVVA 3BH6A 4HNHA 2FR8A 4Y0NA 4S1PA 3LVQE 1SIOA 2IOHA 4QU8A 4WKGA 4WIAA 3CLKA 1JSLA 5KWEA 1FL9A 5L9AA 2ZWMA 4IJMA 2Z57A 1RFGE 2FRDC 2CJFA 5B30A 3RSZA 1W1WA 2CDAA 4ZCQA 3GT7A 4GXRA 4PTZA 1YQDA 1NNUA 2Q8QA 2AHOA 1MAUA 3EVEA 1Z73A 3SBEA 5ACUA 4G36A 1B2LA 3H3EA 2MHCA 4GX5A 1MB0A 2QVGA 5LCAA 2AG1A 1ESEA 2ZE7A 4MHTA 1T4GA 5KYUA 4C2TA 4MAAA 4LY0A 3VR4H 5LWHA 2CLMB 3T4EA 2RGCA 3QHAA 3A14A 1BDBA 2VKQA 3QF7A 2SNIE 3R1IA 4Q82A 3DEYX 1F7VA 1CRZA 1NZJA 3SZMA 5IS2A 4RNDB 3GZJA 4BMYA 5LDHA 4RW0A 4NOLA 2QG4A 4Z4HA 3BXGA 4Q4DA 4TSKA 1K88A 2GF2A 1UK8A 3MLAA 3MNFA 2CNKA 4DRXA 4YPVA 5KTNA 4MUYA 2ZUFA 2DFPA 3L1JA 2CWWA 3I01A 4JGGA 3KVYA 2XPCA 1T13A 4E09A 2FPLA 4EITA 2CCGA 5LM6A 3FMOB 1KIAA 2CXSA 3C97A 1H8ED 3V1KA 5B5SA 2HQBA 4EATA 3H5WA 5D85A 5FTKA 5ICEA 1OH5A 2FWRA 4NECA 1NVVR 4CQJA 3COJA 2HLDD 4QIHA 1MO2A 4AAYA 4Q4JB 1XMXA 2NW6A 4QQ8A 2FSIA 4DARA 3WP0A 5A9TA 1UKBA 1NE7A 2X22A 3F74A 5AUOB 1PK8A 1FA9A 1E7MA 4GI3A 4JP5A 3DDCA 4N0EA 2SKDA 4RGYA 3M9WA 4WN9B 5A7HA 3WGQA 2WTUA 1NW5A 3VR5H 5HTOA 3MTBA 2G9QA 4Q4AB 1NNSA 2EAUA 2WINI 4IQGA 4ZGGA 1QO0A 1SH7A 2YHIA 2ZSBA 4UAMA 3KDPA 4I55F 3PIRA 4GKVA 4C9BA 4PZ9A 4YLGA 1LCIA 5JBIA 2BSQA 2YOGA 2X0JA 3WV4A 1NBEA 1TAGA 3OO0A 1R4MB 3TMYA 9ABPA 1H3EA 3OFND 5F3RA 1FVXA 4OQNA 1C9KA 1ZN2A 3HZHA 5IKPA 4RY2A 3GRYA 1OZFA 3H2IA 2PFSA 3U3RA 1MZPA 2PXAA 1XMVA 2ZRPA 3GVIA 4D3DA 1R9GA 4JWTA 2AWOA 2LRHA 2FZKA 5FOQA 3SSMA 2MMGA 4EVSA 1PBNA 1YR8A 4UOEA 3HJBA 5K3SA 5AP9A 1ZG3A 4A82A 2JZNA 3KQVA 5GJBA 2X58A 2QNBA 3HCPA 1N8SA 2EEZA 2FUG6 3BL8A 3BWMA 4HMQA 1HZJA 5G0WA 5JPIA 1ZJYA 1HZZC 1E2FA 5COAA 3DH0A 4F3YA 2AR0A 1FVHA 3F2IA 3OLXA 4NOKA 1K8QA 4GYQA 1GPKA 3AQIA 3ZIUA 1KR3A 1ZGJA 1O96B 3GPDG 2PKRA 1SVOA 4YMSA 1GG9A 2FK8A 4RVFA 5CA1B 2DHCA 1Z3IX 1XWWA 1IPFA 2ZUWA 4J7XA 2H16A 3A4TA 5DLEA 5ESWA 2OV1A 2QRHA 3MM4A 1N6NA 3FCEA 4LWZA 4PYOA 3OIUA 3WRYA 5BSGA 4WFQA 3OOYA 1NF3A 3ZE7A 5JH7F 3FTPA 3FYUB 5BQ5A 2H3HA 1X74A 1R4MA 1BMDA 2C5LA 2F1KA 5JFTA 3VOBA 4N39A 3ZVRA 4CUKA 5BSEA 3HA5A 3OPYI 4M88A 4TTTS 4UBKA 4P4SA 2F3RA 4P38A 4TLEA 5CLGA 1SZPA 3AF3A 3JRNA 3DBIA 4HAZA 4INAA 2EKDA 2OTCA 1A4IA 1C7FA 2O1WA 1GYRA 2XB6A 3VTZA 1KJQA 1RQXA 4V0HA 4HN9A 1KWKA 2PBLA 1DBIA 1FQJA 3P9XA 4MCIA 2OP1A 4X92A 4D56A 2I33A 1KO2A 3VKGA 2EP7A 4TVBA 1SHKA 3GAFA 4FEYA 3H5OA 4IAOA 2RGWA 2Q9BA 2ZT8A 4WK2B 5AXAA 4EFNA 3JALA 3O4VA 4HOYA 2XZDA 4D0GA 1B41A 4B4KA 3TE7A 5GONB 3LPAA 1M2WA 1MV5A 1TW2A 2R1VA 1C1HA 1ZSYA 1YUNA 1ZXBA 2D5LA 2RGAA 4WESA 1SMLA 1MHTA 3OM8A 2ATIA 2GD2A 2ZK7A 3ETNA 4XB6B 4GFDA 1B8OA 3ZJ5A 4DN6A 1IY9A 5J58A 2QN6A 3UXYA 1U11A 4ARSA 3GPIA 4M0UA 2V5AA 4MVJE 2W48A 4OXYA 3RG2A 1SVSA 4QZVA 3GCZA 3EXHB 3T3IA 3CEPB 4DMGA 3WGMA 1VCOA 2FG7C 5HBGA 4KN5A 3S0JA 3I9NA 4B4DA 5JD5A 4UNIA 4B2IA 2YJNA 3GL9A 4MV0A 4AX4A 2VBCA 5C2JB 1PAUA 3K30A 1I2CA 2XWBF 5DTMA 4AZ0B 4S05A 1T26A 1F5SA 1V8DA 3FGOA 5NULA 5AM4A 3QPUA 5FR2A 3O21A 2BDUA 1NNEA 5DYGA 1MX9A 4K2HA 1BWRA 3KXLA 5DSXA 1GDDA 4YY3B 3F6SA 4O33A 4HH4A 2JFVA 3GDFA 4FGJA 3VGPA 3JALB 3WLKX 1T3ZA 4WLEA 3TX6A 3PQ4A 4U02A 3H13A 4XIFA 2FR8C 1DADA 1DUSA 5GONA 5B1IA 4F5WA 3OLVA 1PZHA 1OHHD 1GILA 5HCNA 3Q3CA 3D0QA 4GLOA 5IF3A 5HZKA 5FPSA 4GOXA 2XKBA 4FILA 4I14A 1M2VB 5GP1A 4AUNA 3QSYA 1KAEA 1U94A 3C1UA 4JJIA 5DMHA 3IE0A 4KZPA 4DTCA 1V48A 1BHJA 1P4HA 4XGIA 4A0SA 3WFIA 2CE2X 2HJGA 3AUTA 3O9ZA 4D5GA 5KWVA 3DZKA 3MBKA 5EQTA 1LS6A 2I2XB 3FZYA 5MN4A 2MSDB 4O4IA 1RHRA 3OIVA 3LBYA 1DWQA 1KSHA 1DS6A 3GFTA 3IUJA 4HVLA 4KQFA 5F52A 1EZZA 3SE0A 3Q7PA 2ACEA 5HM8A 3ZK9A 1E3WB 4PVOA 3FNHA 3ZY6A 1SKUA 2QGZA 4JX9A 4S2EA 2IYVA 1JPNA 1BU8A 3ZZMA 1KSJA 1YB1A 5EUBA 2O8BA 1VKJA 3ZY3A 4AJ1A 5JI3E 4JFAA 3V1UA 4O29A 3JARA 3X1XA 3D0RA 4JU8A 2C03A 1L5WA 1F06A 1CRQA 1P62B 3E5HA 1S3IA 4OM7A 1GTRA 1WUJS 1TM4E 3OUZA 1PQUA 2CB9A 1EE9A 3DXFA 4QJ4A 2Y87A 2CHUA 1SC1A 2R4QA 5AI5A 1EFPB 2BKUA 4YRLA 1CYDA 1KXZA 1MD9A 2NU7A 3M4YA 5KWJA 1IZYA 5KZMB 2FU7A 2G7ZA 5J4YA 2WTMA 3LX5A 1XYYA 5IH3A 1ZW6A 3PPYA 2ZJYA 3LZCA 1BXZA 2ZVPX 3H86A 4L28A 6YASA 5KU1A 2B3TA 3V3TA 1PZEA 4PF1A 5DP1A 3GARA 1RACA 1VLVA 3GGCA 4H6VA 3GGGA 3KUCA 4KIUA 2VP2A 2CZGA 4EDHA 2VFAA 4WMLA 4W5QA 3T1QA 3WGJA 2ETXA 5DEIA 3H9JA 1TJYA 1W30A 3VMFA 3G0IA 3TG2A 4WNIA 3I37X 1A9ZA 3PEUA 1JR3D 4LHYA 4C43A 2E4ZA 3KVNA 5TMPA 3G0OA 1V3TA 3BXOA 1YCHA 4LV6A 1V43A 5DNDA 5ELLA 2D2EA 2BELA 1ARZA 2I3ZA 1CZNA 4OB6A 4X3PA 4UA4A 4C4RA 2WIKA 5FUVA 2VTBA 3E9MA 4RD3A 5I9NA 3TAHA 3GUUA 2L0XA 1H65A 3O74A 1A2QA 1C1XA 3KT0A 3QVKA 3ZQ6A 2ZU0C 1T9DA 2WIGA 3TTVA 5K3BA 3UQZA 3B3QA 2PKEA 3U4QB 1OLXB 3FTNA 3CEMA 4KSCA 2DMRA 2C31A 3CLUC 3Q6NA 1SEVA 5GM2A 3CWCA 2J30A 3HCEA 4DMUB 6ABPA 3G13A 4F86A 1CJVC 3FI9A 4FZJA 5G1OA 1NJ1A 4BUCA 4O4HB 3BMNB 4V0RA 2RJ3A 5FRDA 2O7RA 3ZCPA 2O2DA 2I4LA 3ESRA 1J1UA 4JA0A 3DF7A 2D3TA 3DNMA 2FEOA 2ZSUA 1GLNA 5TSDA 4DMCA 1W52X 3HLYA 5AOBA 4GYKA 2XUJA 3E6AA 3TIXB 1XLTC 4WQMA 4KLNA 1NZFA 5FWAA 2Y93A 1KEWA 3G2JA 3RABA 4DNOA 4D41A 4F71A 4NF2A 1ZI8A 2ZANA 5JO0A 2I1LA 4RAOA 5ADUS 3AJ3A 1CT9A 1SKYB 2HGZA 1GPH1 1ZGHA 2ODBA 4HDKB 4M8NE 3HTXA 1AXRA 3KSMA 3OBBA 4BCDA 2DB3A 3UXMA 4KR6A 4Q3DA 4CLEA 3P2UA 5LXTB 1P74A 2X5XA 3QVGB 2WYVA 1TNDA 1PGOA 4XJTA 1I80A 1VIVA 2Q6LA 2C82A 2GJKA 2ZRDA 3BL5A 3FCSB 1QIDA 4ZMBA 3AG6A 5TB5A 2IEDA 4XTCS 5DJ5A 3D4NA 1RYZA 3INNA 4EYGA 1TZBA 5JWOA 3RT9A 4DFDA 1UIMA 2CV0A 2YXEA 1HI9A 1QONA 5H70A 1OGYA 2GBPA 5C34B 1F6DA 1WVMA 1R4ZA 2QYOA 3GLQA 4FQ5A 4E88A 3OPMA 1R6UA 5C5CA 1UK7A 1Y8CA 3ICOA 2OV4A 3VOAA 2WUWE 3WWOA 2VNSA 4D3SA 4U4AA 2ZBPA 1L7NA 4P83A 2LP4Y 1QR2A 2VBIA 3USCS 3AP3A 3SHQA 3X1ZA 3ZGOA 2UZ1A 3CO5A 3DL7A 4R83A 5AVZA 1UAYA 4AI6A 4H1HA 3EVAA 3PEVA 4LVNA 4BNWA 4CTNA 3R6DA 4EB3A 3OECA 1NRXA 2O8FB 3HU2A 4QELA 1ICIA 2VDWA 3IVGA 4IQ0A 4G6ZA 3URMA 3GLHB 4DM7A 1NWCA 3RC2A 2Q3EA 3QWAA 2X5KO 4D8VA 2PPVA 3A4VA 3CVJA 3RT7A 4I4IA 4DPMA 1B0ZA 2ZBQA 1JEOA 2XAAA 1GYQA 3DW3X 3IBTA 4N7JA 5CB0A 1T2VA 1D0IA 1TF2A 5DHAA 5K3DA 2I7VA 1IJEA 1Z4JA 2QM0A 3OIDA 5FA6A 2BTNA 3AWDA 5EKDA 3D6VA 4PYIA 2UXDB 1JMVA 3PT5A 2WU4A 4RVDA 1E60A 1BGVA 1GT6A 1P5FA 3Q2IA 4DM3A 2N9UA 1Y37A 5J43A 3ZK7A 2CBZA 1Q6ZA 2WJHA 2ZI6A 4WOBA 2A35A 1JRLA 4RM2A 5DK4A 3EZGA 2TMDA 2GH1A 3AL2A 2JFQA 1UP7A 2BJVA 2LWIA 1TEVA 2Y66A 4GGOA 4BFCA 5L95A 3VA7A 5J40A 1TZJA 1K7SN 1Z68A 5AESA 5TY0A 1W75A 3ZE1B 4XEUA 1JKFA 1KI6B 5DHUA 4HY3A 1NPDA 2EX1A 3FMFA 2FXIA 4LJAA 4IIDA 3LC2O 5IT5A 3TUIC 1BVRA 2D2VA 3WXBA 5D86A 3JVVA 5L3SB 2R7LA 1RTKA 3CRW1 5TPZD 3VC2A 4UARA 2W8BB 1ZP6A 3DP7A 5AK4A 4FCCA 2DOOA 4DIKA 1S9DA 2BMWA 4ITUA 4N3CA 3E7WA 3F3YA 1SG0A 4BFZA 1K6MA 3TBHA 4IDQA 2PX6A 2CEKA 5CAEA 3UA3A 4P86A 4HN4B 2YOFA 4GI7A 4RKRA 1L5LA 1B8PA 1YRBA 1U31A 2ZXFA 2BW0A 3ECAA 1ZZGA 4MQBA 5BWOA 4JB3A 2ZRBA 5JTTA 2Z3VA 4MICA 1I32A 1Y0BA 1H23A 4JN6B 1PNOA 3D8HA 2WF6A 4O2BA 4LF7B 3W5CA 4OBBA 5EE0A 1DV2A 2WE7A 3D7NA 3KR1A 4KLCA 4G5RA 3QE4A 4G3XA 4QGAA 3DL2A 5DF1A 1AO0A 1L3IA 3ZGZA 2R7AA 3LRXA 2ZYDA 1GRNA 3OM1A 2A33A 3A6ZA 4YJHA 4WKNA 2G1KA 3KVOA 1YJ5A 4ZP1A 5SICE 4G56A 1EG7A 1ENYA 3WLQA 1U1DA 2ISQA 4J0IA 2CYAA 4DMMA 5K3AA 2PK3A 3RPEA 4EF6A 4MUIA 5KB3A 3O4FA 3O3MB 1E64A 1TZKA 4MW5A 1SVWA 3VDNB 4LPKA 3ZWVA 1Q0QA 3PU6A 3VDMA 3T7AA 5HIPA 4UTPA 5KOYA 5FEUA 1FP4A 5KSOA 4EGAA 5GJWC 2Z2IA 3CVVA 5CAEB 1VYVA 1GUFA 4H08A 4MV3A 3KJIA 3GGSA 4Q05A 4M4SA 3W90A 2QUBA 2JFGA 4XYEA 3H5RA 5EW0A 2HEIA 3Q0EA 3W3AA 1JT1A 3AUFA 3L8HA 1NU6A 1JVBA 1PX0A 2I8LA 3KEFA 4MPJA 4WLOA 5IKOA 2BG6A 1KI9A 1L2TA 1S8NA 1GGKA 3BC1A 3SZGA 3THYA 1X13A 2AG6A 2Z5LA 3AUYA 4DADA 2BFZA 4NMXB 4QXRA 4EZBA 2VXOA 2C5GA 1W4CA 2A6PA 2E87A 2Z4SA 5B6PA 4FGUA 3I2GA 4J3NA 3C8DA 4FHCA 4IEIA 4KWIA 2CJXA 3TIIA 3DEHA 1IY0A 2J31A 4KYTA 4OKSA 3X1DA 2E2WA 4XR9A 3W9YA 3ER8A 1DJMA 3SZ3A 1Y3IA 4CLRA 1DTWB 1KU6A 2BOVA 2ZSEA 2OYSA 5A5DA 4ZHSA 1UZMA 3M5WA 4MR8A 1NJ8A 4WRRA 3VYUB 3UGKA 3IAFA 2Q8PA 4TYTA 3RVRA 1W0CA 3HCDA 3MERA 5L3ZA 3WL7A 1KEZA 1F0KA 1ZN9A 2XF8A 3ESDA 1GG2A 2FN4A 2YC2C 1NIJA 2GBLA 4I1SA 1GG5A 3EWNA 3WLSA 3SVLA 4RTQA 3ACBA 4B3HA 1BW9B 4TZ6A 4LOHA 1B1AA 3H5VA 4CKBA 5HILA 4MRVA 4YWHA 4C6HA 3GDHA 2AQIA 4QVGA 1KYQA 1QCDA 1P5JA 4MGHA 3G2LA 1Y3FE 1T0HB 4HI0E 4V1CA 1ZR2A 2ACKA 3FFWA 5JTUA 1AMUA 1ZU4A 4CEJB 3U26A 3LIPA 5CJJA 1N8KA 2Q5CA 2B7CA 3WRYC 4W5HA 1PJ2A 2HRZA 4W9NA 4LKRA 3GJZA 3PXXA 4ZYTA 2CG3A 2I91A 1A2KC 2B98A 3G2OA 3QJGA 2C7PA 1SURA 4RMGA 4K1LA 1P6QA 2VP0A 4NNOA 1NBMD 4Q4LA 1OXKB 4RZIA 3FJ1A 1QK3A 1T3LA 1Y8RA 4UOQA 3TSYA 4OX9B 2XDQB 4J0KA 2FFRA 3U3ZA 1QNFA 1ZKMA 4LOIA 1KARA 1UDRA 1V7CA 3CINA 3RHSA 3RVMA 4B3XA 5HQ3A 1FUEA 1HFEL 1VA4A 3OCVA 4X7BA 1ZKDA 3D4PA 1Z47A 4TWBA 1GZUA 1U2TA 2PKXA 5C80A 1K5PA 4ENSA 3AB7A 4LQLA 1GL7A 1P1HA 1RP7A 1MIOA 1U0LA 2FX5A 3EF1A 3E84A 1GRRA 4MRRA 3IDAA 4ZT2A 1KQ3A 2HK6A 1OH6A 4MQUA 1MG0A 1WM1A 4LJ8A 3S28A 4AJEA 1MZVA 2O2JA 4NBSA 1SG9A 2W2XA 4HLUC 4LVUA 3AIOA 3NBFA 4GI1A 4GZMA 1SOMA 2RARA 3C85A 2M6KA 5HKAA 2VRNA 3RBXA 3MW8A 1Q1ZA 3OOHA 4H6XA 3ZVLA 5JYCA 3FPSA 2R2GA 5KJ6A 2WAOA 3QHQA 4MPDA 3IIJA 5CA0F 1IK4A 5AIBA 2A59A 4CKZA 1JYFA 3CXUA 3O94A 1YQTA 4EUHA 3KUKA 2H5JA 3UJBA 4F4DA 2GS9A 3OEED 2OEPA 4EO7A 3K09C 3QG1A 4QQRA 1ZXLA 2A1TR 4MEJA 2GCEA 3QTTA 1USIA 3QUQA 4KRGA 4B3FX 4MEAA 2QP4A 3H2JA 4AURA 2P4UA 2WLSA 3EVCA 5FI5A 2NP6A 3VVLA 3CLTC 2B2XA 3E18A 2Y0CA 2Z1NA 3H8JA 1EUCB 2GN1A 2BGKA 3M5DA 4ZQIA 3VPGA 4DWOA 1VHLA 2FPIB 4ER0A 3I5YA 3SM9A 2YHBA 3PYMA 1V9CA 3EPRA 3RGWS 4YGXB 4JXXA 1NQOA 2AOVA 2ZWVA 4AWYB 1KQOA 1T5BA 5JLAA 5I8WA 2GM3A 2NWQA 2K4MA 2VJAA 4IHKA 4D96A 4XIJA 1GUZA 1SBCA 3ZH9B 1G6HA 2G76A 2WM2A 5F76A 2H7VA 3PY5A 1Z82A 3SQMA 1MQOA 2ZSIA 1TM5E 3IDZA 2GCPA 1VXRA 4YUWA 4B3SB 1VC2A 4KN9S 3QHPA 2OCKA 3L0OA 3BT7A 3LAWA 1Z15A 2EJWA 3BOSA 4AMBA 2XQIA 3EARA 5EMLA 4ZYWA 4HDCA 5E0OA 3KCNA 3OX1A 4KQMA 4TV8A 1CQJA 1PI3A 4JT2A 1MB2A 1SXGA 2EP8A 2Q28A 4ASUA 2FPOA 2YJ4A 3LVZA 2JIOA 4LTDA 3ORYA 4NYMR 3NVDA 4BGVA 1VKRA 5KINB 4ALIA 1O9HA 1RQPA 1HDIA 4CR7A 4RIGA 2FY8A 5AM5A 3STTA 1PV1A 3CKYA 5E4YA 5C8YA 2EG9A 1COWD 2OPBA 4F1KA 3MJDA 2SICE 1CE8A 4MMXB 1VG1A 1FTGA 1D2MA 4JSRA 1XZFA 2D00A 5B37A 1J0XO 4A2QA 1QTNA 2P1EA 1R6AA 1H5QA 3HR8A 1I1QB 4J90A 4TT8A 4U8GA 5IN4A 3DMGA 5TIIA 2ZAOA 3P0RA 1E94E 3T3NA 3QWBA 4ABYA 3MYYA 3WBKA 2FE1A 3E70C 3NOXA 5F23A 3GRCA 4A6XA 4KNWA 2XQVA 3F8WA 3GGDA 4OHKA 3STVA 4CIDA 5K4NA 1DRWA 1ZC3A 2IV2X 1U9JA 3EIHA 1YR1A 2BMFA 1PYGA 3SCZA 3FOWA 3A11A 4MWZA 1MF7A 1QC5A 1EP3B 2R84A 1KO5A 3KZ1E 4QPDA 4R1OA 4BQIA 4X93A 2JCVA 4FFMA 4PWYA 4WBNB 5CIYA 4JB8A 4BVKA 1QHFA 1DOAA 3MEQA 2P9YA 3QXCA 2JHGA 3IIMA 4ETWA 5DOVA 3RQSA 1CK4A 4XH9B 1O87A 1E63A 2EW1A 3JYOA 1JTEA 1G19A 1JIJA 1CKEA 1GXSA 2W0MA 3QLJA 3SEQA 1QP7A 2O7VA 4D44A 3B82A 3DT9A 4GMFA 1Z17A 3THWB 4NI5A 1IU9A 3R3XA 3RK4A 4XWGA 5KHAA 1SXJD 2W37A 4QICA 5ELXA 3IKJA 1J5XA 3AY6A 5HKBA 4ARCA 1NFRA 4PBTA 3DLIA 1FRQA 4I36A 1YVUA 4RV4A 4H31A 5C52B 1AQ6A 4LXGA 2XUAA 4O8CA 4YALA 5LKRA 1FMJA 4X63A 1QCCA 3UJPA 3IKTA 4WBNA 4NQ4A 3I8OA 7ABPA 1NKTA 4W7HA 4MW7A 3TXAA 1DZ3A 2AE1A 4LGCA 1ZAKA 3MTJA 1A97A 1X39A 1DCFA 4JC5A 3I1JA 3AVTA 1SBZA 4OUDA 1ZONA 4B3IA 2FF7A 2R8YA 2W2LD 4FPXA 4UUQA 5F2EA 4BMXA 4BUZA 3H0CA 4C14A 3DBOB 4D4JA 5LDDC 3L6UA 5DX8A 3JQ9C 4G09A 4HRAA 1NLFA 2YWEA 3ET4A 3NHUA 4E31A 2JEOA 4RTMA 1TECE 4DC0A 4II7A 3SC6A 5JHGB 3A6FA 1ZMXA 1PE0A 2PVSA 3ZKAA 4XUCA 4BGEA 4BO5A 1STOA 1I2BA 4EKDA 1ZEJA 2NUTA 2FSVC 4HDMA 3FCAA 1U90A 2BP7A 2IOQA 4CPDA 1E5LA 1XCLA 4PZYA 5JAZA 1W5EA 1XIVA 5AKZA 4IOLA 2VHCA 2JD1A 2FHXB 1BX3A 1OFIA 4JS0A 4K5QA 5TS2A 5B4VA 1RI5A 1XQXA 3N05A 1Q3HA 4RQAA 4L2IA 1OUMA 3A3OA 3K1ZA 1N2JA 5HCUA 4DSOA 3IDQA 4LRUA 1P4RA 4WZAA 4CZ2A 1O9GA 3S81A 1OU4A 2Q50A 4OB8A 3C70A 1T8SA 1IN4A 2JCGA 1D1QA 9LDBA 1GSOA 1RXIA 2VXYA 3GLVA 4IGKA 1FFHA 3TBKA 4YXFA 3C7TA 1J5EB 1YDEA 4DT1B 1HT0A 3GJ5A 3HVKA 3QPWA 3QU4A 4L15A 2HLPA 5F1YA 3G79A 2EF0A 5P8WA 4BMDA 1UKZA 3ICCA 3GIWA 3NYRA 1TD9A 3FBGA 4U7FA 5K4AA 4BNDB 1KVQA 1LGYA 1L5RA 2GBCA 1MNAA 2OWEA 1IZ8A 1O54A 1EDEA 2PRSA 2ZUBA 3GUCA 3K92A 4OP1A 4WPGA 2J59A 3UWKA 1NHGA 3PGVA 4LDZA 4BTEA 5CA1F 3W34A 2RGRA 1A5TA 3TINA 1W9MA 4N3GA 4AXBA 3KU1A 4XSGA 3CJRA 5AICA 3QXGA 2EZ9A 6Q21A 3NASA 3DUFA 2G5PA 3RRYA 5J5VA 4PNZA 1A9SA 1W581 3IAXA 4G0NA 2LXNA 2Z2KA 3CF6R 3P2JA 4FZRA 1JKIA 3JD4A 4C5BA 4UE3S 4JXZA 3UBTA 4YRTA 3F5SA 4R3WA 3DQQA 4JMPA 3OUUA 1FLDA 1WV1A 2WKWA 2X3FA 3DDNA 3D1JA 3AMVA 3DMTA 3QM1A 2VXBA 2G72A 3N0WA 3FZEA 2IUUA 4B5LA 1JZQA 4PN3A 4KO2S 3MHPA 1MDFA 4KK3A 3RG8A 3DEKA 4O5AA 3U4QA 1PR5A 2UXBB 2IZ7A 2W2OA 2A9RA 3F4LA 4MX8A 1RBZA 3DGEC 5EVJA 2QF7A 4RJTA 1AQUA 3QELB 3PX3A 3QE9Y 5H81A 1B42A 4KB5A 3REOA 4D46A 5I4KA 1Q91A 4J1TA 3WB9A 2R1TA 5EUQB 1DQYA 2ZI4A 1YR9A 3DKIA 2CL5A 5FV7A 1P61B 2YXDA 1I7NA 1RRPA 5DPMA 5BUQA 2HXGA 4WK6A 2FZLA 4H16A 3F97A 5DISB 5TT0A 2QJFA 1CJSA 3NWOA 3ENVA 2B2CA 2OBYA 2X8AA 4PEVA 5M5BA 5F1PA 4B83A 3LTNC 1SB9A 3GLIE 4KHZA 1OJ7A 1PJCA 4LE2A 4ZAGA 3ZBQA 1QZ3A 2KMLA 1J22A 4OLFA 2HRBA 4CR8A 2PUHA 3HXLA 1JU3A 2QTZA 2ZYIA 1S02A 3IKLA 4JBWA 5DCWA 5AKIA 4CF6A 4ABTA 1HLDA 2VHUA 2VDVE 3UMMA 1JA9A 1X80A 2D8AA 3A36A 4N8SA 2IU4A 2FSFA 4X1YA 1QGED 1INLA 4YRCA 5I7VA 2ZQZA 1X2EA 2WSSA 4BRSA 4IZIA 5A4KA 5CXQA 4BPBA 1ZPDA 3R23A 2EGGA 4GBMA 2IIVA 1Z0KA 5AVXA 2FCAA 5JJ5A 1SGWA 1SCKA 3QELA 1PD0A 3WIOA 3DB1A 3N3BC 4LC9A 4L7VA 3R6TA 5J2UB 4F5ZA 4LDQA 5HM6A 2GYVA 3N87A 4EW2A 5CEFA 3M70A 2UYXA 5AJVB 1XZQA 1IIBA 2X8WA 2ZSJA 1L0BA 1SXQA 1QZUA 3RKUA 5ISMA 5FADA 4KW7A 3U7QA 3NC1C 2EJCA 2GO1A 3KPJA 2ZRAA 1GYPA 1VJRA 3HSYA 5JDCA 2IZZA 5EVBA 1HOTA 2PWBA 3I9OA 3AERB 4BB6A 1ONSA 3STUA 5G4LA 2YJ5A 3DE6X 1RHMA 4PYQA 1E8DA 3ZWDA 1N3BA 5B64A 4UUAA 4QUKA 3ULKA 3DOUA 3FH0A 5K4MA 1LPPA 3HV2A 3UTDA 3GAAA 1A9QA 4AY4A 4XVQA 4GXQA 2X42A 1I5EA 5TJHA 2J7PA 5CX1B 2B7BA 2EGHA 1IMOA 1XRMA 2WHXA 3P20A 1L4EA 2JJYA 1WY7A 3EQZA 4G81A 1FPQA 2NU6A 4E70A 4BYMA 5TVGA 2P6MA 3WA6A 3DAHA 3BKXA 1JPVA 3PHCA 2OK7A 3LPDA 1N6RA 2ASEA 2JIDA 4OIMA 3M3DA 3I5UA 1Z6GA 3H18A 3PE4A 4GU5A 3RBVA 2H07A 1C30B 2OVBA 3FN4A 4WOCA 3FPAA 4YRQA 3BZBA 2YN0A 3AF6A 2XHZA 3ENWA 1PW5A 3GT3A 4E1AA 5J2UA 2YHAA 5LDGA 1S5PA 3ZCXA 3MAGA 1OAOC 3SQLA 2P97A 3K9LA 3DGFC 5B2FA 4PX2A 3VPAA 4M1OA 1AK2A 1GJRA 1M0SA 1OZHA 5GV8A 1NG9A 2TMGA 4MUNA 4R2KA 1CR2A 2R751 4KFUA 5CXUA 5KTRA 2HSWA 2IUYA 4BATA 2HU7A 3GRUA 1XALA 2R4TA 5J5AA 3OQHA 3U4CA 3M1AA 1JN0A 2C7OA 3G8CA 2CSUA 5H7XA 4B87A 2YNTA 3HPQA 3GNLA 1K3UB 5CJ2A 3WB1A 1WO8A 2IIBA 4F8EA 3UWSA 1YOVB 3BBLA 3MB5A 1AB5A 4QTTB 4V0KA 2ZUDA 2PPLA 1GCIA 1EWVA 1N9GA 3C43A 3D3QA 3DHYA 3WL8A 4EYEA 5CFLA 2CB0A 1VL1A 4B81A 1F9EA 2VTVA 1BSVA 3DR5A 3LW7A 4NYMQ 1UOOA 1IHDA 1XXHB 2GBGA 4MS4A 3S55A 3H9QA 5BPHA 3NHKA 3GNTA 3RYIB 5IKXA 2W8BA 5LQRA 3K5PA 3M6MD 3NHPA 4WCDA 2BGMA 2VT6A 1GEGA 1UMBA 1UMDB 1MXHA 2JJ2A 2IUTA 1J6UA 1XZKA 2GTHA 2JAOA 5E7QA 5J1SB 5FHQA 5A0TA 3JZMA 1DB3A 1L7BA 1JKJA 1M7HA 2ZDGA 1HG1A 1CETA 4HF7A 2V9ZA 3C3XA 3WLIA 3A27A 4PINA 1R4AA 2I8AA 2JGRA 1XRLA 2OQ2A 1UBTS 1RP1A 4S1WA 3LT0A 3F71A 1W73A 3QE0A 4TYMA 2Q07A 4M7WA 4TYFA 3I0VA 5E4JA 1GAJA 1F38A 5IVDA 1NVKA 3C15C 5LA6B 1EXNA 1DG3A 4OFWA 2FEAA 1FYVA 4MV7A 1JLHA 3OO1A 1T29A 2H0QA 2AV6A 5IDVA 3V2IA 2VTDA 3FFAA 2QEDA 4MMYB 4RTRA 1QMPA 1UXGA 4X66B 2H2GA 3GRVA 3FUWA 3OHSX 3ZUPA 1HNZB 2FLVA 4W5RA 1K7EB 4N9QA 1XFDA 2ZUEA 1SKYE 1VJNA 1KEEB 2BFFB 2XR1A 4CMJA 4EZEA 3JPYA 4R2WA 4YRJA 3ZY4A 1QRTA 2FVYA 1ADYA 5E6SB 4GXNA 5BWLA 1T4CA 2DR0A 3ODGA 5JSHA 4J1TC 1WMSA 2A86A 5JXIA 2QGFA 1ORWA 1X1BA 3PUZA 3V1MA 3VPHA 1XHFA 1BRMA 3ANLA 3HUEA 4R5HA 3FUVA 3H11B 1GPMA 2VJDA 2X9QA 4XWYA 5AQEA 3ZWWA 2IS2A 1A8UA 2JLCA 5EE9A 5DPXA 1E3JA 2PUAA 3GEEA 1FNNA 1ZEMA 4M1EA 4PBSA 3VV3A 1P4AA 2P3LA 4B47A 3KKMA 4K26A 1J9EA 1MRSA 3ID6C 4D1YA 1U02A 4FFBB 1J7JA 4F6RB 4F6HA 3DYBA 4BDTA 1T8WA 5BVGA 3S1LA 3TZQA 5K0FA 4F6LA 2G4LA 2GNPA 3ZV3A 1UDCA 1SOAA 5EY5B 3SSOA 2IELA 4EUFA 3HCRA 1JHOA 4M9QA 4A0QA 3VJRA 3JZAA 2C7VA 1XE3A 4AXXA 4DCVA 2O7NA 4EL5A 1PSDA 4X7PA 1C3XA 2PX0A 2QJRA 3KSDO 3TB6A 2ZYSA 1CEYA 4PZUA 2BFFA 1KEEA 4GH5A 3ITDA 4I4TA 1DRVA 5KVCA 5FTWA 2HD4A 4HL2A 1S89A 1WPQA 3VVMA 3D6TB 2BZSA 3PGKA 3ZHCA 1U3GA 3R7SA 5JXJA 4KJXA 4BX3A 4S0XA 1KGDA 1KZ6A 2PWYA 3L7BA 1L8XA 3M49A 2WBLC 4EYSA 3C5HA 4ROTA 5AVUA 1PGPA 1HLPA 2X8JB 1OR8A 2IFTA 2C4UA 4EELA 3JWIA 3FROA 1DG1G 2XQFA 4BVLA 2K7FA 2O0HA 3AHIA 1K4MA 2KSQA 3GNQA 5EJEA 4U4LA 2ZJ1A 4UMFA 4Q9IA 1J97A 5G1NA 4V1CB 4H17A 3DH8A 2EC5A 5EXEA 3HP4A 2HGSA 3K8OE 5L6MB 2ZWOA 3HWSA 1Z4OA 5IT0A 3AL0C 1M2XA 4URUR 4R2MA 1XF1A 1Z6QA 3AEKA 1B7GO 1Y5RA 1B0PA 1FBTA 2EHDA 2Q1TA 2CDRA 3REQB 5L4SA 4NXMB 4G5YA 4I9UA 1SCNE 2YWGA 3KB8A 1VE6A 3JAWA 3QEMA 4G1UC 1ADBA 4NJMA 5KYNA 1LI4A 4ZYXA 4LOKA 4L0CA 5H0IA 2BFDB 3LL4A 5EYPB 1SO8A 5ACSA 5B1DA 3JD1A 4WW0A 4XJSA 4KKXB 3K1AB 1WABA 2RK3A 3Q3VA 2V4MA 4KI0A 1CB0A 1GM5A 1V8BA 1UBGA 4TTVA 1TTHA 2C2ZA 3N76A 5G1PA 4E5MA 4E5DA 5HQ3B 3WR5A 1G8JA 4Z0HO 3E7XA 5CVVA 2QRJA 4UTVA 1MPTA 2O1EA 2PZBA 1NLZA 3EBPA 1R0RE 2KLHA 3HCWA 2B34A 4I46A 5CEEA 1NC1A 2DFVA 4DLBA 4JLOA 3U5TA 4HKYA 3DLHA 4YO7A 5KOIA 2PJDA 2PMWB 1U2GC 1Z29A 4FBLA 4Y6QA 5JG7A 5U4XA 3UZUA 3UAOA 4ZAYA 5KIAA 4OKNA 4YIKA 3HRHA 4DA0A 4QPNA 4WY2A 3LV8A 4QD3A 5JZMA 4EIWA 2B1JA 4MVXA 1R9JA 5HA5A 1T10A 4BN0A 5JAIA 2X15A 2REQB 2AMVA 2WPDD 2X5JO 2QL7A 3EQ2A 2QMYA 3ONDA 3PE3A 4TWZA 1QH0A 5E9QA 5IW8A 4QLBA 1I24A 1NY5A 1NRWA 2BFNA 2E3JA 2FEWB 3BE6A 4NESA 1T5LA 4KNVA 4Q3KA 4RXTA 2YZNA 5TR9A 3A6HA 4N9WA 2PMKA 3RSHA 3THXB 9MHTA 4CF5A 4R7TA 2PLRA 4CQLA 1WXFA 4Q1DA 2YZ2A 2C5FA 4ENWA 3PXAA 1NUAA 2XMSA 4JIMA 1IBSA 3K9BA 1V8OA 5TT1A 5JI2E 4J91A 4NH0A 1LNQA 4TMZA 2ZR8A 2ZPUA 1SQ0A 3LFHA 3P9QA 2JFWA 3C7KA 1ZD3A 3DO5A 3G17A 5I9MA 5A23A 1EWTA 2P5TB 4EENA 1DPGA 2HUPA 1WA5A 3N6VA 4AO6A 1ISGA 1P19A 2RJNA 3HC7A 3D2CA 3GAMA 4HXFB 2RGEA 4NNJA 3RYHB 1QHEA 5UKDA 5ADWA 4HPWA 1ZSNA 2RK6A 4HD8A 3EGXA 3OPYB 4NYIQ 1A98A 4A4DA 2H65A 3NIWA 1QQAA 3ML1A 2ISSD 1TZCA 2DWOA 1JXMA 2BKVA 4XYMA 2GEUA 1KJYA 1FSSA 1XYGA 5GAJA 1V3VA 3C1TA 2ZS9A 4FN5A 3KHUA 1Z4KA 3L41A 2QTFA 3WWZA 4RVSA 4P58A 1A7JA 5C53B 2HV9A 4RU1A 4YLYA 1O94C 1RAFA 4N0QA 2XB2A 2AN9A 3EG9A 2WG2A 4F9FA 3PDHA 2PO7A 2EJBA 4YONB 1M1YB 4JQCA 1G18A 3KOYA 4E2XA 1FZTA 1BMQA 1C9DB 1E61A 2XCIA 1HE4A 2BFBA 1PWZA 2W43A 2W6CX 3F8SA 3JYNA 1NN1A 3ADPA 3N3AC 4LY6A 4MQMA 1Z2DA 2H31A 2P2SA 4YAKA 2OHGA 3A58B 4P62A 1RRMA 2Q5OA 1FRNA 1EH5A 1XMPA 2KE5A 4Y8VA 3AEXA 5TMBA 2QKYA 4KXLA 5AR1A 2G9NA 1N9ZA 5I9BA 3EMKA 3AJ9A 3TLKA 4UHJA 1WY5A 3OY2A 2WWFA 2HPAA 3G9XA 1RRCA 3M1LA 1CRPA 3T0FA 3U44B 1N2OA 1EHCA 4CI9A 5DHFA 1J8VA 2ZRFA 3EY4A 1IQRA 1G21B 1L4GA 3B6EA 3HXOA 4FFSA 1L7RA 1BD3A 3QKSB 3M2TA 5AVWA 1ECCA 2Q7DA 3FUXA 4QNMA 3D1LA 5K8LA 4JLMA 1OAAA 3T54A 3RPCA 3AX6A 2MYTA 1Z88A 3D8UA 1JDSA 2VOJA 4M46A 4YROA 2VDUE 1R5NA 2CMGA 1E0AA 4JAVC 2ODEA 1JMKC 4OYYA 3LQYA 3T7TA 1H9AA 4BLOA 3OE4A 1Y8ZA 1YK1A 2WJ3A 4GMKA 3HP1A 4EHKA 2DEUA 2QIOA 3CW8X 5HGXA 5DZSA 4FNMA 3O1LA 1W19A 1MH9A 2VP6A 4PSKA 3WAKA 1A7UA 1YC2A 1Y9JA 2AJLI 5T4BA 2J9ZB 1X94A 2GAFA 1Y44A 3EULA 1SCIA 4DYHA 4JSTA 4D43A 2P6RA 2BCJQ 4C4AA 1V4NA 4EG5A 4FTWA 1E2NA 5EFOA 3ICQB 1EZ4A 3JAMA 3EEIA 2QNIA 4E1BA 1PR0A 4QO7A 3NGMA 4TUYF 1YBAA 1FNCA 3SJUA 2O8EB 2NZUG 3O8DA 1Y7LA 2J9RA 1CPYA 1LSUA 3FNQA 3LRPA 4FIDA 1FQWA 3LOQA 3MWKA 4LYAA 3DVAB 3THWA 4F2GA 2X9VA 4QUIA 3TPFA 4Z3OA 4P2GA 5JCOA 4EL0A 1QAMA 4Y9SA 1ZCJA 2BGJA 4ARZB 5A7GA 2X40A 4IKPA 3KWMA 4YRDA 2YNUA 1AZWA 3SYLA 1COWA 1N6OA 1WX1A 4EQ6B 1IQ0A 3SNHA 1OI2A 5CMLA 2NMVA 2Z6AA 1W9HA 1G8GA 3FF4A 4PTYA 3MC1A 1WZNA 2I6GA 3BH7A 4RL2A 4X7RA 3OPQA 4TMTA 2CKMA 2G0NA 3EGDB 4NLLA 4IJ6A 5ALKA 4BE4A 4HQRA 4DY4A 3IQFA 4YACA 5CFZA 5H9WA 2JFNA 1S7CA 5HMMA 3N53A 1XSEA 1F51E 4Q3LA 5C8ZA 4EEKA 5KVQA 2B6HA 3DZDA 4M0DA 3OQMA 1D0VA 3DHAA 4ZRMA 4JLPA 1FYXA 4KR9A 2IIQA 4UWOB 3B6JA 4JQYA 3VBCA 2IYYA 2BSXA 4IGEA 3UC5A 1SAYA 4BB0A 4IIUA 4IOMA 1D5CA 2GHQA 2W5UA 2HREA 2F3QA 4D98A 4HHEA 4YC7A 1S7GA 1CBUA 3ASYA 3HBLA 2F9LA 1IQUA 2JFZA 1EM8B 1K07A 3Q88A 1GZDA 4ANFA 3N2GA 1DINA