5AHOA

Crystal structure of human 5' exonuclease apollo
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
314
structure length
314
Chain Sequence
b'SMNGVLIPHTPIAVDFWSLRRAGTARLFFLSHMHSDHTVGLSSTWARPLYCSPITAHLLHRHLQVSKQWIQALEVGESHVLPLDEIGQETMTVTLLDANHCPGSVMFLFEGYFGTILYTGDFRYTPSMLKEPALTLGKQIHTLYLDNTNCNPALVLPSRQEAAHQIVQLIRKHPQHNIKIGLYSLGKESLLEQLALEFQTWVVLSPRRLELVQLLGLADVFTVEEKAGRIHAVDHMEICHSNMLRWNQTHPTIAILPTSRKIHSSHPDIHVIPYSDHSSYSELRAFVAALKPCQVVPIVSRRPCGGFQDSLSPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5' EXONUCLEASE APOLLO
publication title The Structures of the Snm1A and Snm1B/Apollo Nuclease Domains Reveal a Potential Basis for Their Distinct DNA Processing Activities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 87
structure length 314
sequence length 314
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07522 DRMBL DNA repair metallo-beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12650 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5ahoA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5ahoA01
3BK2A 1VGNA 2Y8BA 4Z67A 2QJSA 3IE0A 5KILA 5KIKA 4F6ZA 1DXKA 5EV6A 3BC2A 3IOGA 4GYQA 2ZWRA 5HIOA 1QH3A 4J5HA 4O98A 3T3NA 2Y87A 5A87A 3X2ZA 5FQAA 2GMNA 4HL2A 2BTNA 4D1UA 5AXRA 5HH5A 1JJTA 2QDTA 1HLKA 2YNTA 4BZ3A 1Y44A 5LM6A 4UWRB 3IOFA 3ADRA 4H0DA 5K4NA 4PVOA 2ZNBA 5EV8A 2Q9UA 4Z6XA 4HL1A 2OHHA 4FR7A 2BFKA 3KL7A 5HH4A 5K0WA 1BC2A 2YNVA 2WHGA 4PVTA 4D1TA 2BFZA 3SPUA 2BGAA 5B1UA 3L6NA 1P9EA 4DILA 3ZNBA 5B3RA 1X8HA 4XWTA 4YSBA 2P97A 3DHCA 1KR3A 3ZR9A 4NQ2A 2WYMA 1WUPA 2GCUA 3VPEA 5DPXA 1ZNBA 3PG4A 4J5FA 5FQBA 5LSCA 4WD6A 1QH5A 3KNRA 5LMCA 2I7TA 1XM8A 2BG8B 4JO0A 5EW0A 1BMCA 1XTOA 5LCHA 5A0TA 4V0HA 5B15A 5ACTA 1E5DA 5HH6A 5ACWA 4UWSB 4KEQA 5ACVA 2NYPA 2AZ4A 2YNUA 4FEKA 2FK6A 4EFZA 3AJ3A 4C1CA 4UWOB 3X2YA 3A4YA 4AD9A 2BG6A 1MQOA 2P4ZA 5AHOA 2FU9A 3I13A 5K4KA 2FU6A 3I15A 5K4MA 4EYBA 5LE1A 3SW3A 3I14A 2ZO4A 3SBLA 2YCBA 1WRAA 2QDSA 3WXCA 4TYTA 5AXOA 3FCZA 4B87A 3ESHA 4AX0B 5A5ZA 4C09A 3I11A 3PY6A 2BR6A 2GFJA 2NXAA 5EVKA 1A8TA 5ACPA 2BIBA 2GFKA 3AF5A 5LS3A 2WYMC 3IELA 4C1DA 4Z7RA 1DDKA 2FU7A 3IDZA 4EYLA 2BG7A 4DIKA 4AWYB 1SMLA 2HB9A 4D1WA 4C1GA 2Q42A 3ZWFA 3X2XA 4KEPA 1KO2A 2VW8A 3PY5A 2DKFA 4NQ5A 4UA4A 4P62A 4RL2A 1ZKPA 4EXYA 2BG2A 1BVTA 2FHXB 4ZNBA 4TZEA 3S0ZA 2YNTB 4GCWA 3DH8A 2FM6A 4XUKA 2BFLA 3LVZA 3SRXA 1VJNA 5EVBA 3RKJA 1YCFA 3X30A 3ZQ4A 3P2UA 4EYFA 1JJEA 4RM5A 5LCFA 4TZBA 2AIOA 1JT1A 3QH8A 5AEBA 2XF4A 2DOOA 3KNSA 4AX1B 2A7MA 1A7TA 2M5CA 3I0VA 5ACRA 2QEDA 2WYLA 4CHLA 4Z60A 3BV6A 1ZTCA 5EH9A 2E7YA 1VMEA 2ZZIA 3Q6VA 3BK1A 5ACUA 4XWWA 3VQZA 4HKYA 4UBQA 4C1FA 1WW1A 3R2UA 3T9MA 1X8GA 5ACQA 4EY2A 3H3EA 5AHRA 4NQ4A 3IE2A 2R2DA 3T3OA 5ACXA 5LCAA 2Q0IA 5A0VA 2M5DA 4NQ6A 4FSBA 3G1PA 2WRSA 4ZEJA 4YSKA 5EVDA 3FAIA 3SD9A 2FHXA 4C1EA 4D1VA 2CBNA 2P18A 5HIPA 4TZ9A 4Z5ZA 1DD6A 5EWAA 5AYAA 4C1HA 1X8IA 5EHTA 4ZO3A 2XR1A 2GKLA 4UWPB 2I7VA 4AWZA 2P1EA 3AF6A 2FU8A 3DHAA 1WUOA 4D02A 4RAWA 4EXSA 1YCGA 4ZO2A 2YZ3A 2NZFA 3RKKA 3SFPA 5IQKA 3DHBA 4RL0A 2BG8A 4LE6A 3TP9A 2Q0JA 4UAMA 2UYXA 2I7XA 2YNVB 4Z5YA 5ACSA 2BFZB 3RPCA 2QINA 3IEKA 2OHIA 4TZFA 2NZEA 2BC2A 2BMIA 5HIQA 4GYUA 3IEMA 2Y8AA 4TYFA 5LLDA 1K07A 3F9OA 1KO3A 2H6AA 4RBSA 1M2XA 3MD7A 4F6HA 3JXPA 2OHJA 2YNWA 1YCHA 4U4LA 4YSLA 5HISA 3IE1A 5FQCA 1L9YA 4RAMA 4BP0A
chains in the Genus database with same CATH superfamily
4I55F 2QZ9A 4RYDA 1Q0HA 4C0XA 3FPKA 2ES4A 1ONBA 3EH1A 3MGAA 2Y8BA 4RWEA 4X00A 1U8ZA 2QJSA 3T6KA 4P3NA 2IV7A 1T2UA 7GPBA 5ITZA 2QX8A 4NP6A 3S0JA 4EA8A 4MWBA 3INYA 2Q0QA 3ZJVA 4FR5A 4HNHA 3TYXA 3HI6A 4EJ2A 5KZMB 3A9CA 1R5JA 1T8UA 4X3PA 1E98A 1V48A 1XAIA 1YQWA 2GN0A 3K9GA 4W8HA 4C30A 2QTTA 3V5NA 4C4RA 5JXHA 5C81A 1WEKA 5CBPA 3UK7A 2GESA 2HK8A 4CEIA 1G8KA 4QHSA 2HEGA 1RTKA 4IQ0A 1W94A 2CJWB 4QSHA 3ZHCA 1W59A 3RH0A 1OX4B 2FXIA 1GIAA 2ET6A 3MWEA 3IEUA 2P4EA 3JAKB 3MTIA 1MAUA 3U4DA 1E9CA 3S2YA 4BNDB 3DZFA 1FYEA 2BT4A 3PJRA 4YQZA 3IAUA 3NX4A 5EJGA 3W5IA 3RVQA 1GFSA 1RWXA 1W29A 4JOBA 2F55A 4CW7A 4YROA 1UJBA 5EIBD 3NOOA 5A4JA 2CFUA 4X7BA 2BGWA 5LWHA 1P72A 1WCV1 1TEVA 1KPIA 1Z22A 4FOOA 4L4XA 1OROA 4W5QA 1G8GA 1NRJB 3RROA 3DZ8A 4CF5A 1GV0A 3K70B 4Z4GA 4DQDA 4K6GA 4N5LA 4H0DA 2I1QA 3KCQA 1NG9A 1PWHA 1M6YA 3EF3A 3A1UA 4DA4A 3SQXA 3DAYA 3DFIA 2BONA 5JSKA 4E5VA 5I8PA 1O7JA 5JXGA 4C7OA 3G6WA 3SLGA 3OE5A 1BKDR 4R0VA 1SUCA 1TF5A 2Z1MA 2YQZA 4DL9A 1XTQA 3FIJA 3H2JA 3TIGA 1BQ3A 2JEZA 1VJGA 2VF8A 4FSXA 1T8TA 1F0KA 3FLAA 1OHHA 3NC1C 4ZC8A 3TRIA 4LW8A 4IRUB 4U6SA 4EK9A 4OQXA 2I76A 4MW2A 3VR5A 3QLUC 1XZFA 5B1UA 2QQ5A 1E2HA 2R00C 1DI0A 3JR7A 4K6OA 5KNDH 2ILTA 4UHDA 2BR3A 3MMPA 4OH7A 5LMUB 4PLTA 3K9NA 5CFMA 2QPLA 4ND8B 3GRPA 2XHZA 2VVTA 4II3A 1NLFA 1CRPA 1DIGA 1OE0A 1O6CA 1UBFA 3TLCA 2PLNA 2R1TA 3OEEA 3IP1A 5GONF 3W6ZA 2XA2A 4LGYA 4TN5A 1KF0A 4D57A 4Y6OA 4YAEA 1FUKA 1Z5GA 3DBOB 1R50A 4KYIB 4HEQA 4LVCA 3PRKE 5K3BA 5EUQB 2BFMA 3CLRD 2DH5A 4K1XA 5FTJA 4MDFA 3L6BA 5HKLA 4A15A 1QUFA 3IUYA 1F2TA 2IS6A 3U7EB 4MDHA 3LNTA 1NXWA 2O2YA 4MVJM 4IH4A 4HZUA 5AJYA 1IEVA 4FWTA 1NBEA 1HGXA 1K98A 3PDIB 3VH2A 1QMGA 2AOWA 1YASA 3P45A 4S1TA 3C1UA 3T94A 2G8NA 2AYXA 2QTVB 1WX1A 3IVAA 2JAOA 4IHJB 3THYA 2VYND 3WZMA 5A1JA 3ORRA 1EJ2A 4GMXA 4KWIA 4R6XA 1S2DA 1BMCA 1FLDA 2IITA 5WRFA 4KR2A 4I55A 1NN3A 1XRNA 5AVWA 5LMZA 2OBFA 4DIEA 3AVYA 1E5DA 1KAGA 2XMDA 5AVQA 1JRLA 4BCDA 5JECA 1HDYA 3NBXX 3U31A 1V8DA 3PJFA 4M1ZA 1UOOA 2QYHA 4R2IA 5DHAA 2JFZA 5ALHA 3IQDB 4RD0A 1KY5A 2J5QA 1BHJA 1H4VB 4LVUA 4FKMA 4B2YA 1GL3A 2WWRA 4L6AA 4DEVA 3C3JA 1B8OA 4AD8A 1OLSA 5ENDA 3PIIA 1NVVQ 2GYYA 2RAVA 5A7FA 4UXIA 4CQMD 1J06A 1Z4LA 5FJJA 3QSGA 1Z16A 1ZSYA 1LC3A 5DI3B 1PNTA 1P2BA 3H5LA 1VDZA 1ESNA 3DJFA 3KSDO 3NB0A 3QXJA 1T29A 5EE0A 4TWJA 1XMOB 1QQBA 4C05A 2FU6A 1FBNA 1H1DA 4L8YA 4QU8A 5F3RA 3I1IA 5K4MA 2I65A 2YZGA 3KQOA 2ZIXB 3G8DA 1FNCA 4CV0A 3RIMA 3JWIA 1K8YB 3MJHA 1MABA 1PR2A 1X9GA 4G67A 4D96A 3LHSA 5TS2A 1CLEA 1CUCA 4P3YA 7AT1A 5E6UB 5HS4A 2DR0A 2CBZA 3KT8A 4QUJA 2V5AA 2JGKA 3ZY6A 3CX4A 1SKQA 4O2AB 3ZDBA 3AO0B 1P5JA 5E6SB 3EC2A 4F9FA 3GCWA 3FNFA 4WZAB 1M34A 1ULAA 1Q91A 3B60A 3CIOA 3N74A 4Y9SA 4EVIA 1O54A 4P86A 1U7XA 2C03A 1V3TA 2PTGA 2PX0A 4JKIA 1ULTA 2G3YA 3OCZA 4NNJA 3ZV5A 4DXAA 5I9NA 3MLBA 2W6JA 4IIYA 3SIPA 2O19A 2R6AA 8OHMA 2CXQA 4BKOA 1T91A 4QEZA 2UVPB 1C14A 2Q1SA 4KODA 2IH4A 1A8TA 3BHIA 3ZIDA 2FETA 3EOAI 3LBIA 4C5BA 4V1CB 5K3CA 3LY7A 4JEIA 1VCMA 4MB0A 3G7SA 5KNBH 3T9BA 1A8QA 4RF2A 3FTQA 2AJTA 1EVQA 1U1FA 2UYOA 1KKLA 2XWQA 4I1RA 1ZHHA 3J7TA 5G1PA 2IV3A 3QKUA 1OMOA 3FCAA 1T35A 3K94A 3OWOA 5BQOA 5KNCA 1A1VA 2GM3A 3WMFA 3H9CA 3ASUA 1NGSA 1XCOA 4DARA 4F5DA 1HZJA 4YRLA 2ZAMA 3QEAZ 1A7UA 2C7OA 1FP4A 4KMOA 1LWNA 3KQVA 5GONA 1VL1A 1QGDA 1KFBB 2ZRCA 2X3UA 1HETA 2XITA 4HDKB 4OJNA 5GQSA 3VVLA 4DOMA 3ICOA 1OA0A 3PC6A 2BFWA 4EGJA 1PFGA 3VFDA 2FPRA 2FZEA 1UMBA 3F78A 3LWBA 4QPZA 3VHLB 5IT5A 4MA0A 4LZJA 2VDWB 2R84A 1SQFA 1Y1SA 1F8XA 4FMCF 4QO7A 1YVDA 1VDMA 1Y6JA 2JBAB 2DCUA 5SV2A 2ZKLA 3B8EA 3MS7A 3X1DA 4H60A 1OZGA 2R7AA 4JI1B 2C0QA 2K6GA 1KI6B 4ARIA 3N28A 4WXEA 1QP7A 1L4FA 5J5VA 1RRGA 3S0ZA 5DP1A 1XZHA 5HKAA 1Z8HA 1QHXA 4FFVA 1T6NA 5H82A 4WUTA 1ODTC 5D8DA 4I46A 5FUBA 1P29A 2E0IA 3IPRA 4N8DA 1QR2A 4R8VA 4WXYB 5TEWA 4UHBA 2AYYA 3CUUA 2WKRA 5JCOA 3TINA 1EINA 1D2RA 3FPHA 1GP2A 5EMNA 4TTPA 5F2NA 4HWOA 1E60A 2WAAA 4LTMA 4OG2A 1I4TD 5FBWB 5EVBA 1P73A 5AVUA 3C98A 1I36A 1J21A 1T2CA 4K86A 4ZA2A 1JKJB 2FFJA 4JKYA 4HVLA 2FPPA 2OORA 1A8IA 4CT5A 1YU9A 1V4VA 2WWTA 2AI2A 2GEJA 1J0BA 2GBIA 4I9GA 2O7QA 2WOOA 1GY8A 1MP0A 2ZJZA 3KOOA 3NHLA 4MQLA 4NH0A 3TNDA 1NVVR 5FFNA 3JQ7B 1J5PA 3X43A 1Z6TA 1CRLA 1E7RA 3EZFA 3JV7A 4LTNA 4U02A 2AIOA 4FD3A 3AIOA 4R16A 3VAYA 1QZXA 3DUFB 3E9QA 2PZLA 3STTA 1XPOA 4JHXA 1Z5PA 4DV2B 4PANA 3LGXA 4JBWA 5KNDD 3DZDA 2ZRKA 2XLBA 1KK0A 3G8BA 3ASYA 4PAWA 5TT0A 2OHVA 3RPEA 4C01A 4AXHA 3K8YA 1GT91 2ZRJA 4PYKA 1CQWA 2W6MA 2DQZA 3GEGA 2ISQA 3QU4A 4JITA 4L9RA 1Z0DA 3OM0A 4FN4A 1XDUA 3I6MA 3RQIA 3Q8MA 1J0CA 5KTKA 1U3FA 3K2BA 1JYEA 4MJXA 4ZVUA 4BIMA 4O08A 5CT8A 3F49S 3ST7A 3CUSA 1AM4D 2IBSA 2R1VA 5CK5A 1BSVA 4KXLA 3T7AA 4BNGA 4DYDA 3O4VA 1NRXA 1P60A 3CZPA 4F9EA 2QEDA 4ARZB 4ZALA 1LDBA 3R5XA 3G2NA 1Y3DE 4K9SA 3ESZA 5CJJA 4BBJA 2E4VA 3O82A 1OFIA 4ZPJA 5I51A 2W83A 5TRTA 3NW9A 5L3RA 4BFLA 2Y67A 2F2TA 3UT6A 1YE8A 5JVDA 1IONA 1L3BA 2M2IA 4TMZA 2WF6A 1G291 2BL4A 3TX6A 2EL9A 1KMIY 4KGVA 1S7GA 2OAGA 4Y7CA 2CCKA 4BFYA 2X6TA 4BEBA 1XU4A 1SU6A 2JJ1D 4R7TA 1KHHA 4MW9A 1JXAA 1GYQA 1SBTA 1X3LA 3AJ8A 4IIUA 3ESAA 4XOIA 1KH3A 5LZ7A 3V4FA 4YT4A 5IJ0A 1GQQA 1RLOA 1A8PA 3M1YA 4P4SB 3UKJA 3ZLUA 3QUAA 5IS2A 1IMOA 2PGJA 2QNBA 3OCUA 1KYZA 5F7OA 3KT6A 4R7GA 2LZ0A 4U7WA 4W6QA 2ZSHA 4BWVA 2QQEA 5KQLA 1JV2B 4U9IS 2O3JA 3G9QA 2NYAA 4TKVB 3X1YA 5GJWC 3C5HA 3IQWA 4AS3A 2R8XA 4ZVTA 2NACA 3KWFA 5C9ZA 1HNZB 4C2AA 1XHEA 3L1KA 3GWGA 3ILYA 1N6OA 4HAVA 3GP3A 4OXNA 2OOKA 1E2LA 3G2QA 1H93A 2SKEA 1TK3A 3NGXA 1VG1A 2B4QA 1MRSA 2EAUA 4O29A 3WNZA 5JSFA 2G1UA 3BHMA 2PUAA 3C2QA 3NYWA 4ZEXA 1N7JA 4EY8A 5B58C 2X8BA 5CW1A 3DKKA 3QFSA 1HLFA 2OC4A 2JGEA 1R66A 2JKYA 4ZTUB 5AKEA 4H7DA 2GEVA 3KJQA 2QG6A 3AK4A 2ACEA 5TMEA 4CVNA 4D4MA 1TW2A 3S44A 3EZ7A 3NOVA 2JA2A 4NQ6A 3DKIA 3GAAA 3ZWVA 1NMZA 3CV3A 4FFLA 5MN6A 3DBVO 5LZ4A 3AUSA 3FTDA 3B6ZA 4DV6B 2I66A 3PX3A 1BW9A 1SXJB 1TK2A 4IFIA 1RLUA 3ZXSA 2FHXA 5A6SA 4C1EA 2A7XA 1O77A 2C1EA 2HO4A 3DEJA 3DMNA 3VPCA 2AJBA 3WL6A 3CLHA 1DLIA 2D2XA 3PGKA 3PHLA 2AMVA 3WLRA 1FDTA 4KO2S 5CEJA 2YYYA 3GGSA 4LYHA 4TZ9A 3ZZUA 5THKA 3AIMA 1YJQA 4U2EA 5JAOA 5FH9A 3FUXA 3H2IA 5HIAA 2B1GA 4P0PB 1NDHA 2QX6A 3ZVLA 3JZAA 3WAJA 4KQKA 3QKSB 4C1HA 1FU8A 1LPOA 4GT1A 1Q14A 1NXOA 6CHYA 2WUGA 3O31A 2XR1A 3DPUA 2P3LA 3GHHA 3BB4A 4FOSA 4L2IB 4BNNA 1AMUA 3S81A 4UWPB 4U2FA 1C0PA 2Z1NA 3DLBA 3AIIA 2VF5X 2HQSA 5B6PA 4YJKA 3WK4A 2CHVA 2XWBF 4QQRA 3ZU2A 5JARA 5ICGA 3DHAA 2P1RA 2W2TA 1KJJA 1Q1ZA 3DSRA 2YXEA 2NTYC 4MUNA 1NLZA 2QZZA 2B4RO 3CONA 2VJYA 4HAYA 5F7JA 5CFPA 2PRKA 1NP7A 4MRSA 1I1HA 2BZSA 4WY5A 1Q11A 2VJNA 1V6CA 1AC5A 1YL5A 2GR9A 3IULA 3O03A 1CF9A 2WFAA 5ETJA 4NCAA 2I34A 3BFPA 3HFSA 4JQYA 1AGPA 2O52A 2P9ZA 3K9QO 1KIAA 1ULBA 4X1KA 1TZCA 2CBGA 1GNSA 4OP2A 2H4JA 4PC2A 2ZCUA 5KJCA 1IFXA 1SCIA 2LIPA 2WZDA 3A0UA 2EP7A 3FAZA 2PUWA 3RRBA 3WZLA 4KHZA 3RVSA 2Q0JA 1RAGA 1H2BA 4KFUA 2C31A 3R0IA 4DA9A 3A6EA 1XF9A 4QKQA 1C3VA 4IJKA 1AKQA 2E87A 4ZIRB 2QX9A 5ILOA 1A4XA 3UC5A 3V1MA 2HLNA 3R7NA 5HEKA 1LZLA 2JH8A 3TAHA 3BGDA 3EZ9A 5EAIA 2OGUA 2PUHA 4KGDA 5GOZA 2G1PA 1GSOA 1NQUA 3KE8A 4M1QA 1KI2A 1HE2A 1N9ZA 4POAA 4QFCA 3RT9A 4BRUA 5EHZA 4Y6LA 2C2ZA 4ME6A 5B7NA 4TL6A 3KQMA 3EZXA 4FZJA 4Q03A 1Q83A 3MGBA 3RSQA 3SG0A 2OV6A 5JD4A 2Y8AA 1PL0A 4GE3A 4FYVA 2IXAA 2ZSDA 2AB0A 2Q07A 3SJUA 3GT3A 5AW6A 3LUPA 2XUJA 5EL0A 4N12A 4XRGA 1UOEA 2J3IA 2XUIA 3MWYW 3WNBA 4C6TB 5A2GA 4ZAYA 2GD0A 3D3WB 4QFDA 2PSHA 5ADUS 1YRYE 4D6YA 2WW8A 4QVGA 1GQ2A 4OQYA 3VV2A 1OTHA 4EJ0A 1L1RA 1E4OA 1JYFA 4JLWA 1GRNA 5FTKA 4OQQA 2CMKA 3C70A 3LUDA 4NBLA 2WZBA 2HIAA 2NYRA 1KYWA 2DJIA 3O3CA 4R5HA 5K3EA 2BEVB 2AMJA 2RDMA 1X1BA 2QPTA 2V8OA 1W5EA 3QH4A 4U4LA 3KVRA 2DE0X 5IJZA 3CJRA 3EXHC 2EGUA 4YV0A 3CVXA 1EG7A 3P9NA 1C3EA 1GRCA 5EP2A 2EFGA 3EA4A 3W3AH 1D2MA 1I2DA 1QYXA 2AMYA 2C84A 2ODWA 3QY0A 4M9QA 5BNZA 3QV1A 4IQ4A 1PQPA 4KIJA 4AUKA 1U4NA 1M8GA 3A9WA 1VRWA 1MGOA 3ER9A 1PNVA 4RNDB 3X1KA 4GEGA 5A0FA 1D6MA 3EQ9A 1IYZA 2PKQO 5BN5B 4RSRA 4ZI3A 1KQFA 5KIKA 1RIIA 4UAJA 4DCSA 3IUNA 2O8VA 5HQ3B 2PSSA 2HTEA 4IV0A 1SCDA 7ABPA 3QMMA 2IC5A 4E07A 4OBEA 4KQ6A 2OQRA 5JAQA 2XT9A 2H51A 2ZXEA 3IJ5A 4HLNA 1NC1A 2ECPA 4BP3A 3BUSA 2CHEA 5CB6A 1BHQ1 3J80A 3LO5A 4TSFA 5E8RA 4M38A 1Q19A 4FBMA 1Z2PX 3V8BA 1I6MA 2PFSA 1YR6A 5JD5A 1PR0A 1RR6A 2HCRA 3CE9A 5FLEX 3RQSA 2E82A 2PL5A 3UZUA 1Z4MA 1YDFA 3KO8A 4G4JA 5JXJA 1E6MA 1XEWX 5F51A 3SZMA 2ZI9A 3P32A 4QU0A 1B3BA 3VOTA 4BVKA 2Q1XA 3QKWA 4FSDA 4EVQA 1GUZA 2HCBA 4CM9D 1U28C 2GMNA 3RUFA 2AFHE 4HL2A 2WB2A 5DO9A 2MSNA 4R40A 4RNCA 4INZA 3HCDA 1U2RA 1DEOA 3AF3A 3K31A 3WLKX 4UTNA 1VHWA 1CY0A 3KSUA 1M83A 3H1GA 1KZ9A 1FFEA 1NXQA 4GC9A 2FSGA 4RVSA 3FOWA 3ZCUA 2O5EA 4JBXA 1Y3FE 3N5KA 5FOVA 3GL9A 5JWHA 3LF1A 3R8FA 1G59A 2BGRA 3B6MA 4EB0A 4JMLA 4LX8A 1ZY2A 2V03A 3K9WA 2YNTA 4BZ3A 4AURA 2VYFA 4UWRB 3V6LA 2WZCA 4BNYA 3L84A 4E46A 2BH9A 1NWCA 3EXIB 3GMDA 4FGWA 4MQFB 1XZIA 2WJ3A 1ZRHA 2EDCA 2QN9A 5E1BA 4A6PA 4CMEA 4JBHA 4DY4A 5LMNB 4U0JA 4JIGA 1QNLA 4WJKB 1UXIA 2Z8XA 4U7JA 3Q2OA 3IAS6 5HFAA 4TMVA 5A05A 3EIEA 5K3FB 4FLEA 5JU6A 3R7SA 3H65A 1IATA 1MT3A 3HA2A 3RUEA 4YCNA 1BJKA 3COPA 4OJTA 1M6VB 5AK4A 5FLKA 2X13A 3JQGA 3NM4A 3ZLBA 3B20A 4HMQA 2FPIB 3C5WP 2PJUA 1VXOA 3UWOA 2AJDA 3NHMA 1XNGA 2BFZA 1UBTS 4QVKA 5J59A 4FFWA 5J2TB 2PS0A 5CA1F 1VCHA 1Y0BA 3GLKA 5CMLA 4RDCA 4ZZ1A 5L3SA 2PD6A 3HYCA 5K6RA 2PN1A 2RGRA 4MIEA 4P5EA 5COAA 4DV0B 1PUIA 3HXPA 4X20A 1WB6A 3Q6NA 3S2GA 1T4GA 1QR6A 1DBSA 3U9LA 3DV9A 4XLZA 3ZV7A 2SHKA 1PG2A 4G8DA 5AUPB 1X8HA 5JQGF 1CY7A 2GTHA 2CWDA 2HDHA 1G8YA 3P4UA 1J99A 3NANA 5GPBA 5KQMA 1BHSA 1Z74A 4QXMA 1L3IA 3CH7A 3OAAD 3ND8A 3AERA 4AMBA 2VNKA 1HC7A 4F60A 1FYFA 2WP8J 3DWFA 2ZRAA 3IUQA 2EQBA 3EDRA 3OX4A 4K9OA 4J1QA 1PZXA 3GLQA 4OXRA 5CYOA 3I62A 3M6XA 3B3QA 3QEMA 2FDRA 4DBVO 1ZO8A 2AOVA 1XM8A 2Y1DA 3FCEA 4PSDA 3SMQA 4BLVA 1N8TA 4JQOA 3FVRA 1W85A 2JH9A 3TUJC 1YTLA 3K96A 1RYYA 1RBZA 1OAOA 4WFQA 5F1YA 2B0CA 3VR5H 1PHRA 4YFYA 4CEJA 4IIXA 3SVZA 5C5CA 4UXHA 1KO8A 1U7WA 4FN5A 1AGRA 2WWXA 2C3MA 3CHYA 5CLHA 5HK8A 2QVGA 2WKWA 4KIFA 1EWKA 4M0UA 3C39A 4YWJA 1KE2A 1ADBA 3VOSA 1ESMA 2ZUCA 1NU6A 5FNZA 2O2DA 3OQ6A 1DRUA 1KDVA 3WMEA 1WSBA 4AKSA 5ADWA 1EXMA 3N2GA 5ACWA 1BN7A 3DQPA 1P4RA 2ROQA 4YAKA 1E0AA 1TECE 3VTZA 2WWHA 5EXDA 1D4AA 2I54A 5JJKA 1ML4A 5LQUA 2L69A 1U5BA 4YI3A 2PS3A 2A9RA 3CU5A 3TOCA 4BP8A 3E9RA 1FLAA 4BNKA 3A7EA 4LWZA 1RKXA 1M9NA 4R9SA 1YS2X 5CGZA 5EIEA 1TYEB 4UWOB 3NKFA 1RKUA 3VISA 4WDRA 4D9EA 5EJMA 5CFZA 4AD9A 5L40A 4N3NA 1K89A 3QELA 2QJRA 3VMMA 1G38A 4ZREA 1BX3A 1NA5A 1ZK2A 1PP4A 2XGJA 2ZRBA 4UOEA 3UY4A 2HLPA 2DCMA 5JW6A 3BL5A 3SI7A 3G9TA 2BISA 3PHIA 5BT9A 3QM1A 2WMNB 1JEDA 2AC4A 4WJZA 1QE5A 4PYMA 3QFFA 3TFQA 4G25A 1T43A 2HAEA 1A5BB 3CWZA 3TOXA 4JJFA 2PT6A 4LJ5A 4U63A 1ORRA 4XDZA 2XWSA 3DDZX 3RDPA 3DB2A 1JS1X 4GICA 4RZSA 4Q3AA 1XNQB 3UWMA 4BQPA 2V5VA 5LIPA 3A28A 3HS3A 1SKAA 2BGNA 5IASA 3B1XA 1PJRA 4O33A 1HBJA 4OK6A 5IT4A 1QAMA 4CF7A 2DBVO 1CC1S 1I51A 4Q9AA 5ITVA 3HZRA 1XVVA 1CTQA 2FFQA 3ACCA 2N3ZA 3W3AD 4A8JA 4HWRA 5LZ5A 3ZDZB 2ZRPA 4HDQB 4RQTA 3KUCA 3RTDA 2EARA 3A8TA 4Z9FA 2RGNA 3LX4A 3WAKA 1J90A 1KJWA 2EFJA 1QQ6A 3KPVA 4TV8B 3QHAA 1EP9A 4JUCA 5TJ9A 3DEHA 2VHZA 5ULLA 5LS3A 1P1FA 1D5CA 3DXXA 3FGZA 3LTEA 4BQQA 3OESA 1AK9A 2HGZA 1OLXA 1DARA 2F8MA 2XNKA 1W0CA 4D80A 5L7WA 4QYSA 1KPGA 4AIIA 3NFRA 5JC8A 1KAOA 4Q6WA 1M1NA 4ZOCA 1DQRA 3WIDA 1JB1A 4B7UA 2GUWA 3OETA 1UODA 4KV9A 1NSYA 1UJ6A 1Y37A 2XKAA 5JT1A 5AIJA 1E1YA 1EUDB 2QR3A 4IJMA 4Z3DA 3S55A 2DUNA 3F6BX 1NRWA 3RS2A 4AY5A 5JQGA 1EI9A 4L85A 2B2NA 1ZPDA 2BMJA 3WHPA 3UPDA 2NMVA 3FW1A 1H5NA 3IV6A 1SG0A 1TVKB 2FSVC 2QW8A 4ZOBA 4UE2A 1D1QA 1KO2A 5JTTA 4KTTE 1X42A 2O3RA 4P92A 4PNEA 4BMPB 4B0OA 1SC1A 4Y2SA 2NN3C 3CF4G 4BNLA 4P62A 1YHNA 3KK0A 1N3BA 2BWJA 2N75A 3FTNA 3OIDA 1QNFA 1T5OA 3DE5X 2A1TR 2INGX 2J6CA 1JQDA 3DFZA 3KAJA 1TQ4A 1XF1A 1MJHA 2GA9A 2QUBA 4LBWA 4AJ9A 4C4XA 1X0VA 4X8MA 2QPAA 1KOGA 2HB6A 3I2YX 2AQHA 5KDLA 1I2MA 1P0IA 4U5XA 5FOQA 1DAKA 1DRKA 1SIBE 3B53X 1YVPA 3C41J 5AKLA 2P7HA 3TX2A 5ARDA 4YCSA 3JAMA 1NTOA 5T8KA 1R9MA 4BFZA 4HNSA 3A6FA 1X7WA 1Q12A 1WW8A 2H57A 4MS4A 5THQA 3F9IA 3IHWA 3WQSB 4BMDA 3H13A 3HDTA 5DLDA 2A3RA 3A6DA 2CZCA 3I72A 5K8VA 1MJ5A 2VTBA 9MHTA 3EISA 2Q0HA 4MX8A 5KNCH 1G20A 2YWBA 2HHJA 4URYR 2ERCA 4Z7NB 1OZ0A 4GGOA 3AU9A 5HILA 5LC1A 1GKLA 3Q98A 4M1SA 4TL7A 5HFJA 2UYCA 4IIJF 3UUFA 3PNBA 3L8YA 5KBYA 2G67A 2Q7OE 4Q4JA 1Q92A 3LZDA 3RSFA 4CCWA 3TTXA 1NJ5A 3GMTA 2JD0A 3QVOA 4UPVA 4ENRA 3K0FA 1JBQA 1VI6A 2O3SA 1N1GA 4MGYR 4D6PA 1P6QA 5D00A 2FUKA 3TSAA 4EYOA 3FI0A 3FYUB 4H3VA 1R6TA 1AQ6A 1Z7YA 1E3LA 3VU8A 1GKIA 1RVV1 2GERA 3LPCA 1YK0A 3NUQA 1K9SA 3SGLA 1U3WA 4KQ2A 4RKRA 4BO8A 2ZG6A 3NP9A 4RD3A 3R4VA 2W6CX 5E1MA 2WAYA 4UDYX 3M9XA 2UXBB 1NX9A 4HATA 5DULA 1T2EA 3S8EA 2BVNA 3C1TA 2WYLA 1N2JA 1PJ2A 5BORA 3LY9A 2CFCA 5DGCA 1ARZA 2FMHA 3DM5A 5ALYA 3SYRA 3Q1KA 4AU1A 4EPTA 5E2BA 4D9KA 4D56A 4F84A 3RS7A 4KXYA 3DYBA 3TQCA 3V34A 2E7YA 1ICIA 4EJMA 4LKOA 3G2JA 2JL1A 5CDTA 4QO8A 2QL6A 2GILA 1IPFA 4EF5A 1JP7A 1AD2A 2FN7A 7REQB 2LIVA 3G0HA 2OB1A 1THMA 1U2PA 2RARA 4WZZA 3JTEA 1QBKC 3MMNA 4OYLA 1JMKC 2CBXA 3GZ4A 3PNQA 3PVCA 1MO6A 3VR5D 2JHPA 6LDHA 3CUVA 3D7SA 4M1YA 4AJEA 2EEPA 5LL6P 2FN4A 4EL0A 1HTWA 3HV2A 2LNDA 3P2OA 3R2UA 4WK2B 1K8RA 4N6NA 3MCWA 2ECKA 4LDQA 1IJFA 2XUQA 2YOFA 5KYUA 4D8VA 4DLPA 3NHZA 1JMYA 2OFPA 2X19A 1IBMB 3PP8A 4R0MA 3HK2A 1PEAA 3FOCA 3A10A 1DRWA 4JLDA 4CFYA 2AG8A 1MEJA 1IULA 1SKYB 4EY5A 2WAXA 2O3UA 4QJBA 3P9PA 4PCUA 4HXYA 5AHRA 4GQAA 1SZJG 4KU4A 2FW8A 4DRYA 3M89A 4E14A 3VQTA 1OU0A 2B0JA 4RJKA 2VAVA 2B61A 4ISBA 2ZSFA 3GMSA 1T5DX 1E1RA 3PYLA 3IUPA 4QDKA 4HZGA 5CNJA 1Z0SA 2R1UA 1NM5A 3C97A 1RYBA 3LWDA 4QXQA 4WD3A 4A73A 3H1PA 4CGYA 2EW2A 1IJKA 4XJTA 1D9ZA 3TK1A 3R0QA 1GL6A 1DDGA 1MVLA 3CLTC 2J9ZB 5ALWA 4D92A 9GPBA 5ACXA 4RK4A 1QS0A 3Q4GA 4OQ4A 3DCJA 4M0MA 3EZGA 5ITZB 1EVZA 4WEQA 3HYLA 5EZQA 1G8HA 2NZXA 4ZT2A 2YXLA 3L1UA 4N1AA 5LXTF 3WR5A 4ZK6A 5HZGA 5KTRA 4G0WA 1ABBA 1T13A 3HTXA 4YSKA 3ASZA 3V7NA 1WTCA 3JQFA 4Q18A 2QUAA 2ZZMA 3ZE1B 2B3DA 4MRAA 5CB8A 1YQQA 1FMLA 5CBPB 1JAYA 3WKEA 4P54A 1KTIA 4D1VA 2EHJA 2W11A 2HQRA 3H1TA 1JJ7A 2CBNA 5KJFA 3V97A 4C3OB 3N3AC 1P4GA 3NBUA 1GZ4A 3MWEB 4KYTA 5EWAA 4JJEA 5B4UA 1PYGA 4TYYA 2G08A 2JK1A 4OHKA 5DBEX 1Z3IX 1XL0A 4IIJA 5IPFA 1N2BA 4IICA 1HXHA 3OT5A 5EHIA 4DDUA 3WLHA 3F3KA 4O59O 4BMSA 1QHNA 2IS4A 1XTVA 1FXUA 1PD0A 1XPJA 2R8ZA 4EBBA 4CF3A 1P1BA 4XLTA 2LDXA 3TQTA 2V6MA 1VKRA 3E5HA 4X8LA 4ZPXA 5GZ1A 1N1MA 3GGDA 1E94E 3HJNA 4S1NA 4RZ3A 3KQPA 4M6WA 5JSYA 1G7CA 2Q0XA 2EIHA 1P5HA 1KMNA 3V2GA 1GNPA 5HCNA 3LKDA 3CW9A 1V8OA 2YOGA 3DHBA 1ZDMA 3KTOA 3LFHA 5CEEA 3I3OA 2BG8A 3ABQB 3JQ8A 2I8CA 4XEHA 3TP9A 4DMGA 1P9RA 5SY9A 4C7OB 2FFRA 2Z9CA 3IPYA 3LP8A 3LSTA 5EJIA 1V9LA 3T9FA 5IC5A 4Q1FA 3RC3A 4W4TA 2CFZA 2D1FA 2VA8A 3U5ZB 3NP7A 1RE1A 3UWDA 4P4NA 2VSNA 4N6OA 1WM1A 3ND5A 3GAZA 2YUIA 3Q11A 1RJGA 2A5YB 4INAA 4QRIA 1ZISA 2BBTA 3I39X 3U4GA 2QINA 1UC4B 2R87A 4AW9A 3WFIA 2IZOA 1QFYA 4AJPA 3THWB 4XVUA 1HDEA 3PFIA 1DFHA 2AUMA 2BFBA 3JALB 4PBTA 4X8OA 1TVCA 1ZWKA 1YB2A 4A7PA 3RSZA 1QIIA 3FDFA 3Q0IA 5BNIA 1L7MA 3TLEA 2OG1A 4L28A 3UIEA 5B3JC 3QHQA 1E9FA 2FFAA 3FNIA 5LVAA 2ADOA 3FTCA 1F20A 2J9FA 1DG1G 2SNIE 2DFDA 3P20A 4JSTA 1WXQA 4TWZA 1JQAA 1KVQA 4KWTA 1EJ6A 3ANTA 4KRXA 4JVOA 2G9VA 3K72B 4M2LA 4TUYB 3IO5A 5HGJA 1TVEA 4AXXA 1Q20A 3H9UA 3OPMA 1F2TB 1DKMA 2F43A 1J0AA 1WKCA 2Q3CA 3JQEA 3PXUA 4XWYA 5H80A 5A71A 4ALJA 3UMMA 2G5TA 3AGQA 3ZCSA 2OHJA 3VBEA 1DCFA 1Z17A 2JIZA 3ESXA 3QLUA 4BLWA 2R00A 3KSZO 4YSLA 3THYB 4B33A 4C0LA 3K6SA 3BMOA 2O5CA 1AG9A 2IUUA 3IE1A 1R1DA 4BFXA 1XKTA 4O0LA 1GNLA 4ZQFA 3CUWA 2B3TA 4C9BA 2YZKA 4I55B 1P18A 3WZ2A 4JEMA 5G1OA 4TQ9A 1W6RA 4UTZA 8LDHA 1H9CA 5KYGA 3DE3X 5EI5A 3WLMA 4UU7A 3OZUA 3ORYA 1NQVA 1DZ3A 5LXTA 1E2JA 1MC1A 4O3FA 1I0IA 3GLTA 4RD4A 4N18A 3CYFA 3WOHA 2R5WA 3GJ8A 3CT6A 2QVYX 1NASA 3AFOA 1QX4A 4ZGWA 4HDOB 4KWCA 4INJA 4QYWA 4FHGA 1AXEA 2ZUVA 5JZMA 5EQJB 4Q37A 4YMUA 1B3RA 1QJCA 3S5JA 4FIZA 2RFLA 3ZJ5A 4F4DA 3ML1A 3DKVA 4I14A 4J4BA 1P3DA 3MMSA 4LYDA 1C80A 1SHKA 1NJFA 2GDJA 2VQEB 1R27A 1XWWA 2HPHA 4MVJE 4XB2A 2IEZA 1P3Y1 1L4KA 4Z7OB 2WFMA 5IFLA 4YBZA 4ZXFA 5CHEA 2PH3A 4HDAA 5FCDA 4RV9A 2FE4A 1KFKB 2TECE 3QLEA 3NBZC 3U3RA 4B3XA 4NURA 2HXSA 2EJUA 3FVWA 1L7EA 4QOSA 3LCUA 4UU1A 3SHOA 2HMWA 3B9RA 1RE0A 2HA0A 3QY9A 3ZNQA 5HH5A 3OLVA 2WMOB 3O3MB 1W1IA 4XTRA 4B4VA 6REQB 2HQ1A 2HSDA 1LU9A 3V80A 4JI7B 4LHWA 4GXRA 5FXMA 5JDIA 3OZSA 1M34B 4GSYA 4JD5A 1S2OA 1IBSA 1II8A 3FPGA 4OB8A 4P53A 4X24A 2C5AA 1R7RA 1E3TA 4GYYA 1J9EA 4XB1A 4A27A 4QYIB 3VSCA 2X1HA 1GTSA 3DMHA 2GZ2A 4DG5A 2G88A 2J4FA 3A1NA 2WM2A 4OLHA 2BKAA 2PZJA 3HGQA 4M60A 3LDGA 2IFTA 4IWNA 8ATCA 4GW3A 5FX2A 1OV4A 2V4ZA 4X90A 2IS2A 3B85A 4WWHA 5J2UB 2ZSEA 1YDHA 2VATA 3K1JA 3VKUA 3DMGA 2IBTA 2DWCA 3AHFA 3UH1A 3NHFA 1MXFA 5KYKA 1G8FA 1T5BA 1SUAA 1SA0A 3F5DA 1X1RA 4MH0R 1YI0A 4IS3A 1I9GA 3HJGA 2ENUA 3P7MA 1XLUA 3KNRA 2N47A 4DPLA 3VC3A 1VL6A 3EZLA 2H0RA 5CTAA 4B6FA 1C8KA 2Q6VA 4ND2A 3ZK8A 1NLYA 4PV7A 1P9EA 3QFHA 4IXMA 4R8SA 1VGQA 2CDRA 4CMIA 4DIBA 1GYRA 1GZSA 2CJYA 2Z4RA 3VR4H 1H4QA 1KBQA 3R2JA 4F3NA 5BW5A 1ESCA 4KW7A 3JZDA 1XFDA 1Q16A 4F72A 4V0MA 2QVLA 1JQ5A 2QMYA 1AKNA 3BSFA 4MROA 2JIMA 3E05A 3G2HA 4KN5A 2CXNA 3MM4A 4EG8A 1Q0ZA 3GJ7A 2OXTA 1V0JA 4MUAA 1Z29A 1PYDA 1X1SA 4QEKA 1K4YA 3LX6A 3DA8A 4FI3F 1RPNA 1C0LA 3PRHA 1FA9A 1KU0A 1PGNA 2DQ4A 1R10A 3ETNA 3O92A 1GDDA 5KYVA 4YXFA 1RRPA 4GKBA 3BE8A 2Q5OA 1UFVA 5K51A 4Z3OA 3ZYZA 3G0IA 1SVNA 1G21A 1NJ2A 3ZU3A 2GT1A 3N8HA 4YHHB 1N8KA 2VHJA 2VRCA 3CZ5A 4HRYA 1KEUA 2QP3A 2JAUA 3ZWXA 1FRZA 1VP3A 1MU0A 2BRUC 4ALIA 3OOYA 5A0TA 3NETA 3UAWA 3WHKA 5B15A 1KSJA 2FPPB 2GN6A 5A23A 4EP1A 2C20A 3TDNA 1F48A 1F5NA 3AF1A 2NV2B 4L0MA 1GAEO 4ERXA 3NQ41 4PIMA 2Q9AA 1VIMA 3RD5A 3H99A 1NMSA 1WXDA 2NYPA 3KKPA 5IYZA 1DTWA 1H3FA 2VJQA 1KXJA 1S2LA 1W2WB 2WVGA 5B57C 1RRKA 3BWDD 2PO7A 1UBNA 3DS8A 3OX2A 3RIHA 3T7CA 3MZ0A 3Q7IA 2FSIA 2I1WA 5HM8A 4C1CA 3W78A 3INNA 1IZ8A 3QI7A 2CD9A 3PR2B 3C6YA 1MQOA 5AHOA 4BKQA 5EN4A 3WLSA 2PANA 4X5OA 3PXCX 3AKEA 4IIVA 4NRDA 5E9WA 1LDMA 4KUGA 2GAOA 2R1VB 3M4NA 3G88A 4MO9A 2J3JA 2QOEA 3W9UA 4WBNB 1WDMA 2VI5A 2ZB4A 2A9FA 5C8YB 4NU8X 4OQPA 1Y8RA 2IGBA 4FE7A 5IP5A 1TTTA 3UW3A 2B8WA 2H1RA 4CI9A 4OJQA 5GGYA 1HDXA 5F73A 2G70A 2VT3A 2C2MA 2ZSAA 5JVDB 2RHMA 5HM6A 3H8SA 1OR8A 1WUKS 2XB9A 4WL0A 2HSJA 3O8RA 3KTAA 4UD2A 2CNBA 3F4BA 4G09A 4ZZ3A 2PVSA 5A5EA 3GU3A 2JD2A 1K7YA 1DAOA 4FT2A 4QULA 3T35A 2WYIA 2W93A 5IJ0B 4F6LA 5AJLA 4KGXA 2B34A 2JFBA 3OJXA 2IDZA 3AOEA 4Z49A 4GUAA 4S2UA 4A9AA 1Y1LA 2R2AA 2V7QA 1GN9A 3RWMB 1NXXA 2A9JA 3SX4A 1YA6A 1PZNA 1O3YA 4BVJA 4LG1A 2H1FA 1BJTA 2AIRA 5KTMA 1CQJA 2A0XA 3INGA 3QU5A 2WJYA 1HORA 1GZ7A 1OXBB 1WPRA 2G06A 3QRWA 4O4IF 1H8HA 1ZC3A 5BXQC 4Y30A 3BL6A 2VJKA 3K15A 4UJ3A 5IUKC 1NFQA 2RHRA 1REQB 4XDYA 5HIIA 2P4QA 1YQGA 2NQ2C 2IEYA 2V54A 3WGQA 2E49A 1UEJA 1YKFA 3KB2A 2R6GA 2CD7A 4CG1A 2HPVA 1EVJA 3IUSA 2AEMA 3KQNA 4F9GA 3BA6A 3REFA 4D1WA 1E2KA 1WQ3A 4Z9AA 3RYFB 1ZGCA 4EIWA 3UAVA 1W7AA 1I6WA 1X8KA 2QMUA 2PAFA 2JVKA 2R65A 3NHWA 3A9VA 4WNAB 2IY9A 2XOXA 3KXIA 3OF2A 3BWCA 1DMSA 2FN8A 1J1IA 1WP9A 3HU3A 2P5YA 4NULA 2CZGA 4ICIA 2WP0A 3SC4A 4UA4A 1CHDA 2G5GX 3IIKA 2BN4A 3SR3A 5C8DA 2V1UA 3KE9A 4TPKA 4DNOA 4M37A 2FHXB 4H16A 3D7LA 3GPCA 3DOEA 4ZRMA 4RZUA 2W4QA 2AXPA 3NALA 5HIJA 3FI9A 5FD8A 1RXCA 3LX5A 2LTAA 3MD0A 1N2OA 2GN1A 2B8EA 3MOSA 2GWRA 4HLUC 4B85A 4ZYWA 1IHPA 1OZAA 2Q6OA 5DE3A 3MCVA 4MI3A 1AKWA 4PYRA 4DJJA 3RBAA 3K70D 1L8QA 4HAWA 3AIKA 5DMXA 1QSGA 1CEXA 2AVDA 2VG8A 2C9DA 2E7ZA 1IN1A 2H3HA 3MJSA 1NUAA 2AX3A 1KYTA 4MLZA 1ZX1A 4QDTA 1C3OA 5CLFA 3K7EA 4PLPA 3U9TA 2OAP1 4TSFD 5BQ5A 4A2PA 3RF6A 4PZYA 2VAXA 4R2XA 4DWWA 3PNLA 1U0OC 3RKJA 3NC4A 3VR6A 2VL7A 2W6ID 4CYMA 5A3RA 4GKJB 1JQ3A 4MAMA 1NYTA 3DHYA 5HS6A 1TGVA 2WUFA 4RZXA 1HFJA 1I30A 3K0CC 2GYVA 2HD4A 4HB4A 1XMIA 5L8VA 1KVSA 3TFWA 4PDXA 4G2NA 4R84A 4QQNA 4UBMA 1TLFA 3L6EA 2EJCA 1HEIA 3FZQA 4ZAXA 3RIGA 3RFFA 2QUJA 1CS4C 1NBWB 3OWXA 4XIYA 3A2NA 1EXVA 4X1KB 5CT6A 4TXLA 5IX8A 4RPJA 2YWHA 2BFFA 3SZ3A 4BS9A 5B3AA 1K2VN 3VR4D 3WGNA 1FNNA 2NO9A 2IH5A 2FMFA 3DO8A 3DC2A 1T0IA 3RFXA 5MF6A 2DOOA 3IT2A 3IUJA 2WYWA 5HIMA 3CUKA 1TO2E 3TRDA 3WP1B 2IZZA 3C5CA 4V03A 4A8TA 4NPHA 4KWEA 4HYEA 1BA3A 1L4EA 4E12A 1B74A 4PPYA 3ABZA 3OPXA 3FLEA 4WN9B 3H5AA 2ZWPA 5FR2A 4L74A 2FMKA 3OU6A 3KHTA 3LUJA 1BDMA 4IZHA 5CB4F 1UK9A 2CNNA 1OIWA 5HJ5A 3W7BA 1SCQA 4PVCA 3RNLA 4J90A 4XSVA 1G60A 2AV6A 3QE4A 1GAWA 4EMBA 1GG8A 2JB9A 2VP0A 2G9ZA 3DMDA 3NNSA 4B8YA 4W5OA 5IBCA 3TE6A 2H0AA 2JJ2D 3A9SA 3GQVA 3N8DA 1U5CA 3HP4A 2HRQA 3LPDA 3MHTA 4A6DA 4ZQEA 1IWBB 3SPXA 4AG6A 3U09A 3E0QA 5A3VA 3PQDA 1L5GB 2O8DB 3D9QX 1Z4QA 2QRHA 1Y34E 3CFYA 1WW1A 3UK0A 1QAQA 2MIIA 2X8WA 3GJ6A 5BN4A 3ZHYA 2O50A 4C4AA 1ZH4A 4IEEA 3NYRA 4UU0A 3RG8A 4YMTA 3DT6A 4O4IA 4LY3A 4TV9F 5HGXA 2PWAA 3HZZA 5LPNA 1YS1X 2CSXA 5ERGB 3C3CA 4XQ9A 2A35A 3WRXA 1Y4ZA 2OGZA 2C2WA 2FOXA 1RZRA 3AEUA 5F12A 2JCXA 3H3EA 4NEQA 2WSBA 4OH1A 1E1MA 4RKQA 3DLCA 4UVEA 1ZH8A 1LSUA 2WIJA 1RCFA 1A8SA 2YBDA 4GL4A 5C7LO 1BCSA 1JIQA 2CUTA 3IMKA 1AKMA 4OFZA 2OP1A 1CF4A 2YASA 3P2IA 3BGWA 5L95A 4A91A 3IAXA 4MKFA 4UC0A 3V4LA 1RXWA 3K2IA 3I9JA 4XWGA 1U80A 1OSNA 2AG5A 2AF4C 1N3LA 2KI5A 1CVLA 3RUHA 1MG0A 3HY6A 1RAEA 3RW9A 1J39A 3D8NA 4KYVA 2P90A 2WG1A 5CAEB 1C9EA 4DIFA 3MD9A 3AR2A 3RIYA 1E69A 1MTZA 4PZZA 1JA0A 2WRSA 3QVJA 3EN0A 4BBAA 4CR8A 3C4VA 3HB7A 3AW8A 4W5HA 3T1VA 5IF9A 1T2DA 3WK9A 2ZKIA 1US8B 3JQAA 3ZDXB 2VQFB 1L8XA 4QJ4A 1R6AA 1YUMA 3R09A 4D82A 2GXUA 3PYMA 2ZAOA 5KJEA 3MRTA 4G86A 2FUEA 4LWPA 3USCS 4DR7B 3ECAA 1SOVA 1GPH1 5AOBA 2QXUA 1IWPB 1MA3A 1ZU4A 4P5PA 1JHPA 1J97A 1N36B 3NTVA 2EFEB 3R5FA 2OR3A 3LUFA 4KG7A 4RPHA 1YU6A 4FMDF 3BH6A 3HFJA 2V6JA 4BEJA 2C5EA 3OD1A 2F1KA 1O0CA 3U26A 4EYQA 3DF7A 3NT2A 1L5WA 1QZ3A 3D6UA 1Z35A 1G17A 1EP3B 1AKEA 3VXKA 1YQTA 4M36A 3OBIA 4DCJA 1QV7A 1LBHA 3HG7A 2ID7A 4V02A 4DLTA 3TJMA 3IAEA 2B4AA 2NPIA 3LIIA 3LXRA 4LZPA 1YZKA 3OE4A 3R7WA 3O8CA 2QVZX 2R6FA 2OBBA 1DWUA 3WYGA 1YK1A 4HP8A 4DLAA 1U28A 3CVWA 1ECJA 4U2GA 3CLVA 3G1UA 4BASA 3LGSA 5CUQA 1AKVA 1A5AB 1G2OA 1OV6A 3JQGB 3KKOA 4C0QC 4O4HF 3TFOA 5A5VA 1XTZA 1XYGA 3K0EA 3HB4X 3PUHA 1QTIA 2BM0A 3FB1A 1BA2A 3TLXA 3LOPA 1XI2A 3N2LA 4OFWA 4D0RA 4DWVA 2FKAA 5CB4A 1YGPA 4RIFA 3SS9X 5ELLA 4W5WA 4FZ5A 3UVEA 1SVLA 3R6TA 1YHZA 3IVXA 4GFDA 3AVUA 1OGIA 1V4NA 1X8XA 4DMLA 3N59A 3LPLA 3BDVA 1X1TA 3P26A 4HBGA 5DOZA 1H8ED 1N92A 4MAFA 4PO1A 2I4NA 1YB7A 1BU5A 5EXTA 2JLAA 1HOTA 3QMVA 1E61A 4MCHA 4Q4AB 4QUBA 4IDNA 2WY2D 5LLDA 2ZE7A 3CF4A 4OEHA 2V7UA 2NP7A 1JALA 4P38A 1A5ZA 3BZWA 2XXBA 4Q15A 2G5PA 2PFGA 2P4ZA 1G2IA 2BMDA 2ZULA 2CLLB 4MW7A 2A8YA 4WN3A 3A05A 5CM9C 3VR3A 3W8EA 3WADA 2VBGA 3G2IA 4GR9A 4TV9A 5F5LA 5FWXA 4YPFA 3PHHA 1JPVA 1L4BA 3UCEA 5E2AA 1E2EA 4N0EA 2F3TA 3ET5A 5IKOA 1V37A 3QEMB 5AW4A 3ZXIA 3JXPA 2Z5FA 4J91A 2RGBA 5GV7A 3ZXUB 4FU0A 2X77A 4FB5A 5DHRA 1QIMA 3H83A 3QUSA 1APBA 4IFBA 4NU5A 2F4VB 3NH9A 1G8JA 1EM8A 1FU4A 2WHPA 2FX5A 2W22A 1ZL0A 1USWA 1PSDA 1VJTA 3LC7O 2YIVX 3E3MA 4DNFA 5BUCA 5HRCA 3ROGA 5MN4A 5AJTA 3CF0A 4JP5A 3O8LA 2D13A 3CVJA 4IIEA 4JSYA 4LXXA 4X1IA 4CCSA 1CWUA 1TZBA 5FUXA 2EKDA 4IKPA 2P9HA 3ANYB 5IAJA 1Q3KA 4YDRA 3SQNA 4G0UA 3OZAA 4AF8A 4HB3A 4DQUA 4JV5B 2R751 4EKIA 2HT1A 1XQ6A 2Y0EA 3UXMA 4LHZA 4AB1A 3GYBA 2YXDA 3D2AA 4H18A 3IA7A 2GYUA 4KDFA 1PJ4A 2C8JA 1MH9A 5CYFA 4UBQA 1RLIA 2AOUA 2R7LA 3ZHQA 1K9VF 4DY6A 1H94A 2WBLC 4IDOA 3DDOA 2XDQA 3IT1A 1YB5A 3IEIA 1LX6A 2GA8A 2QY6A 1SUPA 5DXAA 2G9UA 1LVUA 5JNWA 4PSAA 4FJ2A 1WDKA 1PJ8A 2J59A 5DGIA 3U7JA 3MQ2A 1NKVA 1V3VA 1GKKA 1UKAA 4OF4A 3SAJA 1TF2A 1N6PA 2V7VA 1QIKA 3FOBA 5KI6A 3FETA 2OZKA 1OREA 3VM6A 4HAXA 3I01M 1FJHA 3DJYA 4D4GA 4EGSA 4FCWA 3F47A 1H2RS 4D99A 3NWPA 4XM2A 1ACLA 2UYGA 4GXQA 1R0RE 4NV1A 1GM5A 4HDSB 3THXA 2ZJBA 5TB5A 4FLMA 4D0NA 2O8EB 1JAIA 1C5KA 1YL6A 5JANA 5TV2A 2IU3A 3SJZA 1UH5A 3TBFA 3UCFA 3ANXA 2PCLA 3I04M 1LNZA 2PT9A 3CLKA 3FUCA 4P8RA 2CMFA 3O1LA 2J3HA 4ZXPA 1JJTA 3IVCA 4MKXA 4NONA 3QE0A 3A6GA 3UHPA 1L5FA 2QN6A 3BKWA 3BWVA 3R3JA 5EEGA 4AP9A 1YJ5A 4UHKA 5H3HA 2I1LA 3WSTA 3ZKAA 3GGCA 1Q0PA 4DVGA 3K8QA 2BGUA 3HKEA 5CH3A 3WQRA 1DSSG 3M33A 4BO4A 4C4TA 1V11B 1CK4A 4JOSA 4AF6A 4MV3A 4DYHA 1B6SA 5DPMA 2Q9UA 4HL1A 2QT0A 4PICA 5CX1A 3DE1X 2M1ZA 1QYVA 1WPQA 3ITEA 3KRTA 2FYTA 2M6SA 2H0QA 3EMKA 3R3ZA 4HEA1 4C04A 4DKJA 5ADHA 2W7TA 4O4HA 3IKLA 2IIBA 3NHKA 3R40A 4QOEA 3ROXA 1HE4A 5CITA 2P78A 3HU1A 2AOXA 2QJOA 3WGJA 3KAKA 3EEFA 2JRCA 1E1QD 3A9RA 3QZUA 4ZCLA 2V0CA 3DLAA 1Y7LA 3I4LA 3EXFA 4B7CA 4BNTA 4RTLA 3CCBA 1WU8A 4IJ6A 3N58A 4DRZA 2GM4A 3SPUA 1SXJD 3OTWA 2XLCA 1QK5A 3ORFA 2OTCA 3MQFA 3DOCA 5KCMA 3CNEA 2FZ4A 4RD2A 4A4DA 3MUNA 2JHAA 2JIPA 4LJ6A 3ONWA 4ADSG 1JJVA 1KKUA 5B3RA 1NDUA 3UBMA 3HXMA 1S7CA 4GE0A 3NVKI 1LCIA 3B2NA 3UNXA 5EJ4A 3DXZA 2PIAA 2PYZA 3IQHX 3QOWA 4K03A 1LEHA 3KXLA 5H59A 1YIOA 1PV1A 3ZR9A 3L8FA 5JBNA 4H7EA 2OV3A 4B6PA 4DSTA 5BR7A 3GO4A 3OQIA 5CGQB 3VDNB 3M9WA 1CUUA 1LBTA 3ZU5A 1CUZA 1PV4A 1DV2A 5TGDA 3GLIE 2YIMA 2NGRA 1VA4A 2DTXA 5D51S 2LDBA 1EQAA 2BKXA 5B1HA 5ICMA 1XRSB 3AB8A 3PC2A 1QF9A 2ARKA 1LRJA 3G1WA 1X7WB 3CLSD 4MS4B 1P80A 2NZWA 3OOSA 1OX5A 4GGPA 2IXDA 3HGMA 3O2QB 3Q85A 4UVHA 2YJ5A 2GPAA 2IIVA 5TT1A 4ARVA 3P5BA 3B1FA 4NPCA 2H5EA 3R9XA 1G20B 3ADBA 1GA4A 1MX3A 4KFRA 1DCMA 3GBVA 1DJQA 3ILXA 1HSZA 2ZJ3A 3KUXA 1U9YA 1XXHA 2FSVA 4TTTS 4XVQA 2GUGA 2IOFK 4ZO6A 3RAJA 1AOXA 1W96A 4NFLA 5D6OA 1PZEA 2CK3D 2Q2OA 4HDMB 4OOFA 1PNRA 1EB8A 2P40A 2ZIFA 5AI8A 3HJCA 3KBOA 4BX2A 4YV1A 3WTCA 3AT1A 3CN7A 3LBYA 1V3QE 4LHVA 5C0OE 4DWJA 4WKPA 5IVKA 3VOBA 4B17A 1D09A 1PWXA 1H1TA 3T4XA 1UXKA 1EDZA 4Y2UA 3MAGA 1SXPA 2MWMA 5FUYA 2RHOA 3N2YA 2PKWA 4AO6A 4IHQA 5BVGA 3ZTWA 4IDGA 3IBCA 3VH4A 2ZVQX 1GZ5A 3H11B 1QGED 4EEZA 1AA9A 1BMFA 2EIXA 2B35A 5GIOE 3C8ZA 3PHCA 5AW8A 2AKAB 4GZ3A 2JHFA 4WJLA 2RONA 1RHMA 3R3XA 4MW1A 4Q4HB 2FZ5A 1C1YA 3I3SR 4KSYA 4ND3A 4TWIA 3PQ3A 1XMPA 2Y0DA 2PS9A 1M0WA 4MYSA 4HD8A 3HO6A 5F77A 1AHNA 1KOLA 1EESA 4JU8A 3GYGA 2QMHA 2PIDA 4NH4A 4PLWA 2R7MA 4X7PA 4I8DA 1Y8CA 2XECA 4YPVA 1IXKA 1CPYA 4OHMA 3WXCA 1EXDA 4OGFA 5GJCA 5K20A 2XCRB 2EKBA 2H4FA 2AMLA 3L8GA 4X71A 3UW1A 3AEQA 3MWGA 5CCEA 4FNAA 4TRRA 3BD6A 4ES6A 4M9ZA 4ENVA 1XZAA 1JECA 3H9JA 1UK8A 4UULA 1RWOA 1ESDA 1NKTA 2P2LA 4Q24A 2W4MA 3SM3A 3GPIA 1R00A 3OI7A 3EE6A 5IBPA 3R7DA 1WUHS 3HSYA 1KEZA 1HKUA 2BGKA 2J0UA 3DEKA 5G2OA 1EM6A 3Q10A 4NKRA 2XX3A 3N5CA 1YB6A 1D3AA 3LIPA 4NR0A 2BIBA 2BF4A 1V25A 3AF5A 2QRUA 3A04A 2H29A 3SD7A 3X0DA 1P0CA 1U2SA 3IELA 3KZXA 4L50A 3ZIAD 3ZWOA 1TZMA 2ZLBA 4TSRA 3SYTA 3ZY4A 4BV2A 2WC1A 4QLBA 2YRXA 4MQ5A 3RAFC 4OP3A 1RMYA 4YRGA 3UKDA 4JUFA 1Z88A 1W46A 2ODEA 4DLVA 3W7VA 2VRNA 4CHTA 1BE0A 2H1HA 3RUDA 2P2DA 4AK9A 4LYJA 3KPWA 3UF0A 3B5EA 2GBPA 1BS2A 4IDDA 4C1BA 2Q42A 3SIRA 2DOKA 3HHPA 1XT6A 1JB9A 4BNIA 1P62B 5KVSA 2HADA 1BWRA 1RC8A 3N2EA 2GLUA 1DKPA 3VHXA 2IXEA 1XNRB 4OXKA 4M0LA 2B5VA 5KQPA 1A9PA 5T7BA 4BV3A 5EIBC 1NPDA 3CW8X 1LS1A 1YSCA 4UZSA 2XTAA 4EHKA 1NX6A 1RLMA 4CUJA 3ZCVA 1KWGA 3JQPA 5K3SA 5TSDA 3REQA 1J7KA 4C08A 4L16A 1LA2A 1K5GA 1TU0A 2Q2NA 4N5MA 4BEVA 3GVPA 4MYUA 4DMKA 3ZD7A 1NR5A 2X9LA 3KETA 3EPJA 2HWKA 5AM2A 1IHUA 3DQQA 1TF7A 2RGWA 1HMYA 4XPIB 4YJ3A 1SB8A 2WIDA 1TZKA 3GUHA 4ZEOA 1EX1A 4EUFA 1HYEA 3O91A 4RACA 2J3DA 1PU2A 1KK2A 2OGWA 1KE1A 1YZTA 4CM8A 1QGUA 1TE2A 4RZIA 3DMFA 2JFOA 3TAXA 3BIWA 1ZK0A 1OXTA 4ZWNA 4KR9A 4E6PA 1WW2A 2R44A 5AHWA 5JH7F 3ANNA 3F2IA 2NZEA 4B6EA 3BMNA 1YQ9A 5DCUA 1HT3A 1UDRA 2J45A 3W6OA 5HHTA 3D4NA 2WTUA 4TKZA 5LBTA 2QRNA 4RV4A 1UJ4A 4XRRA 4RM5A 4KQFA 5CVDA 4B84A 3AKCA 5JYEA 3PYXA 1YRBA 2FWAA 4OREX 3U37A 1KZ6A 4MLDA 3PC8C 3QQPA 4GM0A 4CMAA 1CR1A 3PVSA 1T1EA 5IC6A 1C1XA 1CZOA 4J7CA 3LC1O 4FFNA 1ZKDA 3DFFA 1SOUA 1ZXLA 2DBZA 3GZNB 5CB0A 3ADKA 1A98A 1E3SA 1RYFA 1I33A 4HXFB 2FSPA 4EH1A 2YZMA 3G0DA 2Z43A 3GIDA 3WOVA 4BMOB 5TQVA 2F3QA 5AKGA 4CLDA 1YBHA 2O8DA 3TAUA 4XWKA 1DIBA 1PTJC 2H9IA 2P91A 3CLRC 3MGGA 1F06A 5U4QA 4YJ2F 4XARA 5KU7A 1S96A 2LCIA 1YKGA 3P2EA 3CEPB 4I3GA 4YEDA 4HNTA 2WJ6A 1E0JA 2I3GA 1U1CA 3ADCA 1SD1A 3LG2A 3OEHD 2QMOA 4MICA 1ESEA 2PGLA 3GMIA 1N5JA 3FCUB 3WYFA 1XVAA 1UKEA 2F00A 2PO5A 2ZYGA 2YFKA 1S2IA 2LBPA 10MHA 2CB9A 2BTEA 2J9FB 2WTNA 1DHRA 1TI7A 3BK1A 3E7DA 4CF4A 3AYXB 2OY0A 3GUYA 4E5PA 5DM70 4EG5A 4ZYLA 2IYOA 1T36B 5C1BA 1S3FA 3KUDA 2P30A 2Q1TA 3NHSA 1I3OA 3QOFA 2EV9A 2CY0A 1MPTA 5IH7A 2NNWB 4KFCA 3T99A 5AW0A 3EFEA 4PR3A 4CKYA 3HBMA 4OBBA 3D3KA 1C8BA 3D2CA 5EXEA 1FUEA 3ZDDA 1X8GA 4XCXA 4OATA 1E6CA 1GHTA 1LF0A 4ID9A 1H22A 1U1DA 4KITB 3K6SB 3WYEA 2OCLA 2ZJ0A 1PWZA 2FWBA 3HCNA 3RB8A 3LL4A 3VPSA 5H3CA 1KIMA 2MDTA 3AP2A 3ESRA 1FRFS 3P27A 4BV9A 1I4EB 1WR8A 4G41A 1T8YA 5B3JA 3FHTA 2XRFA 1OCEA 4F8JA 5BR8B 2DHQA 3QX3A 1E32A 4DJEC 1AHIA 5HFNA 1XPUA 4WBSA 2DTDA 2X7HA 4L5AA 1GUFA 4YXWD 1PJLA 1ZGGA 2VYVA 1EVKA 3V7YA 4KK3A 5JSHA 3KVNA 4IG4A 1I9CA 2ID9A 2IRWA 3PQCA 2TSYB 1JLMA 1FZTA 1W0KD 3LQRA 1CR6A 4ZU6X 2UAGA 5LD2C 2JDIA 4R54A 3AZOA 2Q5JA 1G5HA 1U2DC 1ZEMA 1ZLXA 3GJ5A 4MWEA 4QARA 4YRKA 5EJFA 3RTAA 4MB2A 1OYYA 4XGNA 2DPHA 4AYWA 5KWJA 2Z9DA 4GOND 2ZRIA 2GZRA 2UYHA 5HIPA 1GNVA 3QXSA 3IEPA 5TVGA 1NW5A 4WZAE 1DD6A 5G3YA 2OCBA 4X84A 1JDTA 1YFKA 1ZA1A 4IHAA 1I0LA 3KLBA 4QGSA 5LQCA 3H2SA 5BWBA 2H7XA 3U1TA 5EWMA 4R1OA 1FX0B 5C4MA 2FJPA 2VZ9A 1CT9A 1PSZA 1QG6A 3R6GA 3D64A 3PDWA 5EPUA 3H75A 3KL4A 2CSUA 2PXXA 3LD9A 3O4IA 3RYHA 4FW9A 3OC0A 1QHSA 1SC9A 1Z4JA 1GTMA 2BKUA 3QX8A 2YICA 5G4KB 4US1R 2AZDA 2CXHA 2ORIA 3UMBA 2HH9A 3R3YA 4YMHA 1II8B 1JLLB 5FOUA 1IBRA 1NNI1 5KAMA 4ASUD 4B6JA 2Y66A 4LOLA 3JAWA 3CNHA 4YUYA 5CVVA 1AN0A 3TSYA 4URVR 4PYJA 5I9LA 1NLMA 5E7QA 5ESDA 4HQKA 2LRHA 3Q41A 4JNCA 4WSOA 1MORA 4S05A 3E9NA 1LGYA 4CR7A 3FPAA 1W5FA 3QFRA 4HSGA 1HYQA 5ECWA 4U7FA 4LJYA 1TCUA 1FMTA 4KAJA 3VZPA 4F4UA 2PSEA 3LP5A 2PLAA 2DUWA 2OPHA 4YJ2A 1IIRA 2REBA 2EGHA 1VFNA 4LYFA 1BNCA 3RS5A 5EHGA 3FCOA 2O2ZA 4OXXA 2BGGA 2GSWA 2Y93A 3O4HA 1TYDE 2XQJA 3CG0A 3E03A 4IUBS 3RHSA 3WRWA 3GFVA 4TZFA 3NTOA 3MTJA 4A0SA 2I2FA 4GPBA 1L7QA 4CMIB 2JJQA 4DJFC 2ID8A 4F5WA 2ZJ5A 4OHBA 3KB6A 2AG6A 4TL8A 1ZC4A 4WASA 2YC4C 1Z8DA 4EECA 1FPMA 2BUCA 4H1TA 2HPAA 1F0NA 1NUSA 3SFVA 4MR8A 4DCPA 5HIQA 2C2OA 3N2ZB 4PLVA 3MOGA 3W6PA 2C94A 4TRMA 4BKPA 4J0QA 3G0GA 1XC7A 3ZHXA 3F9OA 4HDCA 2O2EA 2OXRA 3STHA 4B35A 1JFFA 2EZ4A 3A58B 1FW6A 2H6AA 5DSZA 1YZ3A 2EC5A 1OYWA 1QAOA 3BMQB 2QVCA 4G0XA 4F6HA 1HE8B 3PNOA 1SM4A 3OP4A 5KAPA 3SLKA 5F98A 2RB4A 1GQRA 2C59A 4WXRA 2OFXA 1J8FA 4YUAA 4E4TA 5LNK6 4I1IA 4A6XA 4FYIA 3ZYCA 1LLFA 3ONEA 1CUSA 2WUDA 3BZBA 3FFBA 1OD6A 1XZLA 3BTUA 4ETNA 4PG8A 5HCUA 1XQ9A 2PKCA 3U7QA 5FQCA 3IUMA 4AMZA 4F71A 3RSCA 1YULA 3Q72A 3VZCA 2UZ4A 2OLKA 3QTBA 5FWDA 4AJNA 4BP0A 3EMVA 3RFTA 2L2QA 2G4CA 2OWEA 2H52A 4CWAA 3GLFA 1YC5A 4U6NA 4OQNA 3WJ2A 2GRJA 1U0NA 4Z4HA 4YLEA 4GX5A 1W52X 4YALA 2FWNA 4RPKA 5IYZB 1DTWB 4U39A 3TLBA 1NVFA 1O94C 4L9WA 4EPVA 3GJQA 1KDPA 3WI7A 4RXMA 1UM9A 4LHSA 1Z4KA 2EX1A 4E32A 1HX7A 2RH9B 1U98A 4G1CA 4Q1BA 3L8MA 3HL4A 3SHFA 4K5QA 1SBCA 2WM3A 4R9VA 4LCBA 4UKDA 1A7AA 3Q9UA 2PNJA 5BYBA 3UA4A 1T4MA 3T7JA 2P79A 4R69A 6ADHA 2XCQA 1M8JA 1JDVA 1NJ8A 4RTNA 4KN9S 1JHUA 2UDPA 1PEKE 3WY9A 3UA3A 3ZDEA 3MJDA 3WK6A 4NBRA 4FXPA 4MV5A 1WUIS 2EZ9A 3U81A 3HLKA 1Q7GA 2J7PA 4UM8B 4D2IA 3BXGA 1RQ7A 3AI2A 3P2YA 4EABA 3PG5A 1XNHA 3B51X 3E9DA 5B2FA 3OE1A 3HADA 1AHPA 5E4TA 5GJVC 5IEJA 3O2JA 1WS6A 3BORA 1NC3A 1KR2A 1Q0RA 3NZEA 4GX1A 4ANFA 4EHFA 2VPIA 3U44A 4H4DA 2ZUEA 4A2CA 3PWZA 4EGFA 2W43A 2O2HA 3PQEA 2I1VB 1A7KA 2CXRA 4RQBA 5CXUA 2WJ4A 1AF4A 2YNMC 4XIGS 2UUBB 5L3QB 1SU8A 1VC2A 1RMQA 2M98A 4F4HA 1C9YA 1XMSA 4JLVA 1ZD4A 3M1IA 3EXG2 3HJTA 1KRHA 4FUTA 4U5QA 5K0FA 1ZQ1A 1U0JA 3DH0A 3O9ZA 3LL7A 3O9MA 3S7TA 3TQHA 3WV5A 3SDBA 1O58A 2IHUA 1IJEA 2I91A 1Z2EA 5ARCA 4AFNA 4EBFA 3B6IA 1A96A 1PFVA 2W6OA 3AHDA 3TTUA 5EIHA 1GQFA 2OO5A 2VJOA 1TAQA 1SELA 1L5NA 4W82A 1J7JA 4RHFA 1EA5A 1Y3HA 3DBRA 4WXPA 5AUQA 1FB5A 4N5NA 3TR0A 4D1TA 5HK9A 1WUYA 2G71A 4RY9A 3EYAA 2DFPA 1SXJE 3UK2A 2RHTA 5KSOA 4X1YB 5D85A 3BSYA 1U94A 1OIVA 1W88A 5LP6F 2DQYA 2NUAA 4BE4A 2ZCJA 5HUJA 3QKTA 2W70A 1KTVA 2Q4DA 4CKBA 1L7XA 2NW6A 1YR3A 4F6CA 2OBMA 5AVYA 1VIDA 2RJNA 3GV0A 1IBLB 2ZT8A 4BMNA 2D0OB 3LZ6A 4Q7KA 1Z7BA 4PZ0A 1E3WA 4ND6A 2ORVA 3LUGA 1NE7A 5KOIA 1WF6A 1JQBA 1QTRA 2MT9A 4E5SA 2JGDA 1E92A 2ZIWB 3QEOA 5KYTA 1DT5A 1W9MA 4OO3A 3L8HA 3DGEC 3SM9A 1XTSA 5A06A 2FJ0A 5EJ7A 4EKNB 1DQZA 1N9GA 3DULA 1ADGA 4B3GA 3NPMA 1JR4A 1HDCA 3PWSA 4ZD6A 2CXUA 3HKBA 4DR3B 2VT6A 5I7WA 4YRMA 2J3LA 1YJXA 3PJGA 1LH0A 4UDOA 3EJ6A 2RKOA 1GG9A 4M9XA 1N5KA 3NTLA 2V58A 3O0TA 1WY5A 3B8HA 2FZWA 3FYHA 3MAAC 3VYVA 5ALTA 2NSLA 2VJAA 4U9UA 1C3OB 4CMGA 1ATIA 2XQFA 3AUFA 5JPCA 2JKZA 1EJBA 1V5WA 2XYRA 3NR2A 4HNUA 4Q1AA 1CG6A 1M73E 2MSKA 2GAAA 1I2AA 2OOSA 4B3BA 4DC9A 1YMUA 2XYVA 4IOLA 2YY5A 3EIQA 2CDNA 1HK7A 3ANLA 4GKAA 2JARA 4D9JA 2FOIA 1G3QA 3F8SA 3AVOA 4RH3A 4EUNA 1W9HA 1ISGA 4UDXX 5A5GA 5IMSA 1J5XA 1FP1D 4LY0A 4TT3D 4OX9Y 3VR1A 5AUOB 2DF8A 3HUTA 2J85A 4HLDA 4XIIA 2D5CA 5IBQA 2AZ4A 3BCSA 2CJXA 4IWXA 5DLEA 3WLOA 4HLUA 5AHKA 3VTAA 1FFDA 2AJLI 2JFYA 2LGJA 4EO9A 2YV1A 1MRZA 1LY1A 2BFFB 4KQHA 3T7SA 3F7OA 4BTVA 3A26A 2J5KA 4D97A 1SY7A 2FZCA 5AI4A 3WA6A 5F4ZA 5JV5A 3QTTA 1Z07A 3U80A 5JY1A 4MPDA 1PVOA 2O8EA 1AH2A 5E3JA 3ZQJA 3SW3A 5T4HA 2B25A 1XX6A 4IV5A 2HBQA 3IPCA 3PIRA 5K8UA 5LZ8A 2P65A 2RHJA 3ZVMA 3GN2A 3F46A 3W2IA 1T3SA 1OBHA 3K0CA 4BXOA 2HLDD 3UAGA 5TMPA 1SHZA 3MT7A 4RIGA 3DTVA 3GZTB 4UDNA 1I7NA 1BDIA 1RHUA 1OUMA 2VUHB 4FHCA 2XZDA 5GMOA 3AINA 5JZBA 4UBJA 1I7DA 3JRNA 1HV8A 1RWPA 2GH1A 3DEIA 3QPAA 3CINA 3F4KA 2GF9A 3DGFC 1SVKA 4DABA 2FH5B 1E5QA 1FTGA 3C8MA 4EX7A 4KR7A 3BRWA 3KWMA 3FRHA 2A67A 1LTHR 2OCDA 3LRXA 3W9SA 1Y5MA 2L17A 1M7BA 2B7LA 2Y1GA 5C80A 5IAAA 4CR6A 3U6KA 1OWMA 2JLZA 3ECCA 3VKVA 4LPSA 4GZLA 5JS7A 5LFAA 3LZCA 2PZFA 1M10A 4FHEA 3BRQA 2GFKA 4JBGA 4LBZA 3DHVA 4QX6A 3AEUB 3W1WA 2HIGA 5L4NA 1CS0A 3CCCA 3LLUA 4D45A 3BAZA 3O5AA 3JD4A 1U7PA 1LZKA 3VJMA 4W5NA 4OMUA 3O8OB 1RXIA 4CHGA 4ZCSA 5LP6A 1BCSB 3IQEA 2C04A 1LUAA 3SYLA 2A0WA 3AV3A 1QF6A 3O8QA 4LZWA 3PGLA 4HGRA 4F1JA 4HCJA 3LYAA 1Z25A 2P11A 3ZWFA 3M4ZA 4BLSA 4WFKA 1L9KA 5A9TA 4G65A 1C9JA 2LKCA 5FWYA 3OG9A 1M67A 2OMEA 2ZI5A 2ORYA 3LYUA 1KK3A 4FEGA 2WTXA 3GT0A 4NQ5A 4DSOA 1TIBA 4TLBA 1YV9A 1GOTA 1UBHS 2WILA 2XZPA 3MPUA 3QYAA 4N49A 5TE9A 3D7NA 4AKIA 2Q6IA 5EJ6A 5C7OO 3JQAB 3EXHB 4ZNBA 4MSUA 5SY6A 3OIUA 2ZUSA 1UQUA 1QO9A 3DFKA 4IDCA 4PPQA 1RI2A 2EJVA 3EF1A 3F6SA 4K6MA 5EKDA 5F64A 4F5ZA 3ZHSA 3JQRA 2VJMA 3I6QA 4YRTA 3B7WA 1ECBA 1K92A 2IYTA 4N03A 1KMHB 2ONJA 2DVMA 1N33B 1Q57A 4GBED 2OV1A 4GVPA 5EKSA 3DBIA 3OZEA 3VJLA 5L53A 1OLUA 3PNKA 5EPEA 1B0UA 1Y6ZA 1RQGA 3I9FA 1A9TA 3PFWO 4JSRA 4AX8A 5KTYA 3F9RA 3COJA 2BMFA 4LMPA 1VLQA 2P2NA 1UBUS 1R5OA 5JCJD 1MIOB 2C77A 2A33A 1V8FA 4ABTA 1GV1A 2DECA 3HDJA 4YA6A 1JR2A 4BUCA 1UBKS 1W4CA 1QIGA 1Z6GA 2HREA 4WXHA 5CPFA 4QBTA 1JKXA 2VJBA 3DM9B 2XD9A 1EB9A 3CXRA 3GWZA 3H1EA 3L0DA 4V2UA 4BEWA 2BFDA 4FGLA 3R7WB 4YP9A 3TSZA 5IJWA 1PR9A 1Y5RA 3HYSA 4K9KA 3CNNA 3K5WA 5T57A 3I8OA 4RFLA 2FN3A 3P9XA 5LIRA 1FU7A 1YI1A 4N48A 4DA0A 3A14A 3GVIA 4O2BF 1Q84A 4MR9A 1GFWA 4J3JA 5HP4A 3W9BA 3KNSA 1TKBA 2C2XA 3F3YA 4HQFA 1JEJA 1STOA 2ZJ6A 3AUYA 4O02B 2D1QA 4DCCA 1K3UB 3TH5A 4PU0A 2PXAA 1XB2A 2YC2C 3MTBA 4IQFA 1E5LA 2PA3A 1J9ZA 3GOHA 1V47A 1XKQA 1YUBA 3CH6A 5CFOA 4D9BA 4ZDIA 1OXSC 1XCBA 3S5UA 2PBZA 1RYHA 2DKNA 2YRFA 4CKCA 1NW7A 3BRSA 4TS1A 2WHQA 3RANA 1LD3A 1WW3A 2W58A 2F6RA 2AI1A 3NBKA 3OZBA 3SZUA 3ZXXA 1V71A 2VOEA 3VJRA 3RKRA 4Y6PA 3WWCA 4EYEA 2WKSA 5KMGA 4NZYA 1RVDA 2CGEA 1RC0A 4YVFA 2Q4EA 1SU4A 1Z0ZA 1BCRA 5IZCC 1IM2A 1E4VA 4X93A 1U11A 2JAXA 1V6AA 1BAPA 3OPQA 4GPAA 3TSOA 4CBVA 4RMJA 5B64A 1L3CA 3L40A 3A2KA 2OBLA 3GCDA 1RAFA 1RQRA 5GY7A 1DJMA 2WYUA 5IDXA 4NC9A 5FHRA 2ZAYA 3VTKA 1WHTA 2UKDA 4M8IA 3GJ4A 4X6XA 1TJ3A 3G9ZA 2HRRA 4DV5B 4RH1A 2VUTA 2YJNA 4BN0A 3BGOS 4F46A 1IY2A 1W8DA 4K8OA 3M6MD 2X2EA 4R2MA 2FCAA 3QX7A 1NIJA 5FPPA 1W76A 2NPOA 3IFSA 3IA2A 1PRYA 2EFYA 4HN2A 2H06A 4UBOA 5FI0B 3STXA 3TNFA 3VYSB 2I8LA 1XP5A 4LQCA 2JAQA 2D7CA 3AL3A 4FWIB 4J2HA 5BVHB 4KRFA 4FYYA 5I3CA 1F14A 1G64A 1HDRA 1XA4A 4PAQA 3TTYA 1XRPA 1CDZA 2P2CA 3EJWA 3IE2A 5NLLA 5BUQA 3RBVA 2D5AA 1NZDA 2CVPA 1WOMA 3H4MA 3IDFA 1DTSA 3CRNA 1TMYA 3ULKA 2O0HA 1DP4A 4DQVA 4PXYA 1U3GA 3FYDA 1TD1A 1ZGBA 4WT7A 5B5SA 4PGHA 3T9CA 3DDCA 4LOAA 1L4LA 5AJUA 3MEQA 1B26A 3HDHA 5ALIA 1FDUA 3JQCA 2H65A 2GHTA 1F6DA 4IYJA 4M7PA 4ONEA 5ALOA 3CR8A 5IM4F 2JIQA 2OFOA 3L1VA 3SJBA 3IO3A 1B4DA 4ZVNA 3RC7A 4JYBA 2ZUFA 1DC6A 2HU7A 3PCTA 3ONVA 2IUSA 4J16A 4FCVA 4Q3KA 4IMIB 4ZRDA 2BGIA 5AM5A 1PW5A 5T64A 3YASA 1E3JA 1L7OA 3B5IA 1W48A 2JI6A 5EHTA 3THXB 2O59A 1ISFA 2GVDC 1IEWA 2OWDA 5BUZA 1YH3A 3WKAA 5U9CA 5FBKA 2XBMA 3KZNA 3MTGA 4I9NA 1XLTA 3S27A 2L18A 2P1EA 1XMQB 3PUYA 1SGWA 2G83A 5CR9A 1W49A 3OOEA 5EFOA 4H6WA 4OOEA 4XD7A 3CPHA 1BDJA 3HVKA 3JS5A 3O84A 4K0RA 2QSZA 3HN7A 1GL7A 2JFUA 2WHEA 2ONCA 3HKEB 3RRFA 3VMFA 3CKLA 5TMBA 3L1HA 2PS1A 3KYCA 1LI7A 1HR0B 4G5YA 4BAGA 4G24A 2PQ0A 4NEHB 4J0CA 5A9SA 4PONA 1JYSA 3TVYA 1T5TA 1WCXA 3EK2A 2PY6A 1QVRA 5DYYA 4XUGB 4OX9B 4UAMA 2FW1A 5AI5A 3ETLA 5D3MB 2YN4A 3L3BA 1GRVA 1PG0A 1OF1A 2UUPA 3JATA 4EPWA 1RM5A 1MPXA 3U3MA 3T1TA 1Q3TA 2Y1FA 4YX9A 4RMHA 4R1MA 4LEIA 3A32A 1GPNA 2IYUA 3IEKA 4HB2A 2X40A 3BXHA 1OZHA 5BSRA 4QGHA 3GLRA 2UU9B 3GJ0A 1NYRA 2WT8A 3JW8A 1XDWA 1UF9A 1RBMA 2Z6AA 4DEXA 5KB3A 1W25A 1Z6XA 9ABPA 4ROSA 2FPUA 4TVKA 1JA9A 1K6XA 2X4DA 3C6BA 2I8AA 3ELDA 4KKXB 4D3ZA 2C00A 1G5QA 1U0EA 4JB8A 4LWQA 1VPWA 3OMWA 3VSDA 2B1IA 4PNHA 4OHUA 3WGZA 1QG2A 3LQQA 1YCDA 2F90A 1IUPA 3DO5A 3K20A 1FFXA 3HO8A 4TSKA 2J6IA 3A70A 1FFGA 5LZ9A 1T6XA 2JFQA 3IPAA 1OW3B 1KGSA 3JD2A 2CVZA 1C9NA 4HWKA 3TLAA 5IAGA 4DA8A 2JK0A 3NHJA 3MTAA 3T9AA 4U8HA 3OQNA 1P4SA 4KQGA 2FOLA 2VCEA 3LQ2A 4O8ZA 5ICCA 4JR1A 1XZMA 1W93A 2PMWB 3DOJA 1BKSB 4JL8A 4BWYA 4EKEA 4YDQA 3JYNA 1R4MA 3LO8A 3AR7A 1Z08A 5EC8A 2IPXA 3TNYA 4WOPA 4PGFA 2V6IA 1HFKA 3QI2A 3HSKA 3R9XB 2Q7XA 1EFHA 3EXEA 2C82A 1EAYA 4TTVA 4OLBA 1BS9A 2JJYA 3JQDA 2WWIA 1EE9A 3QG5A 4FYJA 4B3JA 1ZICA 2XGMA 2YFYA 1A97A 4EI7A 1V1RA 1Z0AA 2OZLA 3L0BA 4B9AA 1R18A 5CTJA 1BXKA 1PNQA 4MGEA 3TI9A 3PWTA 2A0KA 5JCZA 3ABIA 1UZNA 1G6Q1 1CEEA