5AHOA

Crystal structure of human 5' exonuclease apollo
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
314
structure length
314
Chain Sequence
SMNGVLIPHTPIAVDFWSLRRAGTARLFFLSHMHSDHTVGLSSTWARPLYCSPITAHLLHRHLQVSKQWIQALEVGESHVLPLDEIGQETMTVTLLDANHCPGSVMFLFEGYFGTILYTGDFRYTPSMLKEPALTLGKQIHTLYLDNTNCNPALVLPSRQEAAHQIVQLIRKHPQHNIKIGLYSLGKESLLEQLALEFQTWVVLSPRRLELVQLLGLADVFTVEEKAGRIHAVDHMEICHSNMLRWNQTHPTIAILPTSRKIHSSHPDIHVIPYSDHSSYSELRAFVAALKPCQVVPIVSRRPCGGFQDSLSPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structures of the Snm1A and Snm1B/Apollo Nuclease Domains Reveal a Potential Basis for Their Distinct DNA Processing Activities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords 5' EXONUCLEASE APOLLO
total genus 87
structure length 314
sequence length 314
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07522 DRMBL DNA repair metallo-beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12650 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5ahoA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5ahoA01
1QH5A 3DHAA 2YNWA 4AX0B 3BV6A 4UBQA 3L6NA 2Q42A 1X8IA 2FHXA 5AHOA 2ZO4A 2OHJA 4FSBA 3ADRA 2OHHA 2BMIA 2I7VA 2NZFA 4C1EA 4UA4A 3X30A 4F6ZA 3BK1A 2YNVB 1QH3A 4Z60A 1E5DA 3FCZA 5LS3A 3SPUA 5EW0A 2WYLA 1WUPA 4O98A 5EV6A 3PY6A 4C1GA 3T9MA 4YSLA 2Q9UA 2BFLA 3AJ3A 3BC2A 2ZWRA 2GKLA 2WRSA 1BMCA 4Z7RA 4PVOA 2GFKA 2BGAA 3AF5A 2YNVA 4AWYB 1VGNA 2YZ3A 4UWSB 2NYPA 5EVKA 4C1CA 2Y8BA 5LM6A 2A7MA 3SBLA 4U4LA 2Y8AA 3IE0A 4HL1A 4Z67A 2QINA 1BVTA 3PY5A 4RL2A 4EY2A 5HH5A 2FU8A 3KNRA 5K0WA 4EYBA 3I0VA 4FEKA 5LMCA 3IOFA 4WD6A 4DIKA 4D1VA 5LLDA 5LCHA 2FU7A 2P4ZA 1X8GA 4RBSA 3IOGA 2P1EA 4XWWA 4JO0A 2P97A 1ZKPA 3IE2A 1SMLA 4EFZA 4NQ2A 1VMEA 1BC2A 2UYXA 2XR1A 1WW1A 2ZZIA 4H0DA 4TZEA 2BIBA 2P18A 4XWTA 5A0VA 3T3OA 4UAMA 5K4NA 1M2XA 2FHXB 3PG4A 4UWRB 4PVTA 1HLKA 5AYAA 2Y87A 1MQOA 1K07A 3DHCA 4GCWA 2BR6A 3WXCA 3SRXA 2QJSA 2BFKA 2AZ4A 3RPCA 2BG8A 3R2UA 1JT1A 2E7YA 4Z5YA 2M5DA 3LVZA 4J5HA 4D1TA 4NQ5A 3IEMA 4RL0A 5B1UA 3I15A 1VJNA 5A5ZA 3MD7A 2FU9A 5EHTA 4EYFA 5ACUA 4FR7A 4GYUA 4YSKA 2BG8B 4ZEJA 4TYTA 5A87A 2WYMC 4C1DA 1XTOA 5ACQA 3FAIA 3I11A 2AIOA 4ZNBA 4TZBA 1Y44A 5LCFA 3QH8A 3RKKA 2HB9A 4TZ9A 1KO3A 2R2DA 1JJTA 5HIQA 4D1UA 3ESHA 3KL7A 4EYLA 2QDSA 1YCGA 3ZNBA 2GMNA 5KILA 4D1WA 2WYMA 4HKYA 1X8HA 5AEBA 3ZWFA 4RM5A 3SD9A 4BP0A 2BG2A 5FQCA 4J5FA 1KO2A 2DOOA 2YNTA 4TYFA 1P9EA 3G1PA 2DKFA 4F6HA 2BFZA 4ZO3A 5ACPA 2Q0JA 1DD6A 5ACTA 3TP9A 2QDTA 3P2UA 2BC2A 4GYQA 4YSBA 1DXKA 1A8TA 2YNTB 4ZO2A 2NZEA 5LSCA 2CBNA 4UWPB 5ACRA 2VW8A 5ACVA 4HL2A 1WRAA 3SFPA 2BFZB 4RAMA 1YCFA 5HH4A 2BG7A 2YNUA 4Z6XA 1WUOA 2OHIA 3H3EA 5FQAA 5AXOA 5IQKA 5B3RA 5LE1A 3I14A 2GCUA 4EXYA 4Z5ZA 4B87A 5EVDA 3DHBA 3ZR9A 3KNSA 5ACWA 5AXRA 4AWZA 3IELA 4DILA 4TZFA 3F9OA 1L9YA 2GFJA 3A4YA 2FU6A 2FM6A 5B15A 5A0TA 4AX1B 2ZNBA 2XF4A 5ACXA 4P62A 4CHLA 5KIKA 5HIPA 2BTNA 5FQBA 4C1HA 2H6AA 4AD9A 4UWOB 4C1FA 4D02A 2QEDA 2BG6A 3X2XA 5DPXA 4BZ3A 3X2YA 5AHRA 4KEQA 3SW3A 1JJEA 3X2ZA 3I13A 3VPEA 1A7TA 1XM8A 3IE1A 5K4MA 3VQZA 4LE6A 5K4KA 3T3NA 5EVBA 3RKJA 2I7TA 4NQ6A 5ACSA 5HISA 1YCHA 4RAWA 5EH9A 3DH8A 4V0HA 2I7XA 3JXPA 5HIOA 3IDZA 2YCBA 3S0ZA 2Q0IA 4EXSA 3BK2A 3IEKA 2NXAA 5EV8A 3Q6VA 4C09A 4XUKA 3ZQ4A 4KEPA 2WHGA 3AF6A 2M5CA 1ZTCA 1ZNBA 2FK6A 1KR3A 4NQ4A 5HH6A 5LCAA 5EWAA 1DDKA
chains in the Genus database with same CATH superfamily
3WGKA 3DUFA 1NDQA 1T5BA 1IJEA 1H1LA 3IKVA 5BVHB 1R8SA 1W30A 4UMVA 3LLCA 1WCYA 1DRVA 1W36D 1WV1A 1YS9A 3P4XA 2FI1A 4U9UA 5DIZA 5JU6A 3DONA 3EZXA 3GC6A 2IEIA 4ENTA 4HXGA 1ID8A 4WQMA 5AK3A 2KI5A 2PO5A 2PX0A 1CRQA 3BZBA 5AVVA 3G2OA 1E2NA 1WXXA 2DULA 3DZJA 4XVCA 4QGBA 2HIMA 2DKOA 4KBFA 1ZD5A 2VA8A 3JQGA 1NZDA 2XYVA 3DHVA 3VA7A 1XZAA 5B36A 3QEKA 1TZJA 2EP5A 4XCXA 3ZWMA 1C1DB 1HURA 2W6CX 1WD7A 3IPLA 4TVKA 4PG8A 5BRJA 4NJMB 3C4VA 1YBVA 2QMQA 4Z4GA 1UMCA 1TF2A 1ZUHA 4JJ8A 1XNHA 4B3HA 4DANA 2DBYA 1N9GA 2Y9MB 2PSEA 4IDQA 4TM8A 5F5NA 4AJIA 4C1EA 3C1OA 1UKYA 3CZMA 2UVPA 3OUUA 3KZNA 1WETA 4N8EA 1SBNE 4XWKA 3GPIA 2G9UA 3ADDA 4XTCS 3A1WA 3DVAA 4A82A 2NSDA 4BGUA 4BXOA 1OGYA 5SY9A 2EOAA 1DRWA 2P5TB 4ZANA 1B6TA 1V5GA 2FOIA 2JL1A 2YWHA 3F8SA 4GX5A 2F1JA 4YIKA 3S1SA 3ULKA 2CYCA 3LDAA 4LI0A 1KSGA 3TLEA 4HC4A 4JS0A 2XY4A 4FGLA 1F4PA 1ZD4A 3RFTA 3ZHZA 2ZUEA 5CTAA 2H4JA 4IPTA 1EX1A 1SKAA 1G55A 3H5WA 4C7XA 1M2EA 1DKQA 2ID7A 1U5BB 2AG1A 4JLJA 2C4MA 3GLGB 5CPBA 1E9AA 1UMCB 1KL7A 1N8SA 3N7AA 2DPLA 4GS5A 3RTDA 1XK7A 3G8YA 4BX9A 3TBKA 5F1OA 3WXMA 4GKAA 5M29A 5TPZD 3LPCA 3PJDA 2F3RA 2DHEA 4UUPA 2ZRLA 3NYWA 1K2VN 4WFIA 3KOUA 3LLSA 3VMFA 4L6CA 2PM8A 3O90A 3GGDA 1XD2A 2Q4EA 1XDWA 2RG7A 3E22B 3VAAA 1L7PA 2ZJZA 5IT4A 3FRHA 5CT6A 4Z4IA 1YS7A 1RWQA 4IIJB 4I14A 2YBDA 3SC2A 3CLRC 4IHKA 4TKVB 4WNCA 4LDQA 3X1KA 1FVFA 4B3XA 3C8HA 4IG9A 2JI9A 4X1YB 4ZJYA 4U7FA 1Q7CA 4F3CA 4MWZA 3I34X 4HGQA 2IQIA 1WBDA 4JYBA 2W8BB 2R96A 2JD2A 2H2IA 2VBFA 4LDPA 4CG2A 1U3VA 5AO9A 5TPZA 3FPKA 4QYTA 1WKVA 3R3ZA 3KR1A 2P6PA 1UDCA 1C9KA 3MTBA 3R7FA 2GTHA 1UXGA 2N0SA 1S02A 3B1JA 4KREA 1JF8A 1N75A 2RH9B 5T6BA 1YR2A 1W75A 4CF5A 2OZEA 4PNPA 4F72A 1GO2A 1MX9A 4Z7JA 3ELUA 3TOZA 1H2AS 3SX4A 3DKIA 2EW1A 4J16C 1U9IA 2VDNB 1U9JA 4H6XA 3UG7A 1N3IA 2D3WA 3B9PA 3EA0A 2R68A 3LLVA 5TGTA 4LA4A 3MWEA 3ZDYB 1KAQA 4RQUA 3DOIA 4AN1A 1NR5A 4GQBA 4EMTA 4DZZA 5LCHA 2ONCA 3H4MA 4F9GA 1K27A 4Z9AA 4FNGA 4Q21A 5ITVA 1FZTA 4EYGA 3OFSA 2YC4C 4FONA 3TX6A 2XKBA 1BEZA 2FMHA 3PZBA 4IGEA 1H2XA 3UV6A 2FEPA 4KSBA 4KGZA 1ZH0A 3FMOB 1OU4A 5HRCA 3SBEA 4XWWA 3P4YA 2BDUA 1YH3A 1D8AA 3NBXX 4GBJA 5BN5B 4B6QA 5JNLA 4D2IA 1CB7A 2QRKA 5CB4A 1TMYA 2Q5OA 3GLIA 1J7JA 5DBEX 3PQ7A 4E08A 3TR0A 4PZLA 1IHUA 1EX9A 3L6OO 3GPBA 2JFWA 1URPA 4JBIA 2W7TA 4RY9A 2H11A 4A6PA 1V11B 1H1LB 1COZA 3DTVB 5BVHA 4JU8A 1HE4A 2DJIA 2H54A 2YJ4A 1KEZA 3IUSA 3UXYA 5FA5A 2J3MA 3A6EA 3RJZA 1OZGA 2QL9A 2OWDA 2PMWB 5G41A 1QXSA 5M04A 4JXZA 4TS3A 1Y98A 4IP0A 2NV2B 2QN8A 1PNQA 5IC5A 2XCTB 1SUEA 1AQNA 3JWHA 2RJ3A 3BHNA 5ADHA 2EJWA 1V6SA 4FNAA 4H1HA 1SXQA 2B4RO 2QJOA 1CNEA 2DJ5A 4E5MA 5JMTA 3DBVO 3K2EA 2GN9A 3GRZA 3PFFA 1FMCA 2GD1O 3E7FA 1BD3A 3KKEA 2PD4A 1KZHA 3VR6H 1P0PA 4QSHA 3F2IA 3W8FA 3R3YA 4YV7A 3SRXA 2GXSA 3HEMA 4REQA 3JARA 2ZRAA 4LPSA 4C7VA 1W19A 4L0CA 2R8RA 4Z9FA 4CG3A 1NBIA 1WKCA 1USKA 4GRDA 4O2LA 4OMCA 4PGHA 3V8RA 4TV9A 4BEJA 2FZCA 2GUWA 3I3OA 5A3JA 1KJNA 2NVUB 4R5MA 4DCMA 1HE5A 3I3SR 4RK4A 3PJFA 2B4AA 4L4SA 2ZJBA 3IVAA 3LUJA 3HZHA 1E6UA 1K8YB 5BSTA 3I2FA 3IT1A 5A7GA 2ZUFA 1Z0DA 1MB3A 1J5XA 5EC8A 3AZPA 4TV8A 1GWNA 2WWIA 1P2SA 2W6JD 4Q7EA 1WUYA 1UP4A 5K0JA 4XCQA 4YXWA 4WBSA 2VJQA 3GAFA 2WF6A 4BO4A 2F1HA 2FPGB 4C1NA 1ZRSA 3I2IA 1CYDA 3WHPA 4PQEA 4CUZA 4DMRA 2PL1A 2E48A 4MVJD 5L40A 1Y9AA 4U6QA 1MR3F 1QRAA 3X1JA 2FU5C 2JW5A 5ICEA 3QY0A 2ZYIA 2JKVA 4OHKA 3TFQA 4HZIA 4OX9B 3SJ7A 1UEIA 5JH7F 5FAKA 2HJ9A 3DKRA 2XGOA 3OPQA 4QU9A 3V1TC 1Z4NA 2ERYA 1Q3HA 1FU7A 1B8PA 2GDJA 4KQFA 2RI0A 3BMQA 5BV7A 1IHYA 5AUOB 2QSYA 3X43A 5GVRA 1AKMA 5HXAA 4PCLA 1G2QA 4EWLA 5C5IA 3GBPA 2X5JO 3FNIA 3Q1KA 3GRYA 5EIBD 3L18A 3PQ6A 3TGWA 3DXYA 4DQVA 1ULBA 2PJRA 5ACQA 4ZVSA 4ZTZB 2EARA 3A1CA 3PXXA 3ENNA 4HAIA 3RTBA 3WYEA 2GSWA 4YCCA 1PK9A 1T6YA 4K40A 4O1MA 5DM4A 4PX2A 5HF9A 1W73A 4QO7A 4HAWA 3DV9A 4FMPA 3U19A 1LJUA 1W8DA 5J63A 3G8AA 4BX3A 2NSHA 2Q3EA 3TQSA 5DGCA 1YDEA 4Z3KA 1KJZA 4LGCA 4O8ZA 1SHTX 1W85A 2CUZA 4HEA1 4N54A 3NPAA 4FBGA 4PLGA 5DYTA 4EYOA 2ZUDA 5FTKA 4XQGA 4US2R 5JVDF 5B7QA 3NUZA 4EQ6A 1XYVA 3WKBA 2NUBA 1TU0A 3ASUA 4Q3LA 1EWYA 1ZNQO 2IXBA 3ILXA 4B8WA 1DT3A 2Q46A 5A2GA 4MYSA 2FGKA 2ZJ4A 2YL2A 3MELA 3M4NA 4BVHA 4BOYA 1OLUA 1NXSA 3CCFA 5TV2A 2WWVD 5G53C 1Y37A 1AUQA 1I1HA 2O3TA 2Q6IA 2VYND 3N75A 3IDFA 1D4ZA 4Y2HA 4PDXA 1NVAA 3NAMA 1AY0A 3IX7A 3LAWA 3LNTA 2W37A 4UZFA 4ZGWA 5SY4A 3TIFA 4ZJPA 2QG4A 2HT1A 1RXEA 3PRJA 4WFQA 5KJ6A 4FE7A 2B0CA 4ZEOA 3MMZA 3OIGA 4CQJA 4DEXA 4I2NA 5IAEA 1C9MA 1QYCA 2ZAMA 3WWEA 1EP3B 2ISSD 3I4CA 4P93A 4YJ2B 1ZUIA 3SHTA 1G4HA 3AFOA 2A5GA 4GOLD 2WF9A 2I3AA 1SA0B 3OF3A 2Q0JA 5IVHA 2FX3A 2QYHA 1TZCA 5FNZA 8ATCA 4CM3A 3KOMA 4PG5A 5AJYA 4DREA 1V7ZA 5EP4A 2CNOA 3DMYA 1G2IA 1DLIA 4EOGA 4W5TA 4BY9E 3KT0A 3BBPA 3L05A 4Y2RA 5EYPB 2AOTB 4BLUA 3R76A 2JGDA 4HUQA 2GZ2A 2PL9A 2XHEA 4MUJA 5F7ZA 5T5QA 4QHTA 2IZ7A 3KM0A 5IVIA 4RS4A 4B3JA 4ESOA 2QSJA 2QP3A 4DIFA 7ADHA 1UAYA 2D2IA 1N2XA 3GJ0A 4XW2A 5DNWA 5DCLA 3EE6A 3RLIA 1A72A 2ADOA 3ZS8A 4A2WA 1QM5A 4UBOA 4CKBB 1Z2CA 2XMQA 1A8PA 4GQIA 1GPDG 1N2GA 4M46A 4NF2A 5JD5A 4HDMA 4KOEC 2JD1A 1GXSB 5LKRA 1U7WA 4BMVA 4KMSA 1G6OA 3WBFA 1N3YA 3GEIA 2IBSA 1WABA 4MH0R 8OHMA 1CBUA 4GM1A 1JJVA 4M1KA 1RPTA 2LRHA 3DMPA 4TQAA 1WRAA 3N39C 3X1MA 1VGRA 1I51A 1PT8A 1TUEA 5HOEA 4B40A 1EQ2A 2I99A 4UEOA 1TM1E 4NY1A 5C8YA 4O1HA 4J0JA 1THGA 5FWAA 2YNUA 2ZRMA 1KJYA 1PGQA 2X5KO 1ZKDA 4JYCA 3WLNA 2XYHA 2GZHA 3OETA 2FKAA 3ZV3A 4CDMA 4Z7OB 3CVUA 1XAIA 2ID9A 5CVDA 5KTNA 3VGPA 1EINA 3DD1A 5FQAA 4BAGA 4JR0A 2DRIA 4RTJA 3REQA 3I14A 2F6RA 4W8GA 1TA0A 5JLAA 1HOTA 2MMGA 3BKXA 3DVRX 2GYUA 1E2JA 1JQ5A 3CLSC 3KDPA 1RZRA 4YJHB 1Y8CA 2V45A 3I09A 3CN9A 1XF1A 4Y9DA 2ZBEA 2CHEA 3KV3O 4J1TC 3O4IA 1IRXA 1G5IA 1YUBA 2VIIA 2VWQA 4ER6A 1JR3E 2XZDA 3V8BA 1QAOA 5FOXA 4XQ9A 4BTLA 2HK9A 2B1GA 5JG7A 2FU6A 4YRFA 4ND8A 1U2PA 1E4EA 3G17A 2QNBA 4Z1OA 4MB0A 1QFZA 2C4UA 4NK5A 2VRCA 3AQIA 3FHLA 3ZE1B 2ZETA 3NORA 5A0TA 1YNOA 1M7GA 4AX1B 3FCOA 1LPAB 1LPPA 4HLUC 1N7IA 2HV9A 3LXUX 4QPCA 3VPAA 3D7KA 4UTOA 4J16A 4ZVNA 4P53A 2WJZB 2XF4A 1YS4A 3M49A 1CB0A 3UHAA 1YVDA 4YMHA 1GPUA 5CLGA 2CCJA 3C41J 3DBOB 3RVDA 5B12A 3SC4A 2WT4A 4DCSA 2BFEB 2XF8A 4U2DA 1OFUA 4HR7A 1PX2A 2HQ1A 4PAOA 1BIFA 1BQ4A 1H0SA 2I03A 3ESRA 2OZPA 2VHUA 3HQ4O 3OP1A 3U4IA 5FFFA 5FQNA 3MN1A 4AP6A 1DC4A 3S8EA 3FCYA 4X8OA 1HDXA 1P9NA 3SZLA 2Z2IA 1P5ZB 5EE3A 3TYXA 2FMUA 1GSIA 1H1DA 4ZDKA 3UG6A 4QD3A 5HZMA 3OA2A 2ZE5A 2ZUSA 5J4HA 3DWIA 3H16A 2I91A 1LFAA 3HDGA 4LYDA 2VEDA 2F67A 3DOJA 3MLBA 3Q6NA 1EDDA 4L8LA 4NQZA 1TE2A 1VLHA 4P8RA 1NPYA 1G5TA 4QUGA 2AOXA 2B25A 4YQYA 5ECDA 3AMVA 1UUFA 2DFNA 2HM7A 4OHBA 4D80A 3NHLA 4GP9A 1XM8A 2YY7A 4YRIA 5BSHA 3MCWA 3CH5A 3K7EA 2GM5A 5DT9A 3TZEA 4BMPB 4YRSA 1QHNA 1ZD9A 2ECOA 1X7YA 3U7QB 1PV1A 3BWEA 1QF9A 5C8YF 3OU6A 4RD2A 2IBMA 1V1JA 4FYKA 1NV8A 1KRWA 5KTTA 3LPMA 2YFYA 2JCBA 4P3XA 2OYCA 3P52A 1C9JA 4C30A 1MD9A 2Q1SA 4BAUA 1UFKA 1G3QA 3F4KA 2BHSA 1ZN2A 2FRDC 1G42A 3KS9A 5JDIA 4MA5A 5I3ZA 4G8DA 1M2OB 2XUFA 2BONA 2HU8A 1TUGA 2CMHA 2FPKA 2RIRA 4BFTA 2PSHA 2YVQA 1E7MA 3A2MA 5BWMA 1ECPA 1O6BA 4TMFA 5TEVA 1TUIA 4F5WA 4V0HA 1UPAA 1YTLA 2EFDB 4JASB 1HFKA 1M0SA 3TTWA 2ZTVA 3PVZA 4W1PA 4BIMA 2PZGA 4K6CA 2C4WA 2VF2A 2XNSA 3TTUA 2BE9A 4RZXA 2XYGA 2QVBA 2SBTA 4IY1A 1IN1A 2P1RA 2P4HX 3WJAA 4DL9A 1F06A 5FP0A 1GN8A 3W9YA 1YMUA 2GCOB 4KMRA 3T9AA 2C9CA 3IEKA 1PW7A 2AYZA 4Z86A 3W5IA 3K70C 2Q6LA 2FR1A 3QPAA 5IYZB 4C7OA 3LGSA 4G8BA 4F8EA 2NXAA 3K9FC 2BGJA 5K8TA 3WQBA 5EZYA 1Q74A 2NU8B 1QYWA 3TNDA 1KEKA 4I99A 4GH5A 2RK6A 4Y2XA 4K28A 3FFTA 4AK9A 1R00A 1M2WA 4LHYA 3AP3A 5CDFA 4B2IA 1QHHA 1SURA 3EHEA 4JC8A 4ONEA 5ALRA 4I1IA 2FK6A 3CSSA 5JHGB 1CIPA 5LYJA 5TT1A 1TM5E 3AW8A 1FPQA 5IM5A 2FN7A 1MT0A 4GECA 1CZLA 3UK7A 5LCAA 3ZOKA 1GAXA 3AUKA 1KE1A 5I9SA 3ZVKA 4M49A 1CUCA 3F9RA 3P27A 1VFNA 2H4WA 3KKZA 4DR1B 3V1MA 5TGDA 1GZSA 3L1HA 5DT2A 2VTKA 5FBZA 2VNKA 4CLXA 3JCZA 2GFQA 1ZW1A 2NXNA 3TFOA 5KCZA 1G5PA 1V4VA 3ZDFA 4ETWA 1DINA 2XUZA 5E9JA 2Q8QA 4MJXA 4PC1A 3TGPA 4UQPA 5BYBA 3JD1A 1O4VA 5BSGA 3CRVA 3C4QA 3GN1A 4KN9S 1JBEA 1AGRA 3PJRA 3ICOA 2QV0A 1MO2A 3TLGB 3T06B 4DAOA 1P5RA 3C5EA 2GLXA 4G36A 2ZAIA 1XB2A 3O75A 4Z3DA 3JWIA 4DR4B 5C1IA 3EQ8A 1K7EB 2XDWA 1CRZA 2XUQA 4OREX 4PZEA 5DGXA 1GQYA 4U5XA 3VBCA 2P79A 4V0KA 4UU7A 4ZZIA 1MHTA 2AHRA 2BTEA 1U8XX 2IYRA 3TLKA 5JT1A 2Z04A 1Y3CE 1RKXA 3A1DA 3EHDA 3O8DA 5FPYA 3RARA 4DXDA 3Q3IA 5IJAA 1K7XB 4M0CA 3TLJA 1PYOA 2VUHB 3R7BA 3M4YA 1JTFA 1QGOA 3E22A 3VQTA 4BECA 4E5DA 1WZ2A 2UKDA 3KZVA 4W5OA 3U09A 3UMRA 3O3OB 1T1IA 4KFTA 1KDPA 4BKUA 5J2TF 2Y1KA 4GI7A 4QXOA 2B9EA 3BXPA 4JZYA 5FR1A 4BN0A 3KDAA 2EERA 3FFAA 3SD7A 3IPAA 4FW9A 4BMCA 1XFDA 4UVDA 2FPGA 3A2KA 3NDRA 4HAOA 1ACJA 4C6HA 3KJHA 4K8RB 1YR8A 2AN3A 3FYUB 4X71A 4IHJB 4LOKA 4C0LA 4AP5A 4O0LA 2C2WA 2P5SA 2ZIFA 2XE4A 1YXMA 1Z3IX 3BE5A 2XTAA 3H1TA 4GSKA 4NYIR 4HDKA 1DC7A 2Q2NA 4MRSA 3H5IA 2MINA 3VX4A 4P4LA 1BXRA 3K92A 3ZWOA 3AVWA 2Q5IA 4NE7A 4GVLA 4P4GA 2UZAA 3H2GA 5ITWA 1RZUA 2XDAA 4Y9RA 1COWD 3W9BA 3WIOA 5E2BA 3NBMA 4LWOA 5F21A 5EVKA 4Q9LA 1PVOA 1JPJA 4C4RA 1CS0A 2FW1A 4Y9UA 2IGTA 1PS0A 1RWBA 1KIMA 4H3SA 1SUFA 5ICFA 4UAJA 1ZSNA 4AMUA 4DS3A 3KYCA 5D3MA 2NLOA 3OZAA 2CLFB 1T0BA 2BBWA 2M6RA 5LJIA 4KL8S 3TLZA 2VZEA 1F9AA 4MV3A 1FYDA 3KOOA 2Y1XA 1B1AA 4LY9A 3PY5A 1ZMTA 4XSHA 1IQ0A 1P3JA 2C8VA 1YQEA 1ZM9A 3NRJA 4K81B 4NMWA 5EZ6B 3AI1A 4D92A 1T36A 2Y1WA 4XARA 2JHPA 3EVDA 4CDNA 2WT8A 3CE6A 3DTVA 4N03A 1WO8A 4KQ1A 2BN4A 3U62A 2H9IA 2IU3A 3MTEA 5EKDA 2JGRA 1M7HA 4IDDA 4WN3A 3TZKA 5MF6A 3NM6B 1XD2B 4O5AA 2Y71A 2GA8A 3RS0A 3UMMA 2NT4A 2X3UA 3E8MA 3HY6A 4X84A 4FEKA 3Q9UA 4EJSA 4CTMA 1NBME 4Q3OA 2W2KB 3WZLA 1PT6A 3WWCA 1E2KA 1D7OA 1EQUA 2F64A 2QGZA 3ND5A 3RKUA 1NF9A 1FTGA 2ZSAA 3RRJA 3V2UA 2YYAA 1M1NA 4L3WA 4LXIA 4BFWA 1KH2A 1AKUA 3LTNC 3VPGA 1ZK2A 3F73A 1OTYA 3IUYA 2PKXA 5DLQC 2P97A 3I73A 3C16C 5FTMA 3T4PA 4LOIA 3MJSA 4NYMR 1B42A 3GG2A 3V8VA 5FI3A 3UOAB 2IYFA 2YKGA 4WECA 5JJLA 1LFDB 1UBTS 1SVKA 3G5TA 1NQXA 1N5RA 4N82A 4OLBA 1K92A 4LQCA 4P32A 2OG1A 1PX0A 1VPTA 1NI4A 3AKYA 1MO4A 1VE1A 1PYDA 1KMHA 3CINA 3LV8A 1XKLA 4DCUA 3PLAE 3SK0A 4XDHA 1ONSA 1T35A 4QXRA 1E1NA 1YDFA 1PKEA 4QLAA 4S1WA 1G4AE 3AR8A 3UFXA 1TVMA 2IY9A 2YUIA 4HQLA 3QVXA 4ZYTA 2XKKA 2AFHB 3BE6A 4CM1A 2I4RA 1HDYA 2C9DA 3D6FA 1F2TA 3VKUA 5BUZA 2UUCB 4A1OA 1OQAA 3LUBA 1ZPDA 5TR9A 1R10A 4KDRA 2CZCA 4HDMB 3W78A 1M2XA 2ONJA 2WJGA 2F62A 2K4MA 1MX3A 1SHUX 3H1GA 3DHCA 3F78A 3D1VA 4NPCA 1TQDA 2YMQA 3GLFA 4G1CA 3STXA 1N2HA 3SICE 4YJ3B 3Q6MA 3C7DB 2DCUA 3K71B 1AO0A 3FUUA 2E3JA 1GARA 1GTJ1 1L1RA 2R60A 1DIOB 1V11A 2QE7A 3CVOA 3OSUA 4MPTA 4O4IA 2A9FA 3DO8A 4AUEA 1A4RA 3PQ8A 4JWTA 3F8TA 4M86A 4R41A 3WGJA 1MAVA 1HYEA 4N5MA 2ZIZA 4OYHA 1SCAA 3UMBA 3NBUA 5EHQA 3AJAA 1FFCA 1N9ZA 2VYQA 1W4CA 3HB9A 5EEHA 1C3XA 1TYEB 5AYVA 1EUCA 2EZ4A 2QX7A 1FNDA 3FX2A 4OYYA 4R2HA 4CIXA 4ASUD 3O6VA 3ZBPA 1JECA 5GOTA 2CHFA 2J07A 3D8HA 4IW3B 5EA2A 1FLNA 4JQZA 5JAMA 3ZLVA 3V4LA 2R65A 4IQ4A 2YJTD 1QVAA 2L69A 2E0IA 4BMDA 4B0PA 2J09A 2ZQZA 2I65A 2ZRPA 4O0MA 4UUBA 5I7AA 4B31A 3ETNA 3CLVA 2BF7A 5DWQA 4QARA 5AJVB 4L6IA 5FOWA 5EHTA 4HB3A 4ENVA 2JGNA 2VHTA 3GUVA 2WTXA 2Y0CA 3LPNA 1KH1A 2LBPA 4P35A 2AC2A 2Q5QA 3TLYA 1FFHA 3C48A 5LNK1 3I5XA 5H02A 3GDHA 4XVHA 3D0OA 1NM5C 1W36C 1MAAA 4LUCA 4G86A 4YB8A 2TSYB 3JVDA 3WNQA 4AJ2A 5JQWA 4PF1A 1N4AA 2Q1TA 3T41A 1JILA 2IYUA 1UODA 3MBKA 3BSFA 2B69A 5IARA 2ADFA 4V0QA 4FHFA 3BGVA 4OG2A 1XMXA 1E99A 2VJMA 3OFJA 4FEEA 1XDBA 1YT5A 4QYXA 5GAJA 4BVAA 5IT5A 4E94A 3QH8A 1L7OA 3F5MA 1NHGA 1OLOA 3PNKA 1E0AA 2GZ3A 4S05A 1TJ3A 1GAJA 2R62A 2ZJYA 1PG2A 1W0JA 4D1UA 1VCMA 2D0IA 1G7CA 2VT2A 1L4KA 2CXOA 4NVRA 3TE7A 1Z37A 2HMWA 5E6SA 3R7DA 1U3GA 4ZCIA 3AF0A 3P9SA 4D4GA 2BEUA 3AXTA 3ZHSA 2AN4A 1XYGA 4CIYA 2E18A 1UT8A 4G4SP 4TLDA 2GZRA 1SQ5A 2ZYTX 1XZCA 1AGXA 3NTUA 1E2EA 1L4YA 3F8WA 5FBLB 1JI0A 5TGZA 3RANA 2CVFA 3SF8A 1Q3KA 1SBCA 3GLFB 1TO1E 2GD0A 2HZBA 1YZYA 3F5DA 6GPBA 3RSSA 3AIMA 1G8HA 4MV9A 4CF7A 4I3HA 3T54A 4YHHB 1UEJA 2XB6A 3OHPA 4RY2A 2JLCA 3MWEB 3H5OA 5GINE 4MWBA 3PSAA 5HOQA 1HV8A 4BQSA 1HKUA 3BS4A 1HLPA 4MI1A 1KYXA 4L50A 5DOVA 3VNUA 1T9GR 3H17A 3DHYA 5LXTA 4F12A 1VPVA 3UAVA 1RCTE 2Y0BA 4X5OA 2Z4RA 3EULA 2OLJA 3PFKA 4MW4A 1HTWA 2ID8A 3SSNA 2QTNA 1WY7A 5CYFA 3G1PA 3SHVA 2HCRA 1XHFA 4D6PA 4F6CA 3A4IA 1TC1A 2XGJA 5B1HA 4F84A 1NFFA 3LYAA 4FJ0A 2I6XA 3MAGA 2OXFA 1A04A 4F96A 5GJCA 2AKEA 4EVSA 5KPDA 1UT5A 1TGVA 1C1YA 3M8KA 5HCNA 4OHUA 4D0RA 1T3HA 4RHCA 3T95A 3C5HA 2FZVA 3GZJA 2P6OA 1E58A 3LQQA 4FJ2A 4JI3B 4NYMQ 2W00A 3TZQA 1UCFA 3KX2A 2I3GA 5IM4A 4YECA 2R4QA 4HB4A 4UTVA 1HH4A 1QE5A 4FMDF 4G4GA 1K8RA 2AN1A 2ID4A 1E64A 1AA9A 1MOPA 1V8BA 3RYIA 3LY5A 1K5DA 2AFVA 3HJAA 1P1KA 1EZZA 3T1HB 5BW8A 2D59A 2XPCA 1DXOA 3YASA 3S5JA 1J2EA 2HSEA 2O6LA 2WPNA 3K9NA 1N2SA 1MJ5A 3VDQA 1ZJZA 1G63A 5CB6A 1XMSA 1M76A 4X20A 2PUAA 1ZGHA 1Y4ZA 1O95C 3H0CA 4KIUA 2H16A 2BG7A 4GI5A 1NVEA 1VSUA 1P1BA 1H94A 1RE0A 1GP2A 2FSIA 3TQIA 2ONZA 4E5UA 5LMUB 2LUOA 1WUOA 2PU5A 3C5CA 2X0EA 1W1UA 5BP7A 2WP0A 2AOUA 3GNSA 1PGPA 4KN6A 4QPPA 4CHTA 5K8JB 1HFEL 1DHRA 1T8TA 2KJQA 1XKTA 2WM8A 3MW8A 4ZQEA 2WIBA 5T8KC 2P9YA 4ABYA 5LE1A 5C18A 3H4IA 5CA0F 1CY0A 4GMDA 3DJYA 4IXMA 2IYSA 1F1JA 3U1TA 1E3TA 2FOXA 4EZEA 2GYWA 3ZCPA 4KQWA 4X91A 1G1MA 4XB6B 2IV2X 1JIXA 3GEMA 4HWGA 2IL1A 1E6MA 4P82A 2VVTA 3DFIA 4MVWA 4R7ZA 3DVSX 1M72A 1EJ2A 4RL4A 1JZTA 1M6WA 1SOAA 1V41E 2ODNA 2JAUA 3QX9A 4NPHA 1MJNA 2OYRA 4B44A 1XZLA 3VC7A 2J3KA 4X8MA 1G38A 1VHJA 4C29A 4DG9A 5AQ1A 3AY7A 4FMDB 4QL3A 1CR1A 2HWWA 4TSKA 2CLDX 4K6FA 4OATA 1CUBA 2EDAA 4RSRA 3PHJA 2YRFA 3I12A 5A2QA 3W0LB 1F48A 2AE1A 4Z6KA 3CUUA 1W4BA 3RIXA 3HCWA 1DXHA 2B21A 5E1MA 2QBYA 3SIRA 2REOA 3WLHA 4OLHA 4FCVA 1JR3A 3ILYA 1XDDA 4RFSB 4R84A 2BLNA 4D8WA 4HHEA 4E5KA 3AETB 1Z62A 4IXTA 3VC2A 1RD4A 4B75A 1HTTA 3HLKA 3W4KA 2Q5EA 3L6CA 3NV7A 4GOKA 1JWLA 4YRLA 3AFHA 2I29A 3OIVA 4F93B 1Z6GA 2C8LA 1I1QB 5E6RA 1DXYA 1U5CA 2XWJI 4BZ3A 2V4MA 4BFZA 3QHQA 3RVBA 1BCRB 3DZDA 4K3UA 4ND8B 5FKJA 3RC3A 5AIAA 2HQBA 4D82A 3E9DA 1YR7A 2JANA 4JD5A 1ENOA 4E32A 4UHBA 2PR7A 4P4TA 3AZOA 4IKEA 1O58A 4RFVA 2GHRA 3JD2A 1NKSA 1TM2A 2VWHA 4MHOA 7REQB 1H9AA 1UJ5A 3H9EO 4R8MA 1NQTA 5DTIA 4D8YA 4DIUA 2EKLA 3C3MA 3Q9NA 1QJCA 2CLHB 2ZP1A 2QZSA 1K08A 3F1LA 1ZWLA 4L4ZA 1OXSC 4FMCB 4Q9AA 2GBPA 3LQKA 1PJ8A 1SHLA 1PFWA 3HBMA 5DXAA 1NUTA 2E5FA 2YZ7A 2FP4B 2H6EA 2CDCA 3A06A 4M6WA 3V1NA 3ZQKA 1X1AA 2AC4A 5C8VA 1Q7RA 3RKJA 1RWOA 5JHHB 2FM6A 4P7BA 1JE0A 3CYFA 2BOVA 5LZ4A 5B4UA 3WYDA 2AXEA 3B60A 5IC6A 2Z5VA 5ESWA 1ADJA 4K6GA 1C3LA 1UFRA 4LG1A 5DTRA 2ZBQA 2Y1CA 1AKTA 2E4AA 5JXIA 5JBNA 4DUGD 5J3JA 3RUIA 4EP1A 4YMTA 2H48A 1ZINA 2VPWA 3QF4B 5ALZA 2J9GA 4CMIB 1XZBA 3A3YA 3LZDA 4Z7NB 1XZMA 4ZVUA 3GHHA 4HS9A 5K01A 3A05A 1WRBA 4W7SA 1SIUA 3DQPA 2P9CA 3OQVA 5TS3A 3FTDA 1EVZA 2JIRA 4Y6GB 4BGEA 2BKLA 1H5NA 3N3BC 2GILA 1Y9ZA 2XTJA 3H6KA 5H68A 1ZJ4A 5AJWA 3UZUA 2Q21A 3CVVA 2HIAA 2WJWA 4LV6A 5BYKA 4D8UA 1ZICA 4W9NA 3O82A 2X0FA 1T15A 3NKLA 3H2BA 1D1QA 2DTXA 3EARA 3MINB 4J9VA 1H2HA 4KYTA 3ZGYA 2WLTA 3U9LA 2WAOA 2JC3A 1Y48E 3HSSA 1JDBB 4TXJA 2OEPA 2GXUA 1W87A 2BKAA 1KMCA 4FK8A 5C52B 4GSYA 4DCVA 1RFLA 3LUHA 1N5LA 1BDMA 1AGNA 4KNWA 1ZXXA 2EZTA 5DHFA 1QZTA 3PXBA 1PZHA 1YA6A 1IOWA 4J0EA 3NIBA 4QOHA 5ALEA 5AIBA 4AICA 3H1FA 5D6NA 5I7OA 3COJA 2VNAA 2RHOA 3DHNA 3DXXA 1XVTA 2R8PA 1XU7A 1AURA 2MOKA 5TDHA 4HTFB 5T7BA 5IH7A 2DHDA 4PFJA 4B4KA 3DS8A 3GJ7A 4JJIA 3TVYA 5K0GA 1TTQB 1FYWA 1DDKA 3MJRA 2GI4A 1KFKB 5KNLA 1TCAA 2CSXA 3TSZA 1R0KA 3RSLA 3UT5A 4IYRA 2TECE 1ADBA 3EDRA 2VTBB 4ZAFA 3ICCA 2FK8A 3EFEA 3OVMA 4ZGGA 4BGDA 2CXSA 1MW8X 3Q3GE 4BQNA 4TZ0A 2ZUTA 2JASA 1UFOA 4MIEA 3UYKA 2CCGA 2IZ1A 4XM2A 2NU8A 4PFKA 5BMOA 2DXIA 4NV3A 3HNOA 3KHSA 3QWBA 1A8IA 4J3JA 2OM2A 2LKCA 3D3JA 3ONDA 1XWIA 4YRCA 3AVTA 5D51S 1A95A 5EKUA 5ELMA 3LX4A 2ZRDA 1H2RS 3TW4A 2NN3C 1JHMA 2CMKA 2OMEA 2YRXA 2P4EA 2H7YA 2R1VB 4IDBA 2DWUA 2D06A 4IIJF 3UPDA 4NZPA 2ZO4A 4HDRB 4ZJUA 1OLSA 1EG2A 1A9RA 1HLFA 3AEKB 4NSNA 4DNQA 2OHHA 1LPBB 3HDJA 4TYNA 5BOSB 2O20A 2V8BA 2G5TA 2V7UA 4LBYA 2XOEA 2QBYB 4OXNA 5C3UA 1AC5A 1EFDN 4X44A 1MTOA 1L3CA 4FQ8A 3LYHA 5DNCA 1MA0A 3FDZB 5B2EA 1JKJA 1P31A 2AZMA 3EXG2 3FAZA 3B3AA 1CS0B 1UINA 2HTFA 3G2JA 3C3PA 3NKVA 4QSMA 4MVJG 4R4JA 4X6XA 5AUNB 4RIGA 4QQKA 4CLEA 1QYRA 4PLTA 2CWDA 3I5YA 3UUEA 4MS1B 4F9TA 1RAIA 1N5DA 1XVLA 3A3NA 2AB0A 4G56A 2M32A 3O73A 2JLAA 3ITKA 4ILKA 3ZW8A 4HDAA 4R05A 1HKHA 3F7MA 4QOSA 3O9VA 4BP9A 3KETA 1EGQA 2UYGA 2Z8YM 2ZITA 3BXFA 3M5CA 3ZWPA 3BFXA 3H99A 2W2PA 3OLZA 2X3FA 4BMXA 4DFDA 1XZKA 1SKQA 2NYAA 1Q22A 3QHAA 3CVYA 3KQKA 3I2YX 4LQDA 5HSGA 2G63A 3HI4A 2ATIA 3NXKA 3SJZA 3EQ9A 1BRTA 1WUTA 2C0QA 4L1KA 4OKNA 2D1YA 2J9FA 2Q9BA 3FHOA 3K5IA 4BLOA 1OC2A 2WF5A 3W8DA 3HA3A 2XV1A 1CUAA 9MHTA 1J1ZA 2YY5A 1GPJA 2WIAA 2ZJ8A 3EODA 3FR7A 4N8SA 4I50A 4BO9A 1XVUA 1EVYA 1ZP6A 1MJHA 4QQ8A 1A8UA 4MB2A 4CLRA 2VPTA 4QOIA 4RXTA 3SQMA 3DCIA 3M1LA 4HNSA 5G0UA 4AX4A 1VL5A 1JJBA 2ZWIA 3UWDA 5FWNA 1U98A 3AJRA 3NI2A 5IVPA 1PL6A 3GY0A 2IOFK 1NMZA 1MLDA 2B4TO 5DHTA 5E7IA 5SZHB 4C2AA 2Y8AA 1C8BA 1PTKA 2GK3A 1L7AA 4HGYA 1H66A 4Q47A 5D3ZA 2B4KA 1GIAA 3LCCA 3VSAA 2D7CA 2IOQA 1LZKA 1DIHA 4M88A 1TF5A 4WPGA 4LHZA 1GGHA 5U4QA 1U9YA 4HRVA 3ZXUB 4MUHA 2OUKA 2W70A 4RL2A 3QA3E 4Y0AA 4BC0A 1XZJA 2D54A 1KFJB 5IF3A 1Z83A 1Y7TA 1U31A 3G0DA 4NFYA 5I9MA 3L0OA 2IDMA 1VYTA 3L0ZA 2GAAA 4UCQA 1RQLA 2BRUC 1K75A 5JY6A 3L4KA 1Y6FA 2R9VA 1EHYA 1P0MA 1G21A 3L7BA 2PVPA 4YX9A 5BVGA 3WKEA 2NVOA 1XLTA 4BV8A 3BKWA 3FYSA 4A4DA 2NTVA 2VJCA 4AY5A 4J0QA 4TLBA 5CYOA 5KNBH 2XDQA 3G13A 1Y8RB 4ENRA 821PA 1OT5A 4LXQA 2P3SA 2WTNA 3GLTA 4HV4A 3P9XA 3B9QA 1O8CA 4HH1A 3IOGA 2ZR7A 1ZD2P 3O8LA 4JO0A 5ELLA 1U7ZA 2WIKA 1UWVA 2N9UA 4FYPA 4NRDA 1GGEA 1JFSA 1W2HA 1SMLA 5EMLA 3PQ2A 2PCJA 1FTNA 2NO7A 4A8JC 1A1VA 4BHTA 2ZOSA 2ZKLA 3T3EA 1BCSB 3OOWA 5EGNA 2YWCA 1GGMA 1J0DA 2A1TS 3L40A 4GYYA 2I4LA 4TV9B 4QULA 2VTDA 3K9WA 1W94A 5DU2A 2OP1A 2O8NA 1DDGA 3OPMA 3AR5A 4PYJA 1SIBE 1U2GC 3AZQA 3I6QA 1FQKA 1A5ZA 1XA4A 3WLEA 1MG5A 2VLBA 2XOKA 4X1KA 2HWUA 4XWTA 1RXCA 3AKZA 3LRXA 3TQOA 3UUWA 2XWPA 3Q7RA 3RDPA 2MTBA 5LLSA 3GEHA 3FFXA 5IN5A 1AHPA 2R6R1 3TOSA 2BGUA 4TVSA 3AF2A 3ZGZA 4X65B 4EHFA 4DVJA 3T3DA 3ZNQA 1A96A 2SECE 3CE9A 1HT3A 3RW9A 4EJFA 1G0OA 3NWEA 4P38A 4YRPA 3A27A 2AX3A 4IVRA 4C2UA 1E2GA 4I08A 3IB3A 1JDUA 1ODJA 1P61B 4GLBA 5ALQA 3RK1A 4OVKA 3N58A 2QUZA 4HWRA 1N8TA 3MD0A 1OILA 4PAMA 1MZPA 2R0QC 5LP6C 2N3ZA 5CIWA 1SBQA 3O4VA 2YV5A 3O3MB 1CUXA 2Z9BA 3CF6R 1GA4A 3IOYA 3FJYA 3PF9A 2IH4A 2B0JA 2XTMA 3FCEA 4JCOA 3RHFA 1OR8A 1TVKA 3X1YA 4UASA 4L08A 2FRVA 3TTSA 2J9YB 3ELDA 3EVBA 4GDMA 1ZM7A 3B6ZA 3GBSA 3JU3A 4A5OA 3C70A 3K1YA 2XD9A 3G1UA 3TQRA 1ISSA 1GQOA 2G04A 3ZTWA 4QBFA 5CW1A 3UGTA 4BNUA 2OT3B 4CBVA 4EHKA 5JV5A 5KWEA 4U3JB 4DWVA 3SYKA 3WADA 1YZTA 4EG4A 3HWX1 1A9XA 3GFQA 1OIVA 4KWHA 2IX9A 1U0EA 2K2WA 4IDPA 4AN0A 4XM0A 4D9KA 2BAGA 1XN1A 5B3LA 2A4KA 5CU7A 4AF8A 3SU8A 3ZYZA 4TKUB 3J7AC 2XGMA 1ZCZA 3ME5A 3DC7A 4M8SA 1L4LA 2HA4A 3Q1LA 2NSLA 4CGZA 1TJ4A 3KOZA 1PZXA 4IIGA 1LH0A 2NAFA 2RGUA 3ETLA 5TARA 1H2YA 4HZUB 2PT5A 2FCAA 2ZYWX 3TFWA 5IAKA 1W36B 1GEEA 4FR0A 1WVGA 3ABOB 1G6Q1 2GPAA 1EIZA 4GC5A 1AZTA 2CV2A 5HM6A 4NBKA 3BXEA 4BX8A 2GAOA 4V0SA 3DBRA 1YVEI 2FHSA 4OV6B 5F4BA 5IPFA 1NJGA 4B09A 5FWDA 4XUKA 2EL7A 5EIWA 3KD3A 3A6HA 1A8SA 4ZVRA 1IMJA 1LLUA 3A4LA 1YU6A 2QMZA 2DCMA 3HUTA 4ID9A 1PWHA 1R4NB 4EARA 1JLMA 2OCXA 3H18A 2D2EA 2PUTA 4L9WA 5BPHA 3SWWA 1Y6GA 1FUKA 1WM1A 2FUEA 2Z4TA 2QJWA 4MR7B 4FYXA 3M6FA 1UKCA 2MSLA 4IO1A 1JIQA 2R6DA 1NNUA 1U1GA 1NJ2A 4ZO9A 5DLYA 4EB0A 2AEEA 1EGMB 1D4OA 3DEJA 4ME6A 2Q29A 2REQA 2HJHA 1NUSA 4IUBS 4NOMA 3L46A 4RYDA 3T7CA 4LCBA 5G3ZA 1O5IA 2ALJA 2E49A 4MK4A 1NBHA 3I8OA 4HK4A 4F71A 4F4HA 3BRQA 1UMKA 2FW7A 3WNZA 3FPEA 1E32A 4MP6A 4DNPA 4WESA 5LIPA 3RS8A 1FLVA 4TVOA 4C7JA 3VTZA 4W7IA 4KWEA 2QY9A 3I2GA 2ZW9A 3FOBA 3IA7A 3R40A 4RZ3A 5GJWC 1HRDA 4AY6A 5HBGA 4BFVA 4BO2A 3EGVA 3IHKA 1ZA1A 2YMPA 4P83A 1IBSA 1X1DA 2NG1A 4XSVA 1RYEA 2XECA 4S1PA 2QTGA 2XUOA 3LCRA 3NEPX 2JVJA 2OGZA 3PU6A 1Q17A 1L7QA 3BXZA 3KHKA 5DLEA 5GJVC 2QLNA 4OH7A 1UPTA 4QUAA 1F20A 4CM4A 5JJCA 3CF0A 2BJVA 1XD9A 1RNLA 4IGIA 4BZXA 2L19A 2BV3A 2Z0MA 2Y1FA 4DIMA 1NVBA 3NCHA 4ZJZA 5H4GA 3LX6A 2RHDA 4NKRA 3R9KA 5BWBA 2PMDA 4XWOA 3G88A 4QNMA 3UMFA 1Q7TA 1A8TA 1WU7A 3OE4A 5DULA 1QCCA 5K6AA 4RTRA 2FQQA 3C3JA 3LHIA 3PRKE 1JSLA 4TSRA 4ECAA 1YJAA 2JLRA 3NTLA 2VW8A 4CCAA 1RHRA 1CQIA 1RM3A 2Q2QA 5GONB 521PA 3ZU5A 4WXPA 2QLMA 4PZCA 4H1TA 4JNCA 3UGKA 2WB2A 1P5HA 4I46A 4MO2A 2KX7A 5ERGB 3P9PA 2PT7A 4UKDA 1E98A 3ZVLA 1U8AA 2AWOA 3GCWA 1WF3A 4XKJA 3RROA 3TSWA 5CXQA 3JWGA 1J1IA 1QGAA 1SU4A 1YASA 3DW3X 3JQEA 3PL1A 4O08A 1T34A 1FXWF 1TUBB 4L07A 4XDZA 4DV6B 1X7WB 1RP7A 2FWNA 2EG5A 5CVTA 5IEJA 5B3RA 2O8DA 1NQUA 1PEYA 1AQYA 3L9WA 4HTFA 4CCWA 1RI1A 1VCNA 1VZ3A 3SP1A 1DFGA 3JRNA 1VL2A 2FSVA 3K5HA 4KRGA 4M0EA 3ZR9A 2ORYA 2J5QA 3WAJA 5ACWA 2PLWA 1AT1A 3JQ7B 4N01A 3T5MA 4DCGA 5BMVF 2XA2A 4GEKA 5EVJA 3NG1A 3HYRA 5DB4A 3L0DA 4EKGA 1E3WA 3IPYA 1AH2A 4IIFA 4JU9A 2WSYB 2PUBA 1A5TA 4DMKA 2H08A 1IN8A 1GRNA 2D1QA 2RH4A 4QBHA 4GP7A 3KU4A 4UOEA 2QE7D 3WMRA 1O94D 2Z3WA 4QYMA 2O6HA 2F1IA 1YI0A 3PDHA 5FBKA 5G1PA 1XLUA 4Z99A 4JYPA 2JLUA 3K0AB 1FSSA 3VX3A 2XVMA 4IJ5A 4WY2A 5ALVA 1T0JB 3O47A 5DHPA 1L4BA 1J4AA 4K9QA 1K2WA 2IYYA 5FBHA 3QTLA 1Z6XA 5ES3A 1CLUA 3OCCA 3PXGA 3D8TA 3DC2A 1LRKA 2HFKA 2V65A 1BE0A 1SZJG 2HGSA 4GWLA 4HLDA 1P6UA 2XCLA 4XXHA 2CB0A 3AG5A 3N2KA 4IRMA 5EKXA 1XT6A 4Q1BA 2QMUA 3T5AA 2YHIB 2QMYA 2AW3A 3KUUA 1B26A 4Z4HA 4FT2A 4KXLA 4O2AF 4DUGA 3MTDA 5I01A 3F96A 2VDMB 5JJKA 2PMKA 2CVPA 3ESDA 3PITA 2BG6A 3VV3A 1DAEA 1N9KA 5L3VA 2H0RA 3SYLA 4CDRA 2DUMA 1SCUA 2VRNA 4G1MB 2EKBA 4IX9A 4L4YA 1L5NA 4BJ6A 4BCBA 2GVNA 4UMFA 4D8VA 4N6GA 2RE8A 4DDTA 3C87A 3IQIX 1LU9A 4QU8A 3SFTA 4DLZA 2ZR8A 3I5MA 3IJEB 1DBQA 2BKVA 1LQ2A 1VZ2A 2ZJFA 2DT8A 3QX7A 4BLWA 4I4IA 3A2LA 3LWZA 2RCNA 3RWMB 4M0KA 1C41A 2BKUA 3DV0A 3VKVA 1CZUA 3RS7A 2BFFB 2R4TA 2UYQA 5JPIA 5BW4A 1A5SB 1M3SA 1OJLA 3EIUA 3GDWA 3GZ4A 4NCKA 3L0CA 4BO6A 1QTRA 1Q0TA 4JI7B 1SXJD 4B6RA 3BULA 1RBZA 3NOXA 3ZV7A 1TU3A 4XJSA 5K4KA 2VHQA 2BFBB 1FXWA 1XMJA 3CLHA 1OZAA 5F78A 3ZH2A 2Q3CA 4HDNA 1NW7A 3WIVA 4EBFA 4EJMA 1P6XA 1V8DA 2BCJQ 4XI9A 3F49S 3VJKA 4M38A 1Q1ZA 1C9EA 2HLPA 1KU6A 1ZSYA 3FDIA 5F2KA 4I55B 1HYGA 3U40A 4AY2A 2BY4A 4EEXA 1MVLA 5ANRB 3IUJA 2YQ4A 2P91A 5EJ2A 1DWQA 5HUQA 2FZWA 1EPUA 1Q7EA 2WIFA 1FNNA 2BF4A 3KYCB 5D3MB 1ZLYA 3L84A 4W9RA 1CRPA 1ORTA 1WBJB 2HRCA 1W9HA 5HK8A 3CV3A 4X64B 4HO1X 1M0EA 4BKOA 4WA7A 5E7QA 3AHFA 4DCOA 2PUWA 4RPGA 3ESAA 3DE4X 3PHHA 4WK4B 1V9CA 4HDQB 1YO6A 4ZOLF 4KPUA 2G9ZA 4KE6A 4I5GA 3LA6A 3THRA 3MILA 4HH4A 3ZHXA 3AUTA 5JWOA 5H83A 1CWUA 4JGBA 3PCXA 1RHJA 4GL4A 1EFVA 1T2UA 1FW6A 3W1EA 2W2KA 2R1ZA 1BMFA 3PX3A 4PC6A 1UWLA 4D56A 1KTIA 2AXNA 5K2MA 1AIPA 2Y93A 3IIIA 1BDHA 1OFHA 3EZLA 4WZBA 4BVJA 2XE8A 3BIWA 3MMNA 2AMLA 4TYMA 3GQVA 3OT1B 1YFJA 4AQDA 1XJWA 1OUMA 3ZDZB 2WTUA 3FNRA 3IAHA 5EXDA 1YOBA 1FUEA 1Q91A 5EMJA 3VH3A 4CFSA 5IJZA 3GD5A 4G5XA 4D42A 2BD0A 3A3OA 3AWDA 3E8XA 3ES9A 3R8FA 4OI0A 3FFBA 4E1VA 4RLHA 5C51B 2FWRA 5IK2A 4KR9A 2OFOA 1H3EA 5FYDA 1DKLA 2JRLA 3ESYA 3TTYA 3W2FA 3F9CA 1RYMA 1ZOPA 1Y6ZA 2R4UA 2GEJA 4LSGA 5EE9A 3DVAB 3AJ9A 5KYGA 3AG6A 3CJTA 4TM7A 1B16A 4P3YA 5FTJA 3D3KA 1P44A 3IT2A 4P0TA 2B6HA 4TV9F 5ER9A 2QX6A 1Z07A 1XRJA 5AVJA 5IEBA 3TNJA 1N1MA 3LT5A 3JQ7A 3KKNA 1SQFA 4MR9A 4MQEA 4C08A 3OPYA 4MNTA 3WRYC 2EQ5A 3K96A 4CRWB 4UBQA 3Q8XB 2GARA 3FWNA 4A36A 3ADKA 2EYUA 4A16A 2IXDA 4INJA 1EIWA 1E5LA 5K3CA 3CWCA 5JQGA 3PNBA 3IP1A 3AM4A 2PYIA 5FBQB 3SZGA 1GNLA 1XCJA 3T4UA 2XB9A 1TZ2A 1TO2E 1LSOA 2X8JA 1QHXA 2OHJA 1DCMA 4MW1A 3G7UA 5IDWA 2PH1A 4MV4A 721PA 3EZFA 5DEOA 4HDKB 4BB0A 2Q9CA 1FS6A 3TQHA 3R7WA 2YNMD 2FGJA 3H7AA 1Z2EA 3DAFA 2DR0A 4MTCA 4EJ6A 2XIQA 5CRIA 3H8WA 4G89A 3HABA 4XOUA 1BN7A 4EB6B 3NTXA 5D87A 1JBQA 1XXLA 1M6NA 2ZDQA 3CJRA 3QHPA 4RPCA 3ZXXA 4MKGA 3PGLA 3MJEA 1HF3A 3O1JC 3C14C 4EUEA 2IRWA 2V59A 2F3PA 1TIBA 3GGGA 2VZ9A 5HKKA 1HFJA 3LFUA 2Q0XA 4D9EA 4MZXA 2VSQA 2YMMA 3A1SA 6REQA 1JHYA 3DDHA 4YJGA 1D9ZA 1A9OA 2CXHA 3L07A 1QAQA 2VG8A 1PD1A 3A3KA 3WDSA 2PLFA 1KVRA 3D54D 4N3BA 5KCMA 1J8FA 4A2CA 1EKXA 3JYLA 3MSXA 1QBGA 1RI5A 1NRJB 1ZN9A 4JQOA 2W4MA 4JB3A 4O3FA 2JIPA 4YSLA 5G0VA 3GFSA 1UBMS 1XV5A 2Q9UA 5FBWB 4CFZA 1NDHA 2Q0QA 2OBLA 3FUTA 1E2LA 1EHIA 1SK8A 3OU2A 4LX8A 1NQVA 2X19A 4WOBA 5BOSA 3CWZA 4ZCPA 5LP6F 5IKXA 4KRXA 2E5WA 4A91A 2ZWRA 1FTQA 4ZI2A 5GZ3A 4O4JF 1OH6A 1BMCA 4MLDA 4G1BA 1O9GA 2WM9B 4RSGA 4ZXFA 2XW6A 4PIPA 1H5UA 1J21A 2OXCA 1OSNA 4EW2A 2PUDA 3O31A 1GPNA 4WLVA 4ZTBA 3HS3A 3UK2A 4LSWA 5JCXA 1NIPA 3D5EA 4GZ5A 2COKA 3LHFA 4U7TB 1S6YA 4OOEA 1W0JD 2NYPA 4C89A 4YUXA 4PRKA 1ADYA 2I2DA 5B64A 1GPLA 2OFPA 3GT0A 3E35A 4NU0A 4ERNA 3D6VA 4HAUA 5CA1F 4OQXA 3N6VA 4Q1AA 2PA3A 3NOQA 5K1ZA 5EXPA 3WWDA 1N8NA 3FBTA 5L4NA 5B6IA 4E22A 1TO6A 1OIXA 1R5OA 1NN3A 2QUAA 3I45A 4NZZA 5JDIC 1BVTA 1E2FA 3O8QA 1VP3A 1WTAA 2PG3A 3HV0A 4PCVA 4TPKA 3RWOA 4DBZA 3BIFA 3MMXA 2RH5A 1T8YA 5KNBD 1L3BA 3ZWQA 4UNPA 3T7JA 3CBGA 1PRYA 3BH6A 4E5PA 4BO8A 4FFBB 1YB2A 4G26A 4BCDA 4DPKA 4ZI7B 5FLXA 5CXXA 4Y6RA 5JRZA 2HHJA 1NR1A 1TVCA 3JQAB 3PRHA 2IQ5A 2Q8NA 3IOFA 3CCBA 3RV4A 2P35A 5BO5A 5EZYB 4CLRB 5H9VA 2HREA 2WQ6A 1LK5A 1SU8A 5D8DA 1AKQA 2JS7A 3JWEA 4H9GA 4NEGA 4Q19A 4BWVA 1JE1A 3PPYA 4KXYA 1STOA 2WU8A 1RHQA 1Y4AE 4MWDA 4NJEA 1ZAKA 4QFDA 5KOHA 2VDVE 4B5KA 5I7FA 1KAHA 4P5PA 1KAOA 1MX5A 1GVHA 1LTKA 1Z18A 3LRTA 3NTRA 4QA9A 5FL7A 1MJGA 3W2IA 3ZD8A 1XO1A 4KIJA 4WLOA 5I6DA 2QT9A 2CBXA 2R2AA 2OMKA 2RI1A 1B6RA 2HQOA 1RWWA 3IGFA 5ALNA 3T0GA 4NQ2A 1KRHA 4M8KA 4FVTA 4EB3A 3QLVC 1LS6A 1KDOA 4M3NA 2I0FA 1QH8A 3CUSA 3MERA 3QW4B 4LY0A 4ZPXA 2FN9A 1SVMA 5EIBC 2BJHA 5G0SA 5C81A 1UL1X 5LQSA 3GGCA 4G1UC 1LBHA 3K1AB 2GUGA 1SQGA 4RHTA 4GBGA 1WW1A 2X1MA 1A7KA 3WJ2A 4GDFA 1E6KA 3G8DA 5LDHA 4W9MC 3DLPX 3WNVA 2PS9A 4FIZA 3R75A 2GCPA 1BVYF 4O4JA 2QTAA 1PNOA 2XDQB 3ROXA 2JCSA 1CJVC 2H5EA 5TQ2B 1T1SA 4FMBB 3QI2A 2EF1A 2Y99A 2C2BA 3K0BA 2PJZA 5KTKA 3OX1A 1X1EA 4DA9A 2IPNA 2IPXA 1EK2A 3PK0A 5JC8A 2PUVA 2PDAA 3COWA 4K1XA 3JATB 2GT1A 4FYVA 1KMMA 3OEYA 3MA0A 3UH1A 1YRAA 5BNTA 2W2QA 5JCPA 1H0HA 4EO7A 1JKIA 1ZNZA 5KJFA 1T6ZA 2J3QA 1CUFA 5K3EA 5K7SA 2XIJA 4W99A 1IN7A 4K5QA 5FO0A 2AUNA 4RD3A 4ENWA 4FSHA 2N1MA 2A5JA 2H2GA 5K3DA 1QH0A 3OEED 2AZ4A 1SVIA 1MQ8B 1LC0A 3EFOB 3KXLA 4LNUA 3K1AA 5YASA 4QUJA 2ADMA 4ZIRA 4DSNA 2ZIEA 2C8KA 1QDUA 2YIDA 2E7YA 4E5YA 2EJUA 5TEWA 4R6WA 3HB5X 2IITA 4EW3A 5CYPA 4EL0A 3KJFA 2ZSUA 3U4QB 2IYVA 1L9XA 1V0JA 2VBCA 8AT1A 4ZAVA 3TLAA 4JJZA 1TKBA 1NTRA 3FWKA 4YJHA 1EUQA 4D1TA 5HIKA 1MC1A 2O2SA 3LQ1A 4GXQA 1HPLA 1U0GA 2OB1A 3OTWA 4H1UA 5FPSA 2G9RA 1CHDA 3UH0A 1ORWA 5EQJB 2VP6A 1UAGA 2X4IA 1AS3A 1Y1RA 3EOAI 3HEBA 2WIJA 3ZV5A 3RAGA 3MD7A 3CX7A 3FCUB 3L0IB 4ER0A 1E4EB 1GT6A 2OP0A 3N0RA 5EUCA 3GP5A 2CJFA 3HHPA 1FNSA 4DUZB 2XCRB 3PDWA 5EKTA 3INRA 4BASA 1E3LA 1U0BB 3T34A 1B2LA 4HGZA 2GHIA 1NL3A 3QKSA 3AV3A 2G4VA 2WYMC 1EM8B 1WF6A 1ZHFA 2YN2A 3WDMA 1P0QA 5JR3A 5CVJA 3A0RB 2VRWA 3BQNB 3H5TA 3FGOA 3HBNA 1N32B 4I3FA 1UF9A 4DQUA 3NEAA 4X92A 4IS3A 1QS0B 2COEA 4OBBA 2R2DA 4IXWA 4BUZA 1OWPA 2GEVA 4NAUA 3AWIA 4FGWA 2CEAA 4B6FA 4EYLA 2NVWA 4JOBA 4MGEA 1DVRA 3I53A 4NNPA 3V4FA 2GK7A 5KTRA 1QGYA 3ZE0B 1DBIA 2B4YA 2LPMA 4GI3A 2IA5A 3MNFA 4UHHA 3B1WA 3BWDD 1TCUA 3EMDA 3TMAA 1Q21A 3RAJA 5EJ9A 2W5UA 4M53A 3B53X 2IEAA 2PD6A 2AH5A 5ER6A 3HJGA 3IT0A 3FTQA 4LMRA 4W8HA 4GNKA 1E79D 2IGBA 4HNAA 1KVUA 4R8VA 2XADA 3EG5A 5I7UA 1YWGO 5B7GA 1KEEA 4DIBA 3FUWA 3I6MA 3JQAA 2JBAA 4GPTA 4PZZA 4E46A 5KSYA 1FVHA 3DV0B 3C3XA 4D7AA 4QM6A 2ZWPA 3M5DA 5HJ5A 5M7EA 5G2OA 2VDOB 1IG0A 1CEXA 4G23A 1J33A 4EHBA 1QRTA 4R1QA 4J0CA 1NNLA 4JC0A 3Q72A 1GCIA 1C30A 4BKQA 3WSTA 2V1UA 5DWDA 3VH4A 4NURA 1PUXA 3MUEA 4BVKA 2J0UA 3OF5A 3T5GA 4XPIA 5KYXB 3E6AA 4R1MA 2UYCA 1SGWA 1ZVJA 5JSYA 1V26A 3KZCA 5ADUS 3DMNA 3N8HA 2WILA 2EATA 1ZRMA 1TC2A 4Y3UA 4NOJA 3IEIA 5REQA 5JNTA 1R4MA 4HDCA 1X3LA 3F71A 1RQ2A 1Z35A 4PX9A 3ZY4A 1RYDA 4C4OA 4GYQA 2MYPA 2Q07A 3JAWA 1T3GA 3SLRA 2PGOA 3TD9A 1IPEA 1BX3A 1DPGA 2JK1A 3CLUD 1AK9A 3KPVA 1M8KA 3M2TA 3Q7SA 3QUTA 1QFMA 4GD3Q 4K88A 3UJDA 3ZIUA 3E81A 4FFNA 4M21A 5SYNA 3Q12A 1YIAA 4IH1A 1NVUQ 2JVIA 4X6LA 5HKLA 4DYVA 3CX8A 4PZYA 5LQUA 4Q05A 2JJ1D 3MAJA 1G4UR 2J6HA 4Y2VA 3L8ZA 1BE6A 4N0EA 4AP9A 4C7OB 1WXIA 2J3HA 4MPDA 2C5LA 2QRGA 3AEUA 3HJTA 2OPBA 2HMVA 4LVUA 4YGXB 4P81A 2F3UA 4YMWA 3E61A 1WQ4A 3Q0EA 4ZICA 3J80A 2F3TA 4V0RA 2VJNA 4RPLA 4M89A 2GRUA 1K6XA 5A04A 1RJ9A 3TF5A 3DVQX 1HT1E 4O2BA 3CCCA 1FP4B 1VJGA 3GVXA 5CJJA 1PR6A 4UAVA 3E3OA 2FW0A 1A8QA 4YO8A 3KJIA 1D2AA 4MHTA 1VP9A 3O8BA 2PQ2A 5C34B 3EUEA 2UUOA 3E7PA 4YFYA 1BS9A 3CO0S 4N7BA 3VHXA 4I4TA 1JJEA 2OUIA 3V97A 2J1LA 7ABPA 3CNQS 2PEZA 2CVOA 4P31A 3MUOA 2B7BA 3EBPA 4KO4S 5G0TA 1LB1B 2YHIA 4UMEA 2W6OA 3ZKWB 1I80A 3QYFA 4FN4A 2VSFA 3NDBB 1QIHA 2VXBA 4JB0A 3QVMA 5IUNC 1OBCA 5CNMA 2Z2XA 3MGCA 4AS2A 5C1BA 1GZ4A 1YC5A 1SG9A 3SPXA 2HLDD 1KWGA 5LZ9A 5A62A 3NR2A 1NU8A 1GU0A 2ORWA 3UCEA 1J5EB 3KYBA 1I3MA 4CUJA 4ZQHA 5F4ZA 2A7QA 4QUEA 4DABA 2UXCB 1XPJA 9LDTA 1P2FA 3PICA 4BS9A 3WK6A 1NP3A 3R7WB 3PEVA 1XBTA 1QB7A 1DEXA 1GQSA 1NJ1A 1EHCA 4U9IS 3H6GA 2ZI7A 1CQPA 1WW2A 1Z45A 2JFZA 2WUDA 2XLCA 3DMFA 4FBLA 4IMPA 4EG1A 1KZGB 4MEAA 1QIFA 1S3IA 2QTVB 3ANLA 3PR3A 4P58A 3DFMA 3MIZA 2I4IA 3I28A 3SIWA 4HXEB 5DM1A 3ZXYA 4WOCA 4YJ3F 1MOQA 4QX6A 4LKRA 3IV7A 4CEHB 1E2BA 2ZR9A 2VP4A 1WUKS 2HPVA 1QGED 2ZI3A 5B3KA 4N3AA 2HEIA 3O3NB 1SULA 4KXWA 4D3XA 5EUBA 4BBZA 3NP9A 3UB3A 2V6FA 1OTHA 3L79A 4WKGA 4C0HA 5D86A 2XT0A 1JFTA 2RGRA 4A6DA 2VXCA 1EVQA 3HU3A 2OVFA 2BBOA 1R8XA 3IOMA 3BHMA 5AXAA 2ZSDA 5JXJA 1JR3D 2H57A 3IVRA 1YRHA 1MW9X 1C2YA 3AI3A 3RC8A 3KQUA 3M3DA 2CYBA 2Q5CA 4JLWA 1Z29A 2VL7A 3LBNA 3T5CA 2GAFA 3VAYA 1XXHB 2JZOA 3WI7A 2R1TA 3AY6A 4UQOA 3W2TA 2VDRB 5HZHA 1O89A 2CKDA 2YV1A 2BZSA 1MUUA 3KJNA 3B1XA 3Q88A 4IUCS 3UHOA 3ESBA 3DEYX 2KS6A 4JSTA 4E2ZA 4LY3A 3OOSA 4ADSG 4NXMB 1D03A 1KVQA 4UE2A 3PNQA 3U4MA 1HYBA 1I3CA 1MNAA 4WL0A 5T3YA 4QPZA 4DCNA 2WSMA 2HK7A 2I67A 2IDKA 1VLJA 5C7YA 3BRCA 3JPYA 3QLUA 3RREA 1MGPA 1B14A 1GPMA 4DJFC 1JAHA 1C3OB 3I32A 5A23A 4OFZA 1UM9A 3D7LA 4IMIB 3U0VA 4D81A 5LMZA 1Z7YA 3IKJA 1E7SA 4PG6A 4JL8A 5DGHA 5DBGA 4QDUA 1PQ4A 5ALSA 4I1PA 1SKUA 5C1PA 3DMDA 3DT6A 1TKCA 1OHHD 2QAGA 2QL6A 3I92A 4YP9A 1NP7A 5AKYA 2HJRA 1GJRA 1LVHA 2ABWA 1P17A 2D2VA 2O3SA 3U2QA 4FKBA 1MIHA 4FFWA 1DQZA 5GONA 1ZD3A 2NYUA 5SICE 4QUBA 3LWBA 1N2JA 3P9QA 1OOEA 2R6FA 3NWBA 3JD0A 4I6EA 4KBGA 4LJ5A 1GG5A 4LTMA 5JSKA 5I4IA 4RBNA 4Q9IA 1U6IA 3EGIA 1XCOA 4CL8A 1NKTA 3KOYA 3TPCA 3EGWA 5M34A 5DBHX 2AFIA 1JQDA 1CZRA 1VPEA 2GGSA 5FLKA 3IOEA 4ZD6A 3TI7A 2DE0X 4F3NA 3ADCA 4YMUA 2JHGA 2FMKA 2XB8A 3EC2A 4TROA 5FUVA 4F86A 2IUTA 4R0MA 1RZVA 4M22A 3GLIB 3V7NA 3ZIAA 1BCSA 3HR7A 1EWQA 1L4GA 2P11A 1POWA 5JS2A 1ZN8A 4JSRA 3A31A 4KVZA 4UUMA 3NALA 1RJDA 1V16A 1T9KA 3LKDA 2ORED 1MEEA 2DUUA 4L3VA 4D98A 2HXYA 3I2KA 3AYXB 1HZZC 3NHUA 4MJ7A 3IRUA 1NVDA 3KKOA 4QJBA 4BQOA 1QSGA 2P27A 2RB5A 2QZZA 5JYBA 2XNCA 2XUPA 1XCLA 3LJKA 2K2QB 4RM3A 4EHAA 1KI3A 4HSGA 3M83A 1GGNA 3TBFA 1CPYA 1TT5A 4DW8A 5JMOA 4JN6B 1LK7A 1P9OA 1WPXA 4DMHA 1MB0A 3KZOA 4CNBA 2TMGA 1LVUA 3D6JA 5KMGB 5KTSA 3ROEA 3KSBC 1GLGA 1BFKA 3HLYA 2EVWX 4UEWA 4XIIA 3LBFA 4E2WA 5A9RA 4C2TA 2BMIA 2WYIA 3TTXA 2ZIXB 1WTCA 1CY4A 3JARB 4UA4A 2UYHA 4LNHA 2ZXFA 2FXVA 1NBMA 3N05A 1XQ6A 4ARZB 4D8TA 4EX7A 3DAPA 5AVQA 2OECA 3RG8A 5L3SB 4DC1A 1EBFA 4PW0A 2NUPA 4TTIA 2HMYB 3CW2A 4LJYA 3HBAA 4HRAA 2WSLA 3FIUA 1XJQA 3H4VA 4PX3A 1P2DA 1V37A 5FT9A 5JO9A 3S6JA 5EXTA 4D3ZA 5CDSA 5HIAA 3WDLA 5KNCA 4GKKB 3U3JA 2H51A 3ZK8A 3SAJA 2J6IA 3W34A 4GWGA 1T10A 2NGRA 1W7AA 2PLRA 4KQJA 2C92A 3GUUA 1XFAA 3ORFA 2EDCA 4XIYA 5AFSA 2XXBA 1O77A 4PQGA 3M6AA 4YJ2F 2HIGA 2I4NA 2O23A 2FWAA 3N8NA 1ZD1A 4NECA 2XCSB 1M34A 5LQCA 1JMKC 3ZVRA 1ZU5A 3LP8A 4LE1A 2HWKA 3S70A 3D7RA 2OZVA 2Z57A 1VYUA 1E66A 3AINA 4QOFA 1XRPA 4EHNA 2Z6QA 4ZK6A 5I4BA 1IY0A 3GAMA 1KO4A 1TLTA 1M2VA 4NS1A 4QJIA 4A0GA 1RMYA 3HKEA 2H4HA 3OLQA 1Z33A 3QTTA 1C0LA 4OOFA 5E7JA 5G1NA 3UOWA 3K94A 2J9XB 4D4HA 4IJVA 2WFLB 3IQGX 1LCIA 4AWAA 1O2DA 3M5PA 3P8ZA 3GLRA 4EHIA 5L8VA 1VL8A 3AR2A 3PGMA 2IW1A 2ZIAA 1KK2A 1KMQA 1T1GA 4RXUA 3IQEA 5I8ZA 5IMSA 1UANA 1HE3A 1XA0A 4KAAA 2W4QA 3AEQA 4PAQA 4ZCLA 3K3PA 2VQSA 3S3TA 3GT3A 3H11A 4EI8A 1KI7A 5BN4A 1QFYA 3I04A 1NRXA 1PI3A 4GQAA 3W7AA 1C7EA 1WLYA 1GAQA 4GYWA 4A10A 2O54A 5C4GB 1HDOA 2PRKA 3G02A 3VVMA 2A94A 3JQRA 3PHIA 3SF0A 2DPYA 4O63O 1DMRA 1CZHA 1UP7A 3B48A 4ND1A 3VR1A 2I8LA 3L7DA 4IUDS 4EKNB 4LECA 1I1NA 2Q45A 5LB2A 1SCDA 1CJCA 2IE0A 3COYA 1JQLB 1T8WA 3B51X 4GR4A 4YRBA 1C8LA 2FU8A 4JYMA 1HM5A 2ZBRA 3SEFA 3C97A 1E2PA 3ENKA 1WXFA 1V3QE 2O07A 2UXDB 1PN3A 4URWR 2CFTA 1H93A 4F5YA 1DCKA 1KBZA 4J6EA 3TB6A 5DV9A 3ROTA 5HZKA 4DIKA 2QTTA 3FVTA 2PHZA 1SG6A 3GVIA 3BE8A 5FRDA 4LSMA 1SQ6A 4QOEA 2K6GA 5EIAA 1XTVA 1Z36A 3ZQJA 2GZDA 4RK5A 3DLBA 5T4FA 1Y42X 1FXUA 3BL6A 1FW8A 4GZ3A 5D84A 4DY4A 4K0KB 4LOLA 2P90A 1PT7A 5LQRA 1T2DA 2QYSA 4XEHA 4F1WA 2R2GA 2X8WA 5JSZB 1LPOA 4J7XA 5J2TA 3GJ6A 3EXIA 5BN3B 4V0LA 2LGJA 4IV5A 4UPEA 1WUIS 2ZSHA 2BM0A 3AERA 3MT9A 3OBIA 3AU8A 3R4VA 4NE9A 4PGMA 3QKWA 4OU4A 4PWYA 4RQTA 3IBYA 3W2GA 3NTVA 5DCUA 2C5EA 3RUFA 1DOAA 3GLVA 2YXEA 4FMCF 2QQFA 3CRMA 3SJCA 3DZ8A 3B82A 2BKEA 5B2FA 1WSAA 3BD6A 3ET4A 4BMNA 3T1YB 4WCDA 4JI8B 4AJ1A 1RKBA 5JRJA 1QQ6A 3G8BA 3T1TA 5A4DA 2ZSBA 1FOEB 4HRXA 4ZNBA 3B1FA 3G0IA 4P2BA 2CUNA 5CA0A 4DLRA 2I33A 4DLVA 1U2DC 4JDUA 1DBVO 2P9FA 2VQFB 4DV4B 1MQ9A 2XUDA 3ESQA 4ZOEA 2YFHA 2Y87A 4YDSA 2QR5A 3ANMA 4IIXA 3ZGXA 4FGZA 1XEXA 1KS9A 1HG1A 1ONNA 1FRFS 3BD7A 3NRCA 2JGMA 1WZUA 3UAXA 1Z06A 4NZMA 4YR9A 3GI1A 1ZNWA 1YBMA 3HMQA 3CKMA 2MSDB 3VHQA 1NQ5A 1Z5PA 3ENVA 3SG0A 3K32A 1W1WA 2JFFA 2PLNA 3QYAA 4F9EA 4UXJA 4HPWA 1Y3AA 1XLWA 3L41A 3LT0A 4QTYA 1SOWA 5JTTA 4LHEA 5EUQB 1C0IA 4D5EA 2JHCA 3V2IA 5G3YA 2WNHA 3W5CA 3Q10A 4JLDA 4EZBA 1KZ6A 1W6UA 2VNIA 5HS4A 2E87A 4KE7A 4WH0A 1X7XB 2GJAA 4MVXA 4LWZA 1OB5A 4Y9SA 1HSOA 2B4QA 1KFCB 2WTAA 2ZE7A 4TLCA 1KVTA 3I42A 4G8JA 3TEFA 4BIIA 2VUSA 2E4XA 5DJ5A 1Y33E 3IEMA 1EXDA 5LD2C 4DY6A 3GFBA 4C6TA 1V6CA 1JAYA 2JJYA 3RAEC 4LZOA 4EG5A 4YRMA 2RIPA 4NESA 4ALLA 2V3CC 3BMCB 3CB4A 3ZWNA 1JG4A 1TD1A 2P2NA 4PHTA 3W1VA 1GV1A 1R0CA 5F3DA 3W9UA 3RJ9A 4KO2S 4GYUA 1OLUB 3R6TA 1EM6A 2QWXA 4LE2A 1QVWA 1NJSA 2XYRA 4KXMA 4KXNA 2MDTA 2MJLA 1G8YA 3M70A 5L51A 1F0NA 3PL5A 5KVVA 1XTOA 2QTRA 3DV2A 1JHUA 1Z5GA 2RHTA 3KPJA 1NFRA 2ATXA 3CIFA 3F6BX 1KO1A 1FRVA 1X7XA 2WUVA 1SELA 4MICA 4PX5A 1Y9DA 1ZIDA 2CYAA 2DBQA 5AJZA 3TS1A 4HEHA 4BNFA 4J94A 4E5VA 2LV8A 3UMCA 1EFKA 1XNRB 1XMIA 1QE3A 1J8QA 1QR6A 3HJBA 4N6NA 2M1ZA 1MFZA 2F9MA 2YV2A 2ARKA 5GIPE 1IY1A 2XMPA 5IXJA 5K0ZA 2F2TA 3WO0A 4PSUA 1PHPA 3DLTA 5KILA 4HYYA 3T5TA 4G4IA 1QC5A 3QBDA 3NKFA 3GCZA 4JBWA 5IF9A 1E5XA 2V0CA 4RDCA 2J0VA 1Q0PA 3OWOA 1JNXX 2O2JA 3O0DA 1T9CA 2NV0A 5AI6A 5TMBA 2Y2UA 3DKVA 1JXMA 5KYYA 3NHZA 3RVRA 3MGKA 2CK3A 1G3IA 3LZCA 4FOPA 4REOA 2O50A 2PZ8A 4FX5A 4D74A 1X7YB 5C8ZA 4QQNA 5TPWA 2EGUA 2Q3MA 2X4LA 3TQFA 5FAXA 2ZZNA 3CNNA 4II3A 2VPZA 2DH5A 3RABA 4ZARA 4J0DA 1U3FA 1KBOA 4BQIA 2OC9A 4H4EA 1QJ4A 4MYDA 1HEYA 1ILEA 1EJBA 2VH5R 5GM1A 3PT5A 4B3SB 2CDRA 2W0MA 3PQEA 4FB5A 2P4SA 2FUCA 1Q0LA 1V5IA 3LBIA 3MUFA 1OROA 4PY2A 1IBRA 3K9LA 4R5HA 5LOVB 3HI6A 1QR2A 1GU1A 4ARBA 3H2SA 4XIGS 1E3IA 3IAEA 1CUIA 3KALA 2ECFA 4KC0A 2IYAA 1GZ6A 1OT3A 1RRPA 2ANBA 2F4NA 2JFOA 1PWYE 3MGAA 2D7DA 2XHZA 1U4SA 3CW9A 4F9FA 2JIZD 3FY4A 1HETA 1VL6A 1J25A 2VYVD 5CG1A 1RYFA 4QIHA 1DXKA 2GAIA 4JJEA 3U16A 4BV2A 3D4BA 1LW7A 2FQWA 4KPUB 1E1CB 1C0PA 4H7PA 4ETMA 4EKEA 4YP7A 2O0HA 1WZNA 3IDQA 1TTTA 1CD5A 3DUWA 2CBNA 3ZBTA 2O2ZA 3JALA 2VDQB 1JJIA 2X9LA 1QRDA 3LQ2A 4P7GA 4PM4A 4WADA 3ZS9A 2QN7A 3E3AA 3WV4A 4COKA 4RAMA 3KWMA 4Z4EA 4HYEA 1S1CA 1GNVA 3PE4A 1QHHB 2UZ3A 1CY6A 2GN0A 2QYOA 3K30A 3MM4A 3UXMA 3PHBE 4KI0A 1OZFA 1T9BA 3L6EA 4HLCA 4U2FA 4YGYA 5EMNA 5FLEX 4UUQA 1CF9A 5JYEA 3BORA 3UJ9A 2AOTA 2IUYA 4WOKA 1N6OA 4BFCA 4PO8A 3W7BA 4DV7B 4KWTA 1RZ3A 1CE8B 4S1TA 5EZSA 1BWQA 5C0OE 4EUFA 3SR3A 2HU5A 3TUIC 3U7JA 3O93A 3EVZA 2R8XA 3H2ZA 5MN6A 4GICA 4CT0A 2FLWA 3G49A 1BRMA 4EY3A 3A25A 3H8VA 4F3TA 3C3BA 1Q6ZA 3F97A 3E7DA 4OQ4A 4X97A 2WRZA 3M34A 1EK5A 2GYYA 3I4FA 4WEQA 4DBLC 3EQ2A 3CR7A 1HY3A 2QGNA 4GRAA 4PSAA 1X7ZA 4A92A 1P9LA 3OIFA 5J2UA 2D1RA 5AM5A 4GNRA 2CNWD 2ACWA 5I7WA 1LI7A 3WSVA 5B58C 2JDIA 1KF0A 2R1UA 2SICE 1N2CB 1FFXA 3A4YA 1O9HA 1VXRA 5LXTF 2W6IA 4W4TA 5C8XA 2WJJA 2YJGA 1UKAA 4FHDA 1S2IA 2A9QA 1NWCA 4JA0A 3WGUA 4CIWA 4J29A 3D02A 4NTZA 2NQ2C 4KODA 1PYGA 2QG6A 2OK8A 4H7JA 1E6EA 4G4SO 4KXFB 4C0BA 4DEVA 1ISPA 4E31A 1HXHA 3BGDA 4PYIA 1C1XA 5JVDB 5M5BA 1BW9B 1W0KD 1RJWA 1R0YA 1ZX1A 3T1OA 1IXZA 4HX9A 4FOLA 5KQGA 5DM70 3TVTA 2O8BB 2ZBVA 4I4NA 2QI9F 3H7IA 4AY3A 1WMBA 2J30A 1ZMRA 3VPCA 4D3SA 2R79A 3V34A 2ZJ7A 4R9RA 4CV3A 1F6BA 3OQIB 1E1KA 2E9SA 1F14A 3L7JA 4U2GA 1GFZA 5CNIA 1ZH8A 4XE5A 4QG7A 3NJ8A 5BYJA 3DGEC 1TX4B 5G02A 3T7DA 4NH0A 4DHWA 1G8PA 1IBMB 2MHCA 2ENUA 1XX6A 3ECCA 3PENA 5DPXA 3I04M 3CKKA 3DZHA 1P0CA 2C5GA 4RHEA 1H69A 4KQ2A 4YR7A 3FB1A 5CLFA 3SW3A 1DEOA 2TYSB 3EBLA 3HUUA 1P7VA 2FV8A 1V7CA 4ZVTA 1FTSA 2X2FA 2Y6UA 1AHIA 1IY2A 3U3XA 4NU6A 3Q9SA 4KO1S 4HXFB 2AF3C 1XVIA 3C2QA 3TBHA 3U3MA 2Z43A 1KI4A 2ZUCA 3FDJA 4FHZA 1DAKA 2BUBA 2E4UA 3QENA 5EJEA 4EY8A 3KTAB 2O8BA 4YV1A 1FFSA 1HQCA 3ZY6A 4I4CA 2PIDA 1VJDA 3QITA 3GV0A 1TAQA 1K7SN 1T3TA 5DEIA 1BC5A 2I3BA 1EFRA 4RF5A 1IMOA 1LWOA 5E9WA 2AXQA 1MB2A 1E9CA 3KB1A 5EJIA 1SXHA 1V7QA 1DX9A 3KQVA 1DRUA 5L4LA 1RC8A 1FFAA 2HLDA 3EUAA 3AHEA 1AO3A 2ZJ6A 4KZKA 2ZI4A 3ENQA 4Q1CA 3SR0A 2PBZA 2BGWA 2COUA 1E9FA 4GZMA 1SRRA 3VYSB 4J1TA 3RODA 3QG5A 4BFXA 1XZHA 3U4GA 4PAWA 3BH0A 4V2UA 5KAMA 3ZIDA 5JAOA 5KU1A 3FHJA 4N18A 1CUSA 3LYUA 3QE4A 4R7GA 5GV8A 2IUEA 1KP3A 1DC5A 4JUBA 5IKPA 3OT5A 4PU0A 2BCEA 2PMCA 3BHJA 4RPKA 1KYYA 2EL9A 3W3AH 3PUKA 4OLFA 5CDUA 3PX7A 2QU7A 3K0EA 3TQCA 3WMXA 4BNZA 2TS1A 2PR2A 4Z54A 2Q4DA 3WL7A 2YW2A 3EXFB 4BVFA 3FKJA 2JGJA 5E8JA 5EWMB 1Y63A 2E4YA 4MUAA 1KFEB 2C03A 3Q5GA 4NEHB 2QL7A 4IOKA 5E3IA 5SZJA 4BKPA 1RR6A 3EX7C 2VHXA 2ZCJA 3QMWA 4CT5A 5K45A 5IT9A 5J1TB 1TMOA 4ZZ0A 3E70C 4DQKA 3E9CA 3CPSA 5TQ0B 1ECCA 1C7ZA 1LX6A 1UK7A 1IZ8A 3EXAA