5AHOA

Crystal structure of human 5' exonuclease apollo
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
314
structure length
314
Chain Sequence
SMNGVLIPHTPIAVDFWSLRRAGTARLFFLSHMHSDHTVGLSSTWARPLYCSPITAHLLHRHLQVSKQWIQALEVGESHVLPLDEIGQETMTVTLLDANHCPGSVMFLFEGYFGTILYTGDFRYTPSMLKEPALTLGKQIHTLYLDNTNCNPALVLPSRQEAAHQIVQLIRKHPQHNIKIGLYSLGKESLLEQLALEFQTWVVLSPRRLELVQLLGLADVFTVEEKAGRIHAVDHMEICHSNMLRWNQTHPTIAILPTSRKIHSSHPDIHVIPYSDHSSYSELRAFVAALKPCQVVPIVSRRPCGGFQDSLSPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 5' EXONUCLEASE APOLLO
publication title The Structures of the Snm1A and Snm1B/Apollo Nuclease Domains Reveal a Potential Basis for Their Distinct DNA Processing Activities.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 314
sequence length 314
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07522 DRMBL DNA repair metallo-beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12650 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5ahoA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5ahoA01
3P2UA 4C09A 2CBNA 5K4MA 4HL2A 3TP9A 4TZFA 5AXOA 2QDTA 4D1TA 4GCWA 3X2YA 5ACWA 5HIPA 3PG4A 5HH6A 4NQ4A 3SW3A 5EHTA 5B3RA 2WRSA 1WUPA 2FU6A 3RKKA 4TZ9A 5HH4A 5AEBA 4RAMA 4PVOA 2ZWRA 4RL2A 4NQ2A 3JXPA 2FM6A 3IEMA 5FQAA 4UA4A 4C1GA 2A7MA 2GFJA 1BMCA 3X30A 2M5CA 3AF5A 1JT1A 3DHCA 2BTNA 3ESHA 3LVZA 4GYUA 2FK6A 2XF4A 3IOFA 4D1VA 2BIBA 3PY5A 2ZZIA 4TYTA 1KR3A 3WXCA 4AX0B 4UAMA 3IE0A 1ZTCA 2AIOA 4JO0A 5ACVA 4V0HA 2YNWA 1QH3A 3QH8A 1WW1A 3IDZA 4XWWA 2BG8A 3BC2A 2P18A 2YZ3A 5LCAA 5HISA 4ZEJA 3AJ3A 2BFLA 1X8GA 2Y87A 4FSBA 2OHJA 3H3EA 5ACXA 2P4ZA 4Z5YA 3L6NA 5EV8A 3ZQ4A 5AHRA 4BZ3A 4FR7A 2Q42A 2Y8AA 2YNVA 5EWAA 2P97A 4XWTA 5ACQA 1L9YA 4UWRB 2GMNA 3SFPA 2Y8BA 4KEPA 3KL7A 3X2XA 1A8TA 3X2ZA 1VGNA 4AD9A 4PVTA 5ACSA 2P1EA 5EVBA 5DPXA 5KIKA 3F9OA 2NZEA 1E5DA 4RM5A 3ZNBA 4EYLA 4B87A 2VW8A 4EYFA 3MD7A 4GYQA 4NQ5A 5HIQA 2Q0JA 3VPEA 1KO3A 4YSBA 4AWZA 2Q0IA 3BK2A 4UWSB 2QJSA 4F6HA 4C1DA 2GFKA 1YCHA 2WYMA 4EYBA 4EXSA 5HIOA 5LCFA 4Z7RA 4YSLA 5ACRA 5LM6A 4ZO2A 1HLKA 1A7TA 5AHOA 4F6ZA 5A87A 4XUKA 4D1UA 4KEQA 5ACTA 2YCBA 4NQ6A 4DIKA 4UWPB 5LLDA 4ZO3A 1MQOA 4P62A 3PY6A 5B1UA 4C1HA 2QEDA 1DDKA 1JJTA 2I7XA 5FQBA 5EW0A 5EV6A 3G1PA 1VMEA 2XR1A 3T9MA 4Z5ZA 4TZBA 4O98A 3SPUA 2BFZA 2UYXA 5EVKA 2YNTA 3A4YA 2GKLA 3VQZA 2ZO4A 1ZKPA 2AZ4A 2QDSA 4UBQA 4EFZA 3SRXA 3R2UA 2FU8A 3KNRA 3FAIA 3IE1A 2YNUA 3Q6VA 5LS3A 3AF6A 4DILA 3SBLA 1P9EA 4U4LA 2Q9UA 5FQCA 4RAWA 3BK1A 5HH5A 1M2XA 2ZNBA 3I13A 1YCFA 2M5DA 2I7VA 3IE2A 4AWYB 4C1EA 2HB9A 2BG2A 2BFKA 2R2DA 3KNSA 4RBSA 4C1FA 2WYLA 1VJNA 2OHHA 5LMCA 2GCUA 5EVDA 2BG8B 3DH8A 2BFZB 2WHGA 2YNTB 4LE6A 1YCGA 4BP0A 3RKJA 1WUOA 2FU9A 3ZWFA 2BMIA 2H6AA 5ACUA 1SMLA 5KILA 2DKFA 2FHXA 3ZR9A 1Y44A 2I7TA 2YNVB 3IOGA 5AYAA 2NXAA 3I15A 3S0ZA 5AXRA 1BC2A 2QINA 4YSKA 3I11A 4J5HA 4C1CA 4CHLA 4UWOB 3T3OA 3DHAA 1X8HA 4AX1B 3DHBA 5A5ZA 5K0WA 2BR6A 1JJEA 2E7YA 4Z60A 2BG6A 4EY2A 4Z6XA 1X8IA 1WRAA 1ZNBA 5A0VA 4WD6A 4H0DA 2FHXB 3I14A 3FCZA 5LE1A 2NZFA 2BC2A 4TYFA 4TZEA 3BV6A 2DOOA 2BG7A 4HKYA 1QH5A 4Z67A 4ZNBA 4D1WA 3IEKA 4RL0A 3T3NA 5A0TA 5ACPA 5IQKA 2WYMC 3SD9A 2FU7A 5B15A 4FEKA 5K4NA 5EH9A 4J5FA 1XTOA 1KO2A 1K07A 2BGAA 3I0VA 4D02A 3IELA 1BVTA 3ADRA 1XM8A 2NYPA 5LCHA 1DD6A 3RPCA 5LSCA 5K4KA 1DXKA 4HL1A 2OHIA 4EXYA
chains in the Genus database with same CATH superfamily
1CETA 3SOZA 5JU6A 4V0ME 3UWDA 4FNGA 4TMZA 3A4IA 1I13A 3B48A 5T3UA 2TRSB 5JCZA 2IS6A 4K9MA 4LTNA 3ESXA 4PRKA 3WQRA 4J16C 4ER6A 5JI3E 4HL2A 3IHKA 3G5TA 2O3RA 2XLBA 2B35A 4JCCA 4DVGA 2CHVA 2PT6A 2A9RA 1Q7TA 1M1ZA 1WR8A 3H8WA 5CNJA 2QTZA 3C1OA 2Q2VA 221PA 2J9FA 4K46A 1Z7BA 3DE2X 4QA9A 2CJWB 4BLOA 4DMUB 3MGBA 1TADA 3HDGA 1FP4B 2OQIA 4EYKA 3SVLA 4BVKA 2QVYX 4D8YA 4YAUA 3DLHA 4ZMRA 2JPDA 2IPXA 3DM5A 1XVLA 1SFRA 2ZVDA 1E4VA 5L7TA 5A6SA 4HHEA 3RKKA 5CVVA 1AKMA 1V16A 3OF3A 4QUHA 4BKQA 1E9DA 3EXG2 5LJIA 4IO1A 3HL0A 2ZRJA 2EP5A 5I9MA 4JMPA 1JFFA 3NH9A 1G8JA 3FAZA 4RHUA 2H7CA 1WP4A 3EAQA 3JQ9A 4P4NA 5BQPA 1RWKA 2ZWMA 2VH1A 1R0ZA 2FP4A 1GGJA 3Q8WA 4EJFA 2WKQA 3R0VA 2OAP1 3MIIA 4QELA 3GN1A 3OFNA 1GQYA 4NYMQ 1M2FA 1YGPA 2FM6A 3G68A 2WU3A 1IBKB 3QF4B 4HLUC 3PUKA 3HFGA 4U2KA 5JZVA 4DV0B 5DXJA 1DXOA 3JALA 4U7PB 5JAZA 3HB7A 4Y6OA 5FPKA 4X6LA 3ANNA 5EJ2A 3OCWA 2JNWA 2JH9A 2VP6A 2WWRA 1SVUA 3EARA 4MQMA 1S1CA 4EHBA 1LQ2A 3H19A 3UJNA 5ED4A 1B6SA 1WMBA 4NCNA 1VDMA 1H9CA 2F2TA 2YICA 5GV7A 1IY2A 1WHSB 1CRPA 1NDUA 3RKRA 4GYUA 2ECKA 3AVWA 1DJQA 3KZNA 1SWVA 4CMKA 4FLFA 2K5UA 1UBTS 3GPLA 3CNNA 3I2HA 1P39A 3LPMA 4BN4A 1GKLA 5AM0A 1GPYA 1Y9DA 3CLHA 2HJWA 1XD2B 2ZUDA 3AWDA 4E11A 3V1YA 4F4DA 4BAUA 3DMFA 3DB2A 1XL0A 2ZRBA 2PKYX 4TQAA 2G6BA 1Z2AA 1ZNXA 1ESZA 4NZ9A 3DDZX 5GJVC 3SHVA 4TKVA 3E1KA 4JBLA 3DD5A 2VQDA 2FR8C 2XEDA 4UU1A 1EVYA 4NBKA 1IAVA 2B94A 1CY8A 1GGHA 1V1MA 1XA0A 1T0JB 2OZEA 3HACA 4CV2A 5B30A 3CW2A 5A9SA 2XUQA 3HA5A 4DNPA 3AJEA 1BCRB 1SCIA 2HLNA 1U9CA 2WA2A 2XYRA 3GRKA 3OOJA 4G86A 4PZLA 4S0XA 8ABPA 3V7NA 1UBOS 3EWNA 3IEVA 3VKHA 2ZE6A 3H5TA 3V1UA 4PLHA 4TTPA 5JAUA 4PINA 3M1IA 4Q9JA 4JXZA 3D0KA 3BMOB 1DX4A 3EFEA 1IU9A 4UHCA 3V1MA 1NLFA 3JASA 4L2IB 2I62A 1R0KA 5EMKA 2FNAA 4QUBA 4B6OA 1X8LA 2JGJA 1N9GB 3L7CA 5A5FA 4ZJUA 4QYMA 3N2YA 3DV9A 3FWPA 4X41A 1YDWA 4UCQA 4L72A 1G60A 2JJ1A 3U56A 1NHWA 3W0LB 2F8MA 1FRQA 2H17A 1EUCB 1Q1EA 4N18A 1K5HA 3IOYA 4X1YA 2AOTB 5BUSA 5A23A 2XXJA 3CF0A 2EW1A 2UYOA 3O8QB 4O1IA 3TQIA 3E82A 3ZDQA 2B4YA 2J9RA 2WE7A 1U11A 5FBZA 3VZCA 4AZ3A 3BRWD 2GRUA 3RIYA 3L1IA 1A2OA 1G41A 1VRCA 3DKIA 1RWQA 3QOWA 1B14A 2QROA 3IQFA 4R5HA 3MYYA 3OZVA 3LYAA 2N9UA 2ZBQA 3SS8A 1KYZA 3B6EA 3A14A 2PIDA 3OPQA 5DP2A 4C1BA 9MHTA 4Y1FA 1UBHS 2XJ9A 1W49A 2R6CA 2W5UA 1U9IA 2EL7A 5DNEA 4F4JA 4Z86A 1Q17A 1DSSG 3FH0A 3GFBA 4AJNA 1IM5A 2AHRA 2ID7A 4EUEA 1P5HA 1ZPDA 1YZLA 1TJNA 1PQWA 4WCFA 2TMYA 1ZRNA 3KDSE 1H5QA 3SEAA 3TVYA 1L7NA 2JCGA 4IW3B 4BO6A 2Q9AA 4D3YA 2WE8A 3GRRA 3KL7A 3S7TA 4MK4A 4EEXA 1GRNA 3EE6A 1V95A 3CLSD 3F2IA 3IPAA 3KYDB 4OJKA 1U1EA 4UZEA 1OA1A 4C78A 3QA3E 5A4IS 4RD1A 1RJDA 3IUMA 1EEHA 5FQNA 4FFMA 4MRPA 1GPBA 2RGAA 2VA9A 3RYCA 1NUPA 3V97A 4BQIA 1B3BA 3P94A 3ER6A 3ZCXA 3KQSA 4E94A 3SVTA 3O4RA 3C8ZA 1Q1AA 3RS8A 3QXSA 2A1TS 2ID4A 2PZMA 1MQAA 1KMIY 1NZJA 3ROXA 1E9FA 1YA6A 5FV7A 2I5PO 4B6SA 3KOWA 4XE5A 6AT1A 1A9TA 1I4LD 2QZSA 2VP9A 1LNSA 3DYVA 2ZXFA 4M2LA 4MI6A 1GD1O 5I5GA 3P97A 4HXFB 1QZTA 5BOSA 3F3YA 5LM3A 1IHOA 4XCVA 1SN7A 4ZAVA 1W34A 3R8XA 3DF9A 2BM8A 1YL7A 1X1SA 2RGNC 3HUFA 3S29A 3R9XB 1KO3A 4Q48A 4YP6A 4CG3A 1BS1A 4GF5A 3NIGB 3VZQA 5BRAA 2F1OA 2WVAA 4QJBA 2QJSA 4LRTB 4Z8XA 2O3QA 2VHYA 1HT2E 2L69A 3A1SA 4R8SA 3WK4A 5IXJA 1EG7A 4C5AA 5C8ZA 5JS8A 8GPBA 4ZOBA 3PQ7A 2W8BB 3ZE9A 1XRQA 2P5TB 2Z43A 4PAGA 2FUKA 5EERA 3OPYB 2OBNA 5TS2A 3E48A 2MJLA 4LJ7A 1JEJA 1NJGA 3LUHA 2FJUA 2A9JA 3QKUA 4X61A 5HG0A 1NVKA 2MOKA 3Q6IA 4GOJA 5FTNA 2BMWA 1GCOA 1M7BA 4IWXA 2XSZD 2NQTA 1U65A 5JBQA 1SUFA 3D7SA 3M2PA 1NNLA 3HC7A 1GRQA 2R2GA 4F56A 5BSGA 3B6MA 4KE6A 4D1UA 4LMPA 3HCAA 4ZZ2A 4HVCA 3ICOA 1G5QA 5KKCA 3ADKA 3RFCA 2IV3A 1DOHA 2HXYA 1UOPA 2ZE8A 4HWSA 5C31A 3WRVA 5I48A 3KWMA 2QY6A 5ENVA 3HDTA 4Q00A 3P26A 2GPJA 1RZ3A 2OWDA 2BI8A 3D8BA 1PJ8A 1BHO1 2I4RA 3IAS6 4OQFA 4S0ZA 3VNAA 1EGAA 5KNBH 1QJ4A 1VB5A 1G9XA 2GA8A 4K6KA 4PNPA 5EZYF 3M4XA 5TIIA 5DJ5A 2OK7A 2H63A 4OGWA 4D0RA 1ONOA 2CMHA 4XDZA 3X1DA 2FEXA 3T4XA 4C4TA 3WK7A 4FZ3A 4CIWA 3BF7A 4X1IA 4CM8B 2X7JA 4P33A 4BATA 2LNDA 3HY4A 4O8CA 4YT8A 5LA6A 1F4VA 5KDOA 5EV6A 2UZ4A 1RXYA 1PGNA 3IV7A 1BJTA 4PLZA 5DM1A 1X1TA 3CH6A 1CS0A 3KHKA 1A50B 2VWGA 4ZVVA 4C4AA 1J99A 2A5DA 1B8OA 3FHCB 1KAGA 5FD8A 2YWEA 3WGGA 2F3RA 3QK7A 3M9XA 1GCGA 4PPGA 3X1XA 2JI9A 2ZSUA 4UTPA 2BFZA 2YNTA 1BU8A 2H3EA 2OLEA 2VBCA 4NFSA 3WNVA 1BX0A 2D5IA 4HFNA 1ZKPA 1WW3A 1A71A 4A36A 1QYVA 2BCJQ 2GDJA 3X2FA 4IZ6A 3D4BA 4BV9A 1FTSA 2QL5A 2H1HA 3MQ4A 4ZKEA 4HXYA 4KSCA 3DE4X 2UUBB 4LYGA 1EH5A 2BLNA 4TMFA 3GFVA 5KNBD 2LD4A 4NCHA 1PCXA 2WJJA 2JLWA 2FJPA 3E9RA 1I1QB 1U3UA 2VJKA 3HRIA 2PWAA 3B5EA 3DZDA 4J0HA 5IBCA 4FMBB 5FYDA 1ID1A 3K31A 4OIMA 1US8B 2ZYSA 5IARA 3QKTA 1ZVKA 2XADA 3STTA 5DCLA 4LY3A 1FVFA 1K6XA 1EIWA 2NO1A 3O31A 4C0JA 1O87A 2ZIGA 1M2XA 2EEPA 1OSNA 2IZ7A 1G59A 4R01A 1JX6A 4AJ1A 1YCFA 4XFDA 1XQYA 2R8RA 1C8BA 1Y7IA 2OMEA 2RMKA 2NAPA 4I55B 4X97A 1KYVA 2WKSA 1EFHA 1H2HA 2N75A 4KACA 4CF5A 3FKSD 3WIBA 5IPFA 4EY2A 1QTRA 4W8GA 1YU6A 4CMEC 3HYRA 3HUUA 1AGPA 9LDTA 4GL2A 1NVMB 1CT9A 1DXHA 2OHHA 3I04M 4LYAA 4XH9B 4YMWA 3DMTC 4A91A 5BR1A 4ZVQA 3TRIA 3QE0A 4WFJA 3BT7A 2ZVQX 4BO1A 4EG6A 4DXDA 1YCGA 3RTEA 5JVDF 1DAOA 2Q46A 5JFGA 1EYZA 2YIMA 4J0QA 4D8VA 2GYVA 5BW6B 1R12A 3QPWA 2CE7A 4M8SA 4QHSA 4R9SA 2C3OA 3CWQA 4WL0A 4DNQA 1K8RA 4NOKA 5HK8A 5HKKA 1EXWA 3QLUA 4D3FA 4ZCPA 5DBEX 1BFDA 4KQ9A 3TEJA 2AUMA 2OORC 3KBOA 3OCUA 3OKPA 5BWLA 3L01A 2ONYA 1EJBA 1S7GA 3K3PA 2O8DB 1MZVA 5I9TA 2BFZB 1UADA 3DZHA 1ZJZA 3H1TA 2Y1EA 4JBYA 5DN6A 4IXTA 1PT6A 2QVXX 2DKFA 2BGRA 3FUUA 1KJNA 3OZUA 4GP7A 5DGDA 4ESVA 2A59A 5EIXA 3BEOA 2Q4BA 3I1FA 4QBGB 4N5HX 5CJPA 3D3EA 3SR4A 5KNCD 1GLVA 3LKDA 3K6SB 3KJGA 1OBCA 3GLIA 3TQOA 1LWOA 3NBYC 4HVLA 1X70A 2QTVA 1BQEA 3DQQA 4ER0A 2RIRA 2AEFA 3U4QA 3S0ZA 3M1LA 4Q4HA 5KYGA 5BWNA 5IJAA 2DY0A 3QKRB 2R1ZA 2C9ZA 5EP2A 1N8KA 3SC4A 4DSZA 2I6XA 5LFAA 2FW0A 4U2CA 5A3SA 3I4CA 4HQ0A 4DZTA 1HQYE 4N3GA 5CUQA 4OFXA 3BFVA 4IVNA 3H2IA 3PRYA 3VNVA 5KZMB 3WWOA 1Q5PA 4A7PA 1CDEA 1HYEA 3HK2A 4AG3A 4HQNA 4ZQFA 3VPDA 2M6KA 4NJMB 2CN1A 3TNDA 1Y7LA 4W1SA 1NT4A 4ES6A 1ZD3A 2CLLB 3TRHA 5IK2A 4PQRA 1XD9A 3FUVA 3ZZNA 3VNUA 1G17A 1NR5A 4PXSA 4RTSA 1U2GA 3QU4A 3IT0A 1I4EB 2HMUA 1XE3A 2EHJA 4I1VA 5L4SA 2XQIA 2YWDA 1OILA 2O8NA 3QFFA 4LWZA 4N8EA 4XGKA 4ZZ3A 5L40A 2GBFA 3UBTA 2D1QA 2HUPA 4FBMA 5FOTA 2V6JA 5JZSA 1OC2A 1ZL0A 1FLVA 4OMFG 3RRBA 2X8WA 2GBCA 5J2TF 2MYPA 1IHXA 4TMVA 5CA1A 3UJHA 2Z9BA 2QX6A 1L4BA 4M9QA 3WA6A 2HLHA 3A4TA 5I3CA 4CG0A 2LE0A 3OTHA 4UBIA 2C97A 1UT8A 2WV7A 4QVGA 1E58A 1NBEA 4YYEA 1JLSA 3U9TA 3QITA 3DL2A 4JUAA 5EPUA 1Z88A 1ZVQA 2EARA 2O7NA 3AY6A 3DT9A 3I83A 4G0NA 1VJCA 4LRUA 2QTFA 4MA4A 5BP7A 1B26A 2Y1GA 1ICEA 1VL2A 3QRWA 1JHAA 2P9JA 3IOBA 4AMGA 1FP1D 3L84A 4JZKA 1NP6A 2FPPA 2FZ5A 2V54A 4TN5A 4M8IA 1QIJA 4UBNA 3RANA 4EB3A 4C4OA 3G5MA 2CUTA 3NTUA 1FU7A 3LOUA 3NBAA 1B8PA 2NSHA 5JO0A 1G3UA 2CNBA 4M9UA 3ZE1B 1AMOA 3HI4A 1MO3A 4KO2S 3DZJA 3PQFA 1SCUB 3I5AA 3W5JA 4KBYA 4BPBA 1QOQB 2X5OA 1YB6A 3QA9A 3CF6R 3UUWA 1SBQA 3AL2A 4KLAA 1T3HA 1NF2A 1M8FA 4AG6A 1G7CA 2YDYA 4URXR 2DOKA 1P4JA 3I76A 2GZSA 5SZIA 4DMGA 3ZKWB 4Z5XA 1KGDA 1GG5A 3BSSA 4B73A 1W88B 2I0FA 3AEXA 3FVQA 5B7QA 2JI6A 4EBBA 3THOA 1XLUA 5DX8A 4CIYA 1L9KA 5D5HA 3JRXA 2EJVA 2DBZA 4G9BA 4MHSA 4PZUA 5BW5A 4OFBA 2XRZA 1EUYA 3C3WA 1JUDA 4TV8F 1R1DA 3P2OA 4P5PA 2VYCA 1ZFNA 2Q9BA 5DHRA 3SYRA 3I9V1 4OA5A 1GPNA 5COQA 1THMA 5E6RB 1E3WA 4EYQA 1E9VA 1I2AA 2AN9A 1KO4A 2RBEA 1PBNA 1XPOA 1GCIA 3HFRA 3JY6A 1HBJA 1GCAA 3PA6A 4BQSA 2NSJA 2ZDHA 1YI1A 2XUJA 3BBLA 1JZTA 3FGOA 4FMDB 4ILKA 4RTMA 2R0QC 4JJ6A 2BBWA 4OPMA 2VXCA 4BVEA 4AKHA 5ICFA 1A27A 1QQ5A 1Z8DA 5KQSA 2CBNA 2P2DA 4G8JA 3VTAA 1L4YA 1EE1A 1SXJE 3OZGA 5U4XA 4EF5A 1GUAA 4IJ6A 4EOGA 4F6RB 2EBWA 1RJEA 4DDWA 1FBNA 1HWYA 1XWIA 3MWKA 4JNCA 3IUEA 1QGYA 4KO1S 3AERA 4AXHA 1WCWA 2NSDA 2OG1A 4WOJA 3OOWA 3D4NA 4K88A 3LCRA 4GCWA 5EXEA 2YVKA 5JVDA 2IYQA 3MOSA 1ZL2A 4GX0A 4GUAA 3Q8XB 1JGTA 5JTUA 2PX0A 1G7RA 1UPXA 3K1AB 2CNKA 4QUKA 1VIYA 3W04A 3ZK7A 1U90A 3IAUA 3LP8A 3C5HA 4QXRA 2E0IA 4YC7A 1M83A 2FEWB 1QO9A 1T15A 2A5FA 2ICAA 2Z2ZA 2D1YA 1H6CA 3LHKA 1FU8A 1L4EA 2BTQB 1PJRA 1LCIA 2FPGB 2OGSA 3LT0A 4R8RA 4YFYA 1TYBE 4AZVA 2XWJI 2AH5A 2HGSA 3SXUB 2VUUA 3FDFA 3CO5A 3KKLA 4MLZA 1YMQA 3K1TA 3OO0A 1FMLA 1WZNA 1Y6QA 2G71A 1SB9A 2ANCA 2X0JA 4MS1B 3FTDA 4RO0A 5H3HA 4JP1A 4WZBB 4X8LA 4D9NA 1DELA 2JA1A 3STXA 2EZ8A 2PXXA 1L3IA 3NQ41 3OZSA 4Z49A 3M89A 5IC6A 4BX3A 4KI7A 4RZQA 4IF6A 5FI3A 1VL5A 1IWBB 1BGWA 2NU9B 3B3FA 2DUJA 1AGNA 2G40A 2YXEA 3IAM1 3K0AB 4WK0B 3TTWA 2GO1A 2XUAA 5KYKA 1XEFA 1YZVA 2QL9A 1VE7A 3ZW8A 2CFUA 2PCLA 2PHZA 4F7DA 3RNLA 3HXLA 1NURA 1NXXA 2X0DA 4FYIA 4B3IA 2FPSA 4RACA 2HGZA 4LCEA 3VDQA 5AJVB 1L9XA 1YS1X 4W5OA 3TL3A 1QIHA 1SEVA 2MT9A 1W581 1CFZA 3BQMB 4NG5A 1ZCBA 1G8YA 1A98A 4LDRA 5ITZA 4O2BA 2XKJE 3AF5A 3N5KA 2QPOA 3CRNA 4IUDS 1BVYF 1TVMA 4XPZA 3E15A 2BEVB 2HQOA 4YCAA 3WK6A 4BGVA 1GUBA 2XGSA 1HE1C 2C00A 4R83A 2BTEA 1N5RA 4HKTA 2O59A 1OXKB 1P4RA 2GXSA 2VVTA 3NMUF 2HRDA 2XF4A 3KZCA 1I7DA 5EGSA 2BFCB 4WESB 1ID8A 3U31A 1M2OA 1YZTA 1ZUWA 1XQXA 4MS4B 1Q92A 1ZQ9A 5FWAA 2OAGA 3D8HA 3DLAA 3W7BA 3L8EA 4YQZA 3FYTA 2XKBA 5AUQA 4B80A 1HG0A 5TQ2B 3ZY4A 3QOYA 4BEBA 3O94A 4E7PA 3DZCA 4C43A 2M9MA 5BXQC 4IYJA 1VHDA 5INTA 1CWUA 1K6JA 1DC5A 3QGMA 1VDZA 4M36A 4C7OA 2HA7A 3NGLA 1A88A 3CSSA 2J6CA 1U81A 2WHXA 1SGWA 1A5BB 3H9JA 4QFDA 2XYQA 2IOFA 4C4XA 2PUAA 4V0HA 4RIGA 5CB4B 2W2NA 3BKXA 3CEJA 4NMLA 1D4OA 3WRXC 1KFEB 2QYTA 2O4UX 3UANA 3A1DA 1CR4A 1LF0A 3NAZA 1PR3A 1UBMS 3R7SA 4DV5B 1JE1A 1X1BA 3JAKA 4PZZA 4P98A 5K05A 3U09A 3JYLA 4QYIB 2WFLA 3S99A 4H15A 1P1HA 2HLPA 2ZRFA 3M82A 4H4EA 1DU4A 1NUQA 1D6MA 5CX4A 4ZDWA 4A2PA 4ZEJA 3HLYA 3F8SA 5F51A 2A33A 1U5BA 1UFOA 5EJ6A 1LEHA 5IMBA 1MAUA 4FGLA 1DJPA 1M2JA 3R0ZA 2WJPA 4AO8A 4LF9B 4AF7A 4EFKA 3A70A 5JRJA 4DLYA 4F3RA 4OYRA 3RQIA 3HJFA 1UK6A 5HR5A 4BRWA 4HB4A 4OHUA 2XLCA 4IOJA 1N2CB 2R7AA 2P4ZA 4ZFNA 3OFJA 1FX0B 1GRCA 5EMMA 5LCXA 4YR7A 5EHZA 2YJNA 4HWTA 2PBLA 3HGTA 4PW0A 5D5QA 3VYSB 2DLNA 4U6QA 2VPWA 1CUXA 2CDRA 4MVJM 4BWFB 4DA7A 2X9GA 3BH7A 4CMHA 4ZALA 2ZI5A 1XMVA 4IG9A 4TV8A 5GWXA 3CNOA 4IV5A 4TKUA 2RGEA 3KWLA 2CD9A 5EWAA 3ZY2A 3V2GA 1WPGA 1T5OA 4ND5A 4YJ2F 4DUPA 2H4YA 3DHEA 4AQ7A 3KR2A 1O7JA 4KNVA 1SUBA 3DL7A 1ISJA 3KKMA 2O07A 4CKEA 2JGFA 2YV3A 4TXJA 3GUUA 2I4NA 2FSGA 1H0RA 3BN3A 3GJ4A 3L0ZA 4YMIA 1M6EX 3PUJA 3MQFA 3E1GA 5FPHA 4E5SA 1DG9A 4U8GA 1QWSA 1USVA 5AM2A 5F4ZA 2W6JA 1N0IA 2FFRA 3OLCX 3TQHA 1FMTA 3RYIB 3MWEA 3NHWA 1B1AA 5FXMA 3DFFA 3CLTC 5AOVA 4AV7A 2FZEA 1IAQA 3INTA 7YASA 3F9OA 2NZEA 3CKYA 3G2MA 5HA5A 3C15C 2HR1A 3L40A 1VE3A 1R4MA 3CPHA 3SE7A 3PJFA 2APJA 3SYNA 3GAAA 3GEGA 1P0PA 4FD2A 3S1LA 2I2AA 3MB8A 1YRAA 2BHNA 2ZROA 5L3ZA 3RJZA 3W6NA 1QSGA 1I0ZA 3TE7A 4RYLA 3TRKA 2Q0JA 2RI0A 2J0UB 2YQ5A 1IBCA 3OT4A 2VZ0A 3EF1A 4KTVE 3SXPA 1GM5A 1NXSA 3EHDA 1M6WA 1MB0A 2NPIA 4JJ4A 2PJUA 2VLIA 1A04A 4AB1A 1AZWA 1EK6A 3GDOA 4B4UA 4KIUA 4OJNA 3T0IA 5CCDA 4B7AA 1E7SA 4J7CA 3VVLA 2A9PA 2D1RA 3A05A 1LSUA 4AG5A 1WVIA 1MT3A 3GUCA 4OK6A 2GEFA 4CKBB 4C1DA 2P6OA 4Q0MA 1L3BA 4KQ2A 1DJMA 4AJHA 4XYMA 2PYIA 3CX3A 5BVHB 2O2SA 4CQNA 1ODJA 3ZGLA 1NR7A 2QTHA 3D4OA 4M7RA 1EDEA 1XTTA 3ZHRA 1P17A 3WGZA 3E9EA 4QBFA 6REQB 3M6LA 4P4SB 1CF9A 1OGJA 4F9TA 4J03A 3IS3A 3N8HA 3S70A 1KC3A 1U3DA 4EDFA 3MWGA 5A02A 4XM2A 3SMVA 2YHAA 4UHEA 4X91A 2I2BA 4QEKA 3TM4A 1IOLA 3WL6A 4DZZA 1BQ3A 3RFXA 4E6PA 5ALLA 1KVQA 2YCBA 1XU4A 1IE3A 1RYNA 4MYHA 2ZPTX 4ATNA 5KHLB 2JLAA 1P5FA 4EO4A 4DV4B 3C6MA 2P65A 2W2OA 1D4AA 5EFZA 3NAGA 4P62A 2GCGA 5K6TA 4GBMA 5AVZA 1RACA 1XPJA 5DYWA 4YRJA 1Z39A 1JJTA 4JVNA 1ZGBA 1B0ZA 3O91A 2VKTA 3PTLA 4MW0A 4EW6A 1ISHA 2OV3A 3AILA 3P9QA 4ZEMA 1R0SA 3EZ9A 1CE8A 3KR0A 2F9FA 2QMZA 1G3RA 3TAUA 1X94A 3AGPA 1J23A 4B7ZA 3BA6A 2FMXA 2HQ1A 1N5IA 2XITA 1CUHA 3BSYA 4MGIR 1ATZA 2P4SA 2Y1FA 2ANBA 4Z9BA 4TGLA 4DA0A 3IHWA 2CXHA 1F51E 1OF1A 3I37X 1VI2A 2R4UA 1CY7A 2E87A 4UDXX 4WK6A 3U6KA 2UYYA 1M1NA 1WUTA 2V97A 3EEYA 2C88A 1X7XB 5JMTA 1D6NA 1OAKA 4PO8A 5DGXA 2BZGA 1XZHA 4TLMB 1AS0A 4AWXA 3WWYA 4LBZA 2G36A 1QV6A 1N5JA 2QR3A 1P6UA 3C85A 2PBZA 2WT8A 1HE4A 3KEFA 1LC3A 4C7VA 1ABBA 5B1YA 3KNRA 1Z5NA 3IBSA 1O9GA 1IY8A 3PYLA 4P3PA 2PAFA 1RXEA 3I9JA 1UBKS 1JW9B 2PQ0A 3R5SA 1JILA 4OQPA 2B6NA 1Q83A 5D85A 3STYA 1Z18A 4A26A 3GJZA 1THZA 3DDHA 5CK4A 2ZQ5A 3ZVNA 5JYBA 4Q37A 1PNVA 3J7AC 1XQ1A 3CX8A 4GC9A 2ONZA 1PSWA 3PDHA 4JODA 4FHFA 1KERA 1SUDA 4N0QA 4AMYA 4RAWA 3MCWA 5AVKA 5BPHA 4B17A 1E3DA 4R68A 3PXBA 1GNTA 2YMLA 4TUYF 2IELA 2GCIA 1XRJA 5L53A 4GPBA 1X7WB 5TF0A 4OSPA 4R8KA 5BSRA 1XKXA 4YPOA 1KOGA 4JJGA 3B85A 4MUGA 4LGYA 2WK1A 3KKPA 1M0EA 1OFIA 3CZAA 1ZJ4A 1P6XA 3FPFA 1DZ3A 1J21A 4Z7OB 1R8YA 3C8DA 3AMVA 3GLVA 5HQ3A 5CITA 2BG2A 2HB9A 4GEKA 3OWXA 3R9IA 1VCHA 4IICA 5FHRA 1WIWA 3SZUA 1E4EB 4C1FA 2IOQA 3SKYA 1DFHA 3GLTA 5HIIA 4DJJA 2Q0SA 3KRTA 4F4IA 4C05A 3G13A 3TIIA 1C1YA 1RRFA 2A3RA 2PU5A 2X3YA 2XVAA 3OIUA 5CXSA 1OYWA 2VHTA 3H42B 4FQ5A 5EEGA 3VYVA 1ZM4A 3SLRA 2WHPB 1U0OC 2X5NA 2VT2A 3EC7A 3L9WA 2AC2A 1ADBA 3LFUA 2BCEA 5KMGA 1PDWA 1SKMA 1CD5A 2ZAGA 2FU9A 4OQYA 1WBDA 2AFIB 5ICEA 1GILA 3L8ZA 3BS4A 2WF5A 3TRFA 1AHNA 3VX4A 5JUWA 3L4SO 1FFYA 1E1NA 4RLQA 3EGCA 4TTRA 1ZBQA 2GJ9A 3R4VA 2XUGA 1TVKB 4ARAA 4B7XA 2CMGA 3G79A 2PUDA 1M3SA 5B58T 4PG6A 4LF7B 4IHJA 4BRUA 3M1YA 2ZULA 5F3RA 2B25A 5FUXA 3EXAA 2EC5A 2VP2A 3E22A 2C92A 1C50A 4KQCA 1L7OA 3P4YA 1NN1A 3U9SA 2YNVB 3TRDA 2CL0X 3O8OA 3W2EA 4URZR 2IHJA 3G0GA 1XQVA 4OV6B 2AKYA 4YJKA 3ND9A 1FVXA 1OXXK 2PJRA 2A0YA 1HYHA 1IIRA 3K6JA 3HDHA 2EF0A 5JE8A 4G2NA 2Q5EA 2A0XA 2HMWA 3EMBA 3RRJA 4YHHB 2F3TA 5JO9A 2Z2XA 3DJFA 1QFMA 1UR5A 1TW2A 1H4TA 3ET5A 4NCJA 3KQLA 3J81A 2J6IA 1HQCA 2XCTB 3H0KA 3M33A 5C34B 4DABA 5IF3A 2XKAA 3EUEA 4E6EA 3DCIA 5T5QA 3NIWA 1F2TB 1PDOA 1EMDA 1T6ZA 4JGGA 1SG9A 4PXAA 3ME5A 2QD1A 1HDGO 1DOAA 5K8JB 2Y4OA 1JT2A 1QTNA 2AJ8A 1SRQA 3GR6A 5K0WA 1A4XA 1SCAA 2CZQA 1BRTA 3NASA 3TGPA 1Q3HA 5I7OA 1U7HA 3HGMA 2IOFK 4NYIQ 3D5EA 3ROZA 3BZUA 2NUBA 3L05A 1NMSA 2C0PA 5AI8A 2VUHB 1SBYA 3FPEA 2ZUSA 1NULA 3Q3CA 1O0BA 1Z7YA 4GZLA 3AR4A 2WY2D 4OH1A 5FUYA 4R16A 2YFHA 2IPLA 3CZRA 4HWRA 3PX2A 2WUFA 3DC2A 3QTTA 4R0VA 5DNWA 3TNJA 1AQJA 4AN1A 4QM7A 3FSRA 1I7LA 2VJAA 2WYVA 3Q41A 3K5WA 4Z3OA 4D25A 2FHXB 4MWCA 1DTWA 4RXTA 3SFZA 2WABA 4ZAWA 4AS3A 5C5EA 4OFZA 3UMFA 1PL6A 3T7RA 1IRIA 1T36A 3CIFA 1M10A 1QMPA 2HJGA 2P40A 3U4DA 2HJSA 2FZ4A 2Z9DA 3ACDA 2FUCA 3EDMA 1P0QA 2VQSA 3I9KA 4JJ8A 2FR0A 2XOEA 4X90A 2NO6A 1COWA 4ESHA 1EXVA 2Z1MA 2WM9B 1P5ZB 3P7MA 1XMSA 1I30A 2FG6C 3IEKA 1H2BA 1W1UA 3GJ7A 5F2OA 1JE0A 2C1EA 4A10A 1UWLA 3AKDA 3H87A 3Q4GA 3WLKX 3C7CB 2O8CB 3R3WA 3R77A 1OREA 3O7MA 4DCNA 3T3NA 1SOVA 2P9TA 2HF8A 3UJ3X 3V4VB 3Q10A 1Z25A 2JCYA 5AIJA 3OKAA 3LE8A 3PUHA 4V39A 4K2AA 3TDKA 4BU0A 4WLFA 4DWWA 2PGNA 3EWSA 4BGEA 4C0BA 5EH9A 2CXXA 2DBYA 1ZLYA 4OX9Y 2GETA 2FXIA 1Y8RA 4ZZ0A 1ARZA 1YJ8A 2W2KB 4KMMA 2SKCA 3CRW1 4LZJA 3ZCVA 1YWGO 2FB9A 1K9VF 4D02A 3ETGA 4K03A 5EP4A 1SKQA 2GZAA 3AESB 5EWJA 2WF7A 1JAHA 2AMLA 2YW9A 2VXOA 3R7AA 5LCHA 2CXNA 2JCVA 3OLVA 3P1JA 3D64A 3H1EA 4UBMA 4DREA 4IX1A 3ES9A 1EAMA 2G9VA 3MWYW 2Q6KA 1KDPA 4A5SA 5HQJA 1AKTA 1HE3A 5DX1A 3E8XA 4IV0A 2OYRA 3QEBZ 1UM9A 1QZZA 1A77A 1AN0A 1W93A 2V3WA 3GFRA 3PVCA 3RYHB 5E4JA 4JJKA 3PDIA 1D04A 2Z6AA 2RC5A 2JIOA 3U16A 3GEEA 2B5OA 1QFJA 2QE7A 4HEQA 1LB1B 1X8KA 1O9HA 2D5CA 2FPOA 4L4XA 4Q3KA 3RWMB 1N2SA 2L18A 3KELA 3P2UA 3LFTA 2XCOA 1YR3A 4HLQB 4RD0A 4C09A 1A2BA 1U94A 1SVLA 3GFSA 3GVXA 3L0CA 4MV9A 5F76A 1E6LA 2BHTA 3PC2A 5AJLA 3PV0A 3USZA 3DFZA 1RQ7A 1K5PA 2B8TA 2W2TA 1K3TA 2ZSIA 2P67A 4R1SA 2R5WA 3QXCA 4RE6A 3SS9X 2IUTA 3UAZA 4P4GA 4MB0A 3AC0A 2JLBA 3ETLA 4GWGA 3WMWA 3X2YA 3FWZA 2O8VA 3CCBA 4BY9E 4I2VA 5H4HA 3FOAA 5TEVA 1M2KA 2QRHA 3C45A 4W5NA 2HZBA 4NBVA 1ZWKA 3QX8A 1J0CA 4DCVA 3IQWA 1KZ1A 4HAUA 4X7MA 3AUKA 1V3TA 5JI2E 2UZ1B 4HPXB 4IDNA 3ZR4B 3O9MA 4EAAA 4X62B 3SW3A 2FW7A 3REQA 2YXLA 4CMIB 2I4LA 3ZBTA 4MHOA 1KYXA 3LNTA 4C9BA 1CQIA 1P74A 2X7XA 4C6TB 3CVJA 3WNCA 4AJEA 4C0KA 1M34E 2P9HA 1U2SA 1KOLA 3DVRX 4G1FA 2WOOA 4MKGA 1OFUX 4CF4A 3BCUA 4UHFA 3W9YA 4J2TA 1FSSA 1RMQA 4WXHA 4YXWA 2ODQA 5JPDA 3QVUA 2VKQA 4HDRA 2DLCX 1VG1A 1PFQA 1M5RA 4GM0A 4HAOA 1TOAA 3BKWA 3BFXA 3LO5A 4MW5A 2P2YA 1N5LA 5ITVA 1Q1NA 3BWYA 5HKOA 2VSNA 1I80A 1NF3A 1ZGAA 1IUOA 3ZK8A 4FHDA 3H2JA 4IDEA 4WDRA 3ZHCA 1J49A 2JI8A 3O2QB 4YRIA 1UZAA 1K92A 1XTVA 2H1WA 2J1LA 5JS2A 1VM6A 1TEXA 2G17A 2P8JA 3QW2A 4K28A 1PL8A 1E20A 4LF4B 1YUBA 2RGYA 2WIBA 4G5XA 4RA6B 3DWIA 4W9NC 1YOVA 4YASA 1TPZA 1EX6A 5ALDA 4KQ1A 4HDMB 1NKSA 2GTPA 3QPVA 4L0MA 3N6RA 2C5FA 1CW2B 3RC2A 2A1UB 2MIIA 2PWPA 3AIOA 3TSWA 1G6KA 1BU5A 1O5TA 1P19A 2GNPA 4RANA 4ZT2A 1QQ7A 2QJRA 3DHCA 2BTNA 4JEUA 3A9VA 3RYFB 2VAPA 5JAPA 1YJBA 3JYNA 2KI5A 3IVCA 1UZNA 4COKA 1FJ2A 4NG4A 4OLBA 1TEZA 3IQIX 2BZSA 5LQJA 4D6XA 1S8NA 1FFXB 4RKWA 1CEXA 1EM8B 2FCRA 2LIPA 2OFWA 2Y66A 3CWCA 2OPHA 3UXHA 1Z4PX 1W5TA 2PO5A 1O5IA 1ADCA 2GCEA 2Q2WA 2V4MA 1EWRA 5DHAA 1H42A 1Q1QA 2QJTA 3T5GA 3RQSA 2XE4A 4AUMA 4CMEA 2INGX 5FV4A 4N47A 3V4OA 1OX4A 2XQKA 4MUXA 3HFJA 4I5FA 2ZM6B 1SQ0A 4QEZA 3WHPA 1WHTB 2F1IA 3ZV6A 2PYDA 3IIEA 3WYBA 3ZDEA 1P45A 4XD7D 2OQVA 1PNQA 3I13A 4G4SP 1PLLA 5KDLA 3NT5A 4BIIA 4F9FA 1J4AA 3GD7A 3KZOA 1WULS 3RUAA 1RIIA 5CEEA 4GYWA 2ZYVX 3A31A 3PNSA 4BQQA 2ZJFA 3DAFA 3T4UA 3BD8A 4TSFA 5IN4A 2WQ7A 3ZWAA 3CUSA 3W9UA 1YFKA 2Y76A 2BG8A 2PL9A 4TMWA 3GDGA 3UXYA 3EVFA 4NMWA 5KU7A 1LPPA 4LJKA 3PTAA 3HB0A 4KN6A 3UV7A 2Y2UA 4RGBA 4Y9SA 2FUG1 3OIYA 3GEBA 5LN1A 4O4LF 1GZVA 1E59A 1KZ9A 2OZPA 3RHZA 3X1ZA 1IOZA 5GIPE 4M1KA 1UKZA 1RXIA 3EDQA 3QU7A 4PYKA 5HBGA 4FEAA 2C2YA 2O5VA 3IKJA 4DDHA 2LKCA 2WP0A 5L7WA 4EQZA 1TUBA 3A2LA 3GIWA 2GR9A 1KVSA 4B3BA 2GILA 1V9SA 2IXAA 1J0EA 5CB6A 3H3EA 2K7ZA 3EC2A 4IO0A 1XEWY 3ZBUA 1DFGA 1YJAA 3PE6A 4WD3A 4E5KA 1U7DA 3AU9A 2FYTA 3KAQA 4IFTA 2X23A 3DWGA 4ML3A 3RSOA 3ZQ4A 3PA8A 2DWQA 5KTPA 3BVPA 4NBLA 4AO7A 3UGTA 1I7NA 1FW6A 1W35A 2O1EA 1H1LB 5FO1A 3PQDA 2YINC 3Q88A 1KBZA 4G89A 4O4JB 4PF1A 2XUZA 4OY3A 1WTCA 4ZVMA 2GCPA 1E32A 4BNKA 2G5GX 3ZS9A 5GTDA 1P7YA 4KN5A 4B81A 4RNCA 2YY5A 1MAHA 4EHDA 3P20A 1UZLA 3O47A 2UUCB 3Q7EA 3N7UA 4C30A 1ZESA 3U4CA 4B79A 2GMNA 3H05A 1V6AA 2Y8BA 4XRGA 1CUSA 2I4IA 2CHGA 3BXOA 1OLUB 2IDZA 3GVPA 3GZNA 4GLLA 5CYGA 5JWRA 4R1TA 1DZIA 1OXBB 4LWOA 3DZFA 5FBQB 2SKEA 5IW8A 3EW9A 2Q3EA 1WF6A 3QBJA 3ILYA 5FOVA 4F04A 1Y63A 3K1YA 1EQAA 4PVTA 3FA2A 4AD9A 2CJYA 1YDHA 4FN5A 2P1EA 1D8TA 3DH0A 1H65A 2KX7A 3F67A 3L0PA 2CY0A 2XTJA 4YDHB 4QYWA 3NVKI 3NIBA 1G8SA 2VNSA 5DDIP 1WXIA 1C1DB 3L7MA 3RS2A 2AX4A 4QAQA 3HU1A 3K1JA 1RYYA 4NDNE 4PG8A 1CR0A 2NNWB 1E2DA 3MINA 1WMEA 1XB2A 1OASA 3IP7A 4FMCB 4YAWA 4GYQA 4RQAA 1EDOA 1K6MA 3HCCA 4ZA2A 4GMXA 1XMXA 1TO2E 2O57A 1GA6A 3P9CA 4K3VA 4OCZA 5DGTA 5HE8A 3UV6A 4E32A 1TK3A 1ISIA 3THXA 3DKRA 1B1CA 1YE8A 2AOUB 5AP9A 1Y81A 2NXJA 5KYUA 3UFBA 3QXXA 2DCMA 3ZEIA 2A7XA 3SLKA 3LGSA 5DGHA 2JRLA 1DT3A 5HHTA 1JLHA 4P86A 3BERA 3DQZA 3P8ZA 4HBZA 5KX5B 1C7JA 3AH8A 5FL3A 4AKGA 1KSJA 3RVDA 2GWRA 3BPSA 3M9WA 1W7AA 4NYJQ 1N2OA 2P4HX 1Y1LA 2O0LA 3NHUA 1XMPA 4UVDA 4GI3A 4MEJA 4TTQA 1E2NA 4P6VF 4KR0A 4WGFA 4ZQHA 2ZKLA 2LP4Y 3EXHC 4WN3A 4ILEA 1F17A 4YDSA 1PD1A 2UDPA 2EKZA 2WWFA 3AM4A 1GT91 4GS5A 4H9GA 1NBWB 5BSUA 1KQNA 4G0ZA 4YYZA 4K81B 2JCBA 3HJAA 4YUWA 1F2VA 1Q95A 1D2RA 1YRHA 2J9FB 2JGLA 4NU6A 1C3OA 2B6HA 2PXCA 2P79A 3PB3A 3CVWA 3R5XA 2J9GA 3JYHA 4HMQA 3W90A 3O0TA 4DHWA 1IXYA 5ACTA 4PHCA 4UHBA 3ZTWA 1KSFX 1DC7A 3ZZUA 2WJHA 4ZGWA 4YCCA 4NQ6A 4D9EA 3LAWA 4TL7A 1ODTC 5A6SB 3LVBA 1QHHA 4MMXB 4G67A 4BNIA 3QLEA 1VJTA 1V16B 3KVRA 3BB3A 4I9FA 4RCVA 2JAQA 5CXQA 4Z4EA 3TDNA 1D0IA 1EKXA 1JYEA 1N5OX 1RAIA 1U0GA 1GSHA 5DMHA 1M66A 1YZHA 5JD5A 1Q7RA 1YRLA 3HADA 1JFFB 2C3UA 2WILA 3UKJA 2HYIC 1I3MA 1JEEA 2O54A 2DFKB 1GTVA 5KSOA 4M1MA 5CFPA 2ZUUA 2O8BB 2G76A 4YBRA 3H9EO 5K3OA 1FRZA 3BMQA 1D1PA 3VO2A 2HBRA 3NXKA 1H4VB 1ZI6A 1PJAA 3OD1A 4TYWA 3I01M 4ZOEA 3OFND 4UASA 3TL2A 4BFSA 1VYTA 3PICA 1ZW1A 5KEIA 1E8MA 1DJLA 2P77A 2EZ9A 2IQIA 1PQUA 2PLNA 2PO7A 1Y37A 3JALB 3M4ZA 5AVUA 1N7IA 3PG5A 1GUDA 3MUNA 1RFGE 3NRJA 4Y2HA 1IZ8A 2V8BA 3N5CA 4Q16A 1L5HA 5LQDA 4D4JA 4ND4A 5DM0A 2ZO4A 2Q0XA 1NRIA 1V4VA 4I81A 5FL7A 3FI9A 3PFCA 4YAIA 2UUAB 1JG4A 2YRXA 3H2BA 1H2EA 1Z35A 3MPUA 2C5AA 1WZEA 2BHLA 4FYVA 2WM8A 4GLBA 1IB0A 2B21A 3VNSA 1X7GA 5K99A 5K8VA 2IRWA 3IXQA 2FW8A 4CDNA 1Y80A 1NIJA 3ZDXB 2J08A 1I4TD 2YHUA 3TQRA 4GKKB 4LBVA 4GPEA 4D5EA 3Q6VA 2IA5A 3R2JA 5JNLA 2ISQA 3BTUA 1WV1A 2Z57A 3MELA 5BOVA 1AK9A 4RVHA 3OTOB 4AJ4A 5J3JA 4I1UA 4MV0A 2QXYA 2VPZA 2VPIA 2DR3A 3ZNPA 3ZXUB 5FNZA 1I1OA 1X86B 3BK1A 1HX7A 5EIAA 4HEA1 1GVHA 4TKVB 4Y2PA 3WRYC 1GPJA 5J4HA 2H5JA 3IQHX 4DNFA 1P7CA 1NN5A 4MJ3A 3UKDA 2R4QA 3CVVA 1ZG3A 5KVAA 1MB9A 4NFLA 1EG2A 1V1MB 4WKOA 3H86A 1UBGA 1RPNA 2X0FA 1AQNA 1A8UA 2P11A 2JAOA 2QDXA 5A9SB 1J06A 2YN2A 4MR8B 5CDGA 1TF5A 4PX2A 4FINA 3OA2A 5T6BA 5BR8B 1M74A 1GCUA 2DFLA 2ST1A 4KWEA 4UQOA 5LMCA 1IZ9A 3KQOA 3HP7A 4IVRA 1XZGA 3ED5A 1AB6A 2YASA 5DO9A 1OHHA 1WM1A 3BTOA 2AKAB 4KI0A 4S2UA 3S8YA 4LE6A 2JLSA 3QHAA 1JAIA 2I6TA 5DM4A 4OMCA 3INNA 4CUZA 5KWIA 3STVA 1H3EA 3R6TA 3AP1A 1MN6A 1RKBA 3RE1A 2YMPA 4I9NA 4K86A 3D4LA 2XTNA 2NQ2C 4CEJA 5B2FA 2NYVA 3KPJA 5T3YA 2IXGA 2JJ1D 4JB3A 2BMIA 2SBTA 2E4UA 4XWYA 3DVQX 3MVEA 3IA7A 4X1YB 4R7TA 5D1NA 2QSYA 4TROA 3G6WA 4UEQA 1WY7A 3W9SA 2D6FA 2O7RA 3PC4A 1P3DA 4HTFA 3V4FA 1UOEA 4AZ3B 1GPWB 4LC1A 3KKNA 4ZOLB 2A8YA 4MJXA 2AXEA 3H11A 2JH3A 2IHYA 2YWRA 4FYHA 4M87A 1GZDA 4Q3LA 4ZV9A 4ECAA 1VCMA 1DNPA 1H93A 1R50A 3NWBA 2MDTA 3MGAA 3OU7A 1YR7A 1VLMA 4DEXA 1EQUA 1VBKA 2CFSA 4ZTBA 1GHTA 2DFDA 3RTGA 4L16A 1PS0A 4AM8A 4DIFA 3H2ZA 3TMAA 2AFVA 5AHKA 4A0HA 3ENKA 2PZFA 1IEVA 2B3TA 4HGNA 4F96A 4YUYA 3FIJA 3THWA 3U7FB 2PPVA 2UYGA 3KVYA 1VE1A 2DHQA 1NW4A 2BEWB 3JATA 4FE7A 5EE5B 5EFOA 5BN3A 4B3TB 1PLJA 3FUTA 2HMAA 1G2OA 3KSMA 4WCFB 2VHZA 2O2EA 4RTNA 3AVTA 1R0WA 2OBMA 1WEKA 2Y9MB 4H1UA 4DXHA 3ZQUA 1VL6A 4ODIA 4D8UA 3F6BX 1OZ0A 2BGMA 2F9LA 2F64A 3FZQA 4CL8A 3N2NA 5BN4A 1C9NA 3BULA 2O2IA 1DT5A 2XHZA 1JDVA 3C3AA 4DDUA 3ZJVA 3C24A 4EI8A 1ODFA 2WYUA 4JA0A 4RJLA 3UNXA 3T7JA 2W93A 3RYCB 3Q8LA 2X9QA 4WE3A 4Y0NA 2GAOA 3OTIA 2L0XA 5IM4F 3SR0A 4FCTA 1Z38A 3M6AA 1Q7BA 1VSUA 1I1HA 3LT1A 4LOKA 2P91A 3T34A 4F60A 3H65A 4YMSA 2G67A 3D54D 3UJAA 1AF4A 3DQPA 4IFEA 1OJLA 1QE5A 1N36B 3ZE8A 1SG0A 4LXTA 3KKZA 4X6YA 2PRJA 1R9NA 3DFUA 521PA 3R7DA 3VPXA 5ALZA 5DOVA 2PSHA 3RAEC 1Z5UA 5DCYA 1ECFA 1NYQA 3ABZA 5IZCC 4GBGA 4DDVA 5BOSB 2P62A 3I14A 2WVJA 3ITNA 2P6RA 1TUGA 1V11A 1XXLA 2ORYA 4UVIA 1Y7PA 2PX3A 5JBNA 1GSIA 3D0RA 5LE1A 1JKJA 1NOKA 1S89A 1IL0A 1C2YA 2PKCA 4U2GA 2RGCA 3ZCQA 1YRWA 1SBCA 1VP9A 1BGVA 2CNDA 1GZ4A 3PTZA 3T9EA 1SURA 2EG5A 2Q6OA 2ZJ3A 5FULA 3A7EA 3CX4A 3GJ5A 3T1TA 3WGQA 4A2WA 2V0GA 4JI5B 4RHEA 1EFAA 1FY2A 3VR1A 5LJLA 1KRHA 1NBAA 1W76A 1Q14A 2V98A 4J9UE 3ZWBA 2JFHA 1BDMA 2II6A 4H3KB 4HRYA 2RHLA 5DYYA 3W1VA 1DO2A 1HETA 3D8TA 1SIBE 1K7FB 1JBEA 1SVOA 4JUBA 1K5DA 4Q66C 1F9EA 4EMSA 1T3LA 1R8XA 1FQJA 2HRRA 4X6UA 2FU7A 4Q4LA 4F84A 3CBQA 4FWIB 4L9SA 3GBSA 4Y6RA 1O1YA 5AVWA 3SICE 1J09A 2XVZA 4YQYA 5JAQA 4BO0A 2Z08A 5AICA 5DVZA 1F60A 2WAXA 1KYYA 2B36A 2XNDA 3R5HA 4PYIA 1TQ8A 1BG6A 1GDDA 1HLFA 3D3QA 5DF1A 5A5VA 2P9ZA 3UHOA 5EJMA 3A1NA 3V6LA 1YB1A 3ND6A 4V24A 3CVOA 1DKNA 1P2DA 3VSDA 4X1IB 5HGJA 4DLVA 2IVFA 2FUNB 4IF4A 3CLUC 3RPCA 2EYQA 1NBIA 5LA6B 5K4KA 4CTNA 3PHIA 2R48A 3PWZA 5IT0A 5FUBA 3Q9SA 5C7IO 2YWHA 1XJQA 1EP2B 1CS0B 1WP9A 4BYMA 2ZUCA 4O4HA 3R74A 4AYWA 5F9HA 2VCHA 4FD3A 1A4RA 2E18A 1LDYA 3DP9A 3O8RA 3MTBA 1JDBC 1O4WA 2J5QA 2VSOA 3NH6A 4FKZA 4HS4A 3OMWA 3S1AA 5ALRA 4CPDA 1YL5A 1N8SA 3I42A 5HGXA 1IK6A 4I3FA 5B55A 3WADA 3B5JA 1JB1A 1X3LA 3ORYA 4I4TA 4WOBA 4YJFA 3DEFA 2XF8A 3C39A 4BAZA 2VXBA 2C4UA 2QDTA 1D0SA 2YBDA 1KU6A 2DB3A 2ZTHA 1P0IA 3PGXA 2Q21A 2ZJ4A 1Q50A 3EUAA 1YDMA 2PZ8A 3ANMA 3KWFA 3O4IA 3OPXA 6LDHA 2WIGA 2FG7C 5FI1B 1J2RA 1UKAA 2KBEA 3GJQA 1AQYA 1ORIA 3H5IA 4B35A 4D3XA 2YWCA 3LX5A 3QPAA 5TARA 4Z1MA 4JROA 3Q9LA 3D1LA 5EPOA 1OAOA 1XKLA 4EO9A 4F4UA 1V8ZA 1RLOA 4RKQA 3KV3O 5CEJA 1TQHA 1Z37A 3H1BA 1PJCA 2J8ZA 1K6IA 2JBAA 3HM2A 2QS9A 3PGA1 4QPJC 5E2IA 1PRYA 3VI4B 3BAFA 3HXPA 2Z6QA 4NQ2A 1U2ZA 1J33A 2G6TA 2NZJA 2IXFA 3PFFA 5E6SB 5FOQA 5HJ7A 5JNUA 5CA0B 3ZHUA 3WBBA 4DSUA 4CQLA 1OB5A 1VQ1A 2WC1A 2PANA 4HGZA 4NAVA 3TINA 4OBBA 1ZITA 3FRIA 4L3WA 2YJTD 1DAPA 4HYEA 4EUNA 1WZCA 4RA9A 5JS6A 2IUYA 5A9TA 2R60A 3KJHA 5K2OA 1MAWA 3DHWC 3EDOA 3FIUA 1ZK3A 2J31A 2C3MA 2J3MA 4JDPA 3ROMA 2VHQA 3TSOA 4BBPA 1I2BA 4E5VA 2WWYA 1NLUA 1PEKE 5HKKD 5EXDA 4EJSC 2WZBA 4JB2A 1QYRA 2H4HA 2W6OA 1TIPA 2Q6TA 4NMHA 1CF2O 1RABA 2XNJA 2Q41A 3KM0A 4WOKA 4RK6A 2MYNA 3HJGA 1TQ6A 3AOEC 4Q3OA 4Q7LA 4ESOA 1BYUA 5DN6D 5FWYA 1PUIA 2O4CA 1J7KA 3QH4A 3UOWA 2QAJA 5K7SA 1A5ZA 1KY2A 1EFUA 1SMKA 3CE9A 4K1LA 4ZO9A 2BDTA 4FT4A 5IM4A 1ZSNA 3IOFA 1I4OA 2HCTA 3EGVA 3GJ6A 4XX0A 5KVQA 3V34A 2CDCA 1TKRA 1QFZA 2QR5A 1ZU5A 1MH1A 4DRXA 2YHBA 4HQFA 1EUZA 2AEJA 2QTVB 2JGEA 3KDPA 5SZKB 2OQ2A 4AX0B 3Q40A 2JJQA 2YIJA 3AY3A 4HNRA 4BE4A 1DC8A 2GBGA 2OPBA 1X7HA 1E2PA 2D62A 1M2EA 3VZBA 2IODA 4N1AA 3F3MA 2B0CA 3W3AA 5IP5A 3X1WA 2AIOA 1A72A 3QIVA 2VZ9A 4S1PA 4EKIA 1N33B 3LDUA 1GKUB 4IIJF 1R7RA 4L8YA 4FOLA 4B76A 4EKYA 5JANA 4RJKA 4YRBA 3D7NA 3QUSA 5EMHA 3JSXA 3H75A 4AMUA 3AEQB 3GWGA 1C7QA 4A3SA 1KEEA 4B3RB 3FCUB 1YE3A 3QU2A 4QODA 2O05A 1FS4A 5H0IA 4GXNA 4BVLA 3K0SA 2OYCA 1EFKA 2ZANA 2BUCA 5IK2D 3QE9Y 2BMDA 1X92A 1AZLA 2YZ3A 1MV8A 2JFOA 2QRVA 2Y93A 2QOEA 3RAGA 4IVPA 5I6DA 1ZVVA 3HYTA 1ISFA 2C42A 3IURA 3ROEA 5KWJA 3IDOA 4L7QA 1TO1E 5GVRA 5BR7A 4B6FA 4RE5A 5JMOA 1D4FA 2Q3LA 3N74A 4XX1A 5JLJA 3TUZC 1O89A 4LMBA 4BZWA 4BMVA 2VSXA 3HN7A 5IF9A 5JT1A 3FX2A 2CVHA 3KD2A 1FSZA 4RENA 4WKPA 1KO7A 3L6RA 3F6RA 5TXGA 1BROA 2F3QA 4L08A 2O23A 3WO1A 5IVHA 2O7VA 5CA1B 2H7VA 5ACXA 1Z6XA 4QNMA 4LGCA 2QW1A 3DVSX 4HV4A 3L4BC 2ZFUA 4BWGA 4CLOB 3QSYA 4WX2B 3HEMA 3RIXA 4HNTA 5LZ4A 1KK3A 5FF9A 1NYTA 1R2QA 4U7DA 3U3DA 4LRWA 1J70A 1M5UA 2QRGA 2VPXA 4K9PA 2ECOA 4ZAGA 4JVOA 4PBRA 5DFAA 4HGYA 1ELOA 3GFTA 5EAIA 2XMPA 3AG5A 3TXXA 4XFJA 4X65B 1JPNA 1W8IA 2FPPB 5ACQA 4KXNA 1EHIA 1Z28A 4HH0A 3ASUA 1O08A 3GJYA 3TFWA 4NYMR 2PUCA 2OCIA 1PZGA 4FBGA 3EIWA 1WUHS 4WKBA 3ER9A 1L8LA 3KJZA 3OCZA 2Z04A 1LDGA 5TR9A 4WSOA 4RJTA 1SOUA 2EX1A 4FYXA 4KXQA 5TQVA 3MOIA 1TAGA 2IZOA 1XMOB 2H0QA 4W99A 4OH7A 1AGRA 4HNAB 2VYQA 2X9LA 5BXYA 1BCSA 1KIMA 3E3AA 1XTZA 4GWLA 1YD7A 1O57A 1N2CE 4L4UA 1E96A 1REQA 1DP4A 2O0JA 1JNXX 2Q1TA 3JQ7B 5DLPA 4KV9A 2FETA 4BNFA 4BIMA 3ABIA 3GFGA 1RI5A 1OGIA 1HDRA 2A84A 3RUEA 3U3OA 3ROGA 4GE0A 2E6UX 3A4NA 3KFLA 4MPRA 4AWBA 1FZTA 1UKEA 3K2BA 1PGOA 3H83A 2FN9A 4R3UC 1D1QA 3ZWYA 3HXQA 1FMFA 3FYCA 3OY7A 3HFSA 1PNRA 2VOEA 1MPTA 3L02A 3HN6A 4IMRA 1W9HA 4C2AA 1SVWA 1UFKA 3OX3A 4RQTA 5ALUA 3DLCA 1I5EA 1L5FA 1XK6A 2DT8A 1HSOA 4UATA 1UODA 2FR1A 1BDJA 2GMWA 3H17A 4AWAA 5IC4A 3FCAA 2PGLA 1ZK0A 3Q1LA 3PWKA 4A23A 1D5CA 2D5AA 4YSBA 1VIMA 1YTLA 4GI2A 4D9MA 4EHKA 2ZRKA 2LR0A 3SU8A 4CI0B 3L5OA 4IUBS 5CDFA 2KWIA 1TYZA 3T35A 5LNK6 1G38A 3VOAA 1KP9A 2R65A 1TYCA 1LLCA 3C7TA 4XVRA 4MR9A 1QYIA 2QT9A 3B9BA 3I0MA 1DB3A 1OWNA 1QVRA 3AERB 4UHDA 2QYHA 3QXGA 2W4IA 4P4TA 1CPYA 3WB9A 3ZH9B 5JYDA 2ATXA 5B1SA 3DR5A 1SCBA 1Q1GA 1RYHA 1YONA 4QDTA 4F1KA 4N01A 5BW4A 1M6NA 3SI7A 1N3BA 2BE7A 4MKHA 5KB3A 1FRFS 1TQ2A 5DHSA 2ZU6A 3FCEA 5FOWA 1MT0A 1XA4A 4U9HS 4DIKA 1U3VA 4A0FA 1X9HA 3BHMA 2WJ6A 4XUEA 3UN1A 3ZHQA 4CLDA 4E4RA 4YJDA 1PAUA 3GLRA 4B75A 1PJLA 3T54A 2IIQA 1K86A 2IOYA 1XBTA 1G18A 3EIQA 5IHPA 4RTOA 1Y3HA 1MQOA 1HZJA 3PY6A 2JIZA 4LYHA 1QKKA 1JP7A 2BE9A 3L77A 3PQ2A 5LP6A 4J7XA 3I8OA 2QEDA 2Z4TA 4EECA 1EVQA 1ZH0A 4N5DA 3QXJA 3T3IA 4EY3A 1FQWA 3K53A 3DO6A 5ER9A 2IKSA 3FVVA 3L0YA 1QYXA 3FGNA 1QYCA 1Z4QA 5JSZB 5JROA 4HPJB 4XIIA 2H4XA 4JYAB 3R7WA 1NHGA 3NANA 3S2IA 3QYPA 4AKEA 1OT3A 1TAHA 2C9BA 4X00A 4DAOA 2ZG6A 2PMEA 4ZGBA 3SPUA 5HF6A 2J0QA 2D3WA 2IV2X 3U19A 3L46A 2AJBA 3ZGXA 5ALJA 4JYCA 2BGGA 3S8MA 3OA0A 2YUTA 5AW1A 2G8NA 4FQ7A 3MJFA 2FSSA 2ZWOA 1X7YA 4GOND 3HWRA 1VPWA 5ITZB 1NNI1 4BTVA 4O2BB 3UTDA 2QDSA 2JJMA 3KG2A 1LQUA 2W42A 2VK2A 2G9QA 3HSYA 4WCDA 5HEKA 4C14A 1I7QB 2FSFA 1LGYA 3OOHA 4RZSA 1GZUA 4HWPA 4JB0A 3T3GA 2VDLB 2FLWA 3E9QA 1CNFA 3CN9A 3TBFA 1K97A 2QD3A 1IOWA 2GZRA 4UUBA 1MX5A 1QG2A 3FG9A 4US2R 5K03A 5SY9A 2V3CC 1K06A 4J4TA 1M2OB 4GQIA 1NPYA 2H2WA 5EGNA 3VPGA 2I71A 4BFZA 1MEEA 3OM8A 3N86A 1PFYA 1PZHA 4MIOA 1NVDA 4UE2A 1JQBA 4X93A 2EHDA 3TOZA 4A8TA 5JHGB 5DYIA 1MHTA 1GOTA 5JDCA 4YRAA 3HWSA 1U0NA 1SQ5A 2ZYWX 1QRAA 4RZIA 1GAEO 1HDZA 1LK0A 4XUDA 4MR7A 2W70A 4C4YA 5ES4B 4EPTA 4EWLA 4C7OB 2ZNBA 1TQDA 3HYCA 4DA8A 1J9GA 1F14A 2BMEA 3W5UA 3C6QA 3WMGA 4K9LA 5D7NA 3AB8A 2IQ5A 1WDWB 2X1MA 4KRYA 1PLKA 4Q9HA 2V6IA 3HHPA 3IB6A 1BD4A 2BGTA 3PXEA 4OQDA 5DBOA 3HDQA 3HTXA 3OE1A 3KNSA 1C9KA 1PZEA 3QVOA 5ETJA 4YAKA 4JXJA 1TMGE 4RZXA 3NBUA 3K9BA 3JAKB 4KPFC 3PX7A 4PG7A 2FPUA 2Y0DA 3D6AA 3LYLA 4OL0A 1WU7A 1FRVA 1M0SA 3N2IA 4ZEWA 4WBNF 3PR2B 4IIEA 3TECE 3ASYA 1B23P 3UK1A 3ZHTA 2VCYA 5FBRB 4JI8B 4W7HA 4LF6B 4U9IS 3KWJA 4ZREA 2BEUB 5LYJA 8ADHA 4X8OA 5EXPA 1CUAA 4PIPA 3ZWVA 4CN8A 5FAKA 1TM1E 1SUIA 2B1IA 2BUAA 3O2JA 4TT3A 3CX7A 4EMBA 1R6VA 1TE2A 1C9JA 3CUUA 1ZW6A 1VP3A 2R8XA 4E5MA 5D5PA 3H0CA 2AVNA 4RH1A 4UXIA 4ZXFA 4TRJA 3HKEA 2P2CA 3ZR9A 4GBJA 1Y44A 2JFNA 3INYA 4GZ6A 1J0XO 3UFXA 2YS6A 2RGXA 4UBKA 4AF6A 4TKUB 3JQGB 3LHSA 5FQOA 1ENOA 4EG1A 3KLMX 3DBOB 1YA8A 1YJQA 3AUJB 1C2TA 1XZDA 4P38A 3WO0A 4P4LA 2VYNA 3JXEA 3WJAA 4ZTZB 3RSLA 1BN6A 5CB8A 1JV2B 2IBMA 4M21A 4MPTA 3I11A 5CD1A 3TBHA 1KE1A 3AOGA 4IINA 4CKEB 1ACLA 1H85A 4INZA 1MJNA 2MMCA 4RM3A 4ZN6A 1KMHA 2AFIE 3TUJC 1U2DA 1CB0A 2HRCA 3CEPB 5TVGA 3TXYA 1R6BX 4PRZA 4EHFA 3JD3A 5BT8A 3E3LA 4DCUA 3JQ8A 4GXQA 2C7PA 5CDTA 4P54A 1E66A 4GMDA 1EVEA 4ITRC 3SZGA 2W6JD 4QSMA 2IXBA 3AJRA 5IFLA 3ZDBA 1NAHA 1VG8A 4IQ8A 4CM6A 1IBSA 2Z0MA 5EJ8A 1ST2A 2ZP1A 1G8HA 3FMFA 4LTMA 1EXMA 4GDFA 2AWNA 3B1VA 1JJEA 3LCJA 3OZRA 3HZRA 2CUKA 5M29A 1R4MB 1E1CB 4B6JA 3FTEA 3OKCA 4Y2XA 2HB6A 4DMMA 1H5NA 1UPUA 1ZUD1 3EXFA 4H7JA 2OXRA 4PSKA 2X1VA 4CFSA 4CM9D 1W4LA 2FPMA 2HWUA 1BWPA 3UMBA 1R3DA 4F9EA 2M2IA 2NYUA 1YQQA 2OR3A 3K4QA 5I7AA 1WXGA 4OG2A 5AOBA 4C2TA 1GYRA 2XKKA 2HPAA 2XE6A 4IEEA 1YS9A 3SAJA 3FMGA 3TLEA 4DWOA 1ADGA 4TV9B 5BMOA 1TO6A 2J59A 4HZIA 3ADBA 1SY7A 2JATA 3BX1A 3LQKA 4DA4A 1CJMA 2FX5A 2F43B 3UV3A 4N4AA 3V3KA 3AV0B 1DCFA 3TPCA 4E3WA 4F45A 3SZ3A 2FHSA 4EITA 4OHXA 4WWHA 1XTRA 4XIJA 2HRBA 5IEJA 3RC8A 3U6BA 1YQUA 2EQ5A 3NOQA 5I7UA 4GG1A 3K92A 3ANSA 5LOVB 3E3MA 2A58A 4FFOA 1H4QA 1YS6A 1T4DA 2AMVA 2NUPB 1BN7A 2R44A 2BWJA 2Z5LA 4DT1B 3VJKA 3WWEA 1L7DA 1ZS9A 1F3LA 3N0VA 4TYQA 3ZXIA 5BWCA 5H68A 2YQZA 3LC7O 3RV4A 5FBVB 4JOCA 2XVMA 3ANTA 5ADWA 3M1AA 1NPTO 4KUGA 4FDVA 3ZZTA 5DW3A 1XDWA 3H2SA 2YNMC 4HNHA 1K68A 5C1OA 4M7OA 1CY4A 5CBPA 1I6WA 2IP4A 3EUFA 3LVFO 3CG0A 4ZKDA 1U1CA 4RV9A 3JR7A 3PPVA 2NZYA 5F52A 5SY4A 4JXXA 4HNGA 5DRYA 4F8EA 2JAWA 4TLCA 4AIIA 1NWCA 1IXRC 3RVJA 5E0OA 4BXOA 2PUTA 3UWSA 3GZ4A 1SG6A 1CE8B 3COZA 4A1OA 5B7NA 2YC4C 5ECDA 4H59A 1D5WA 3KUCA 2IEZA 1V5GA 1BXRA 2ID9A 1A95A 3VR4A 1O96A 2GPWA 2QNRA 1A8HA 5B6JA 2Q1UA 4B45A 1XVVA 4PVDA 1C7EA 2GS9A 4D43A 5IBRA 2CBZA 1NXWA 4QOJA 4CVNA 4ZI7F 1YKFA 1M1NB 1YBHA 3BTVA 1MAVA 3ELWA 4JUCA 4JGBA 4N3BA 5BSMA 3DBRB 4KBFA 3WTCA 4UFPA 4AMVA 2Q49A 1ECLA 1GG2A 4AW9A 3UQZA 5LQSA 1ZLXA 3FB1A 3UOGA 3UPUA 2PS0A 4M9RA 1BFUA 1A8SA 2P3SA 5AXOA 4KC0A 2OVFA 4IHKA 1QLJA 1QAQA 3TEFA 4FFBA 4R31A 5HVNA 3M4NA 5DE3A 1PL0A 1JKIA 2PX4A 4NCBA 3WL4A 2H4ZA 3KTDA 3O3OB 3TVTA 4AUKA 4ZYZA 3KP1A 3WHKA 4A03A 5JNTA 1TTPB 1C14A 1LVHA 3LQRA 1MC1A 1IEWA 2OO3A 3QFSA 4UU0A 3BWVA 1WUPA 3CY6A 4CMCA 5YASA 1LTQA 4MTLA 2O7SA 1BXZA 2EQBA 2NADA 3P4UA 4I99A 3MSCA 2BISA 1JR3E 4X3PA 1LA2A 4J8PA 4R3WA 1CP2A 4MGEA 1OUMA 2Z3ZA 1QJCA 1RYMA 1VFNA 4U0JA 3IP8A 1WSBA 1O03A 4ETMA 2KW5A 3LECA 4L6AA 2I55A 3GZTB 3MTIA 3VR6A 4A92A 3TCKA 1NW3A 1ISSA 2NU6B 2YN4A 1O77A 5FKJA 2H9YA 4UM8B 1ZH8A 1WCYA 2Y1LA 3G89A 5J9FA 4GM1A 1RBMA 2C04A 1GJRA 4LJ9A 1USUA 2CVZA 1QHSA 2QAIA 4M0PA 1JAYA 5ADUS 2HA5A 1YJXA 2JFVA 1FB5A 4FFRA 1SA0A 1R5OA 1EGHA 3TPFA 4AU1A 4N65A 3ZCSA 4Q7JB 4PO9A 3U1TA 2ASVA 1GP2A 3NTLA 4C1GA 1SH7A 4KN9S 1NVAA 4Y18A 2AOVA 1ORTA 1PR0A 4L8VA 5KMGB 1JFTA 4XJTA 1BVHA 4NHOA 1WQ4A 5JNRA 1Z22A 3STWA 1SUAA 3DXZA 1HC7A 2GGSA 4J43A 4N49A 4B2IA 4DC0A 3SK0A 3IERA 5JSFA 3KK0A 4Z8YA 3WX0A 1P2GA 3QV1A 5K4HA 1H2XA 1MNQA 1N6OA 1E89A 1ZCJA 1R88A 4DLUA 4HL6A 4ON9A 2OGWA 4Q7EA 4UUPA 5C4GB 1GZ6A 1W19A 4IJQA 3S2ZA 4NQZA 2WTBA 5TGTA 4IHJB 4EB6B 4IRXA 1Z3CA 2AB0A 1BE0A 1GR1A 2WU0A 3OCCA 3OQPA 4KXMA 1MEOA 4FGWA 1MAAA 1VI5A 2ZT5A 3G23A 3D1VA 4M6WB 3ZIAA 1DARA 5FBLB 3ZXXA 3AR5A 5HJEA 3HYNA 3DP7A 5DCWA 1MJHA 4J0GA 4PS1A 5IN5A 3O8OB 3FTCA 2XZTA 3ZY5A 3DD1A 1DBIA 5JQGB 2CW5A 2EERA 2OVBA 4B4DA 2XB9A 2J33A 4CMBA 4F6CA 4TSRA 2VYVA 3PGLA 1IPFA 5BV1A 5JAHA 1DBQA 4W5RA 3CSDA 1OKKA 4OQMA 2HIMA 1M8GA 2XNSA 2JIMA 2CSXA 4BCBA 1HDIA 3VPCA 1OOEA 1AV7A 4U00A 4RESA 2PKQP 4KYVA 4WZ6A 5TY0A 2J9YB 1MJ5A 1CRQA 2F00A 3AF3A 3QTLA 1NX9A 1WDMA 1IJEA 4LHVA 5AT1A 4BAGA 2M6RA 2GJAA 3DWEX 5JD6A 3FROA 1GXSA 4HX2A 2X2OA 3D02A 5CIWA 5FWXA 3WWZA 5JZOA 2JIBA 1W44A 1G2QA 2JGRA 3AVPA 1RSZA 1RS0A 2A9OA 3E35A 1XCOA 2V9PA 2JAUA 3I45A 4WN9A 3RWOA 2VHVA 4C21A 1P3JA 3MB5A 2Y87A 3M34A 3RRNA 1WPQA 2YJ5A 2AV6A 1SKAA 3OX2A 2BF4A 4D45A 1P7VA 2VH2A 3BEDA 3K35A 4FSBA 2IY9A 2VTKA 2X4IA 3LPDA 4KEAA 4AF8A 2IEAA 4LDJA 4Y2RA 4HPWA 2FG5A 2JEOA 2V1UA 1KGSA 1XZBA 5AFSA 4NQ5A 2OB1A 2G83A 1DTWB 3RKSA 1ZM3A 1C3XA 1JSLA 2PLAA 3L6NA 3FMPB 4N0MA 3HYSA 2I67A 5K6AC 4BFWA 4BNXA 1T36B 1XR3A 4D9BA 2QVZX 3Q85A 5LBTA 2I80A 1HM5A 2PZEA 2N1BA 3A3KA 4LF5B 3FDJA 4QT0A 1NQXA 1CEYA 2D06A 3SD7A 2IUEA 3KO8A 1G9SA 4KNWA 2E4XA 5KTTA 4JLOA 3SJCA 4G1VA 1VLZA 4K6CA 3RRFA 2I1LA 2ZR8A 2NV2B 2V9ZA 3KHUA 2E4WA 4NU5A 3WKBA 1WXQA 3D4IA 1RVV1 1TEHA 4KJXA 2JLYA 2ID8A 4L4RA 2ZK7A 1C3VA 4EYGA 1NUSA 2PQ2A 3KOUA 1NBOA 2X6TA 1UQUA 4J1SA 2B8EA 4ZI7A 3GA5A 3DE7X 3I0ZA 3CUKA 4U5QA 2VT3A 4Y7DA 1CVRA 1JI0A 1LNZA 4UARA 2O50A 4G8DA 1XV5A 3IJPA 3UATA 1BGXT 5J4KA 3OF2A 4EVSA 2GN9A 3ZZ0A 3I64A 3AEYA 3MMZA 1KI2A 4JGIA 5CLIA 5EHIA 4EW2A 3RD5A 1N6RA 2ZUEA 4YHBA 3ZU5A 5DPXA 2O2ZA 1CUWA 2MR6A 3FXAA 1QYDA 4PG5A 2VRNA 2WIKA 4YJ3A 4QXQA 5CAEB 5EWJB 1FYFA 1XHLA 4DTCA 2AZXA 1W1IA 4YXFA 2ZREA 4RELA 4ABYA 2RB5A 3ZY6A 2E4AA 5GIOE 4WY5A 3TI7A 4BO2A 1G21B 5HIQA 5AM4A 3TOXA 4TLBA 3MGCA 4IIUA 1XAGA 4YN3A 3Q9NA 3UUEA 1FIUA 4YO8A 2RJOA 4JKIA 3SHFA 3PDIB 5FFNA 3FOEC 1YMVA 2X41A 3M83A 4ZV7A 4PTLA 2G7MC 4MW2A 2OXTA 3EMVA 4D4HA 2JFWA 2FFJA 4LDAA 4Q4AB 5IFKA 2QE7D 1MGOA 3RSQA 1ZIDA 1MC4A 2WSBA 3EJWA 1KEKA 4NEGA 4PRLA 3HP4A 2J5KA 3TCXB 2CYBA 1KJQA 1PV2A 3DULA 5EXSA 1EBUA 1KNQA 1VHTA 2V58A 3HI6A 4MUAA 1N2BA 4RSMA 1UKBA 3UICA 4CLEA 1TZJA 1N2EA 1T35A 2R8EA 4Q12A 3A4MA 2P4EA 4QM6A 5FWDA 1N1DA 2ZRIA 3M5CA 1TD9A 1E9CA 2OCKA 4JQOA 4ZQCB 3R40A 1ZJYA 5A4DA 3PNMA 1U6KA 3TKAA 4M60A 2IU0A 5K4AA 1F0YA 4DMRA 5L6MB 1YB2A 2H9IA 4Q3EA 4KEQA 1KJ9A 3O1HB 1S1MA 4OJMX 3REQB 5FEMA 1E5TA 3VO9A 2NUAA 3LK7A 4C7JA 1CQIB 1U8YA 5LXTA 2B9VA 1XMQB 2CMKA 2W11A 5LLDA 1ZJ6A 2WLSA 1ULHA 4LFCB 1A82A 3RC3A 3K8OE 4RQUA 1UJ4A 4FONA 4PONA 3HUTA 3SEFA 3RTAA 1QV7A 4YXWD 3ZNOA 2FJ0A 4HDRB 2KS6A 2J6HA 4Q9AA 5BMVF 1OH8A 1KS2A 2WMDA 3VO8A 2PSFA 3L7LA 4TWIA 1THTA 4UPVA 3MPOA 3ORRA 5FO0A 1V9LA 2H1SA 1FDTA 2PRSA 1FNNA 2FSPA 2W2QA 3DJYA 4M3NA 3ZHYA 4Z7JA 5HRCA 3QPCA 1MVNA 1PKEA 2IEYA 2YMQA 4QAJA 5C1PA 1URPA 1D07A 2J30A 2R9VA 1KMMA 2QTAA 3H4TA 2WAMA 4GXRA 4H7EA 4WUTA 3TFOA 1VBFA 2HJVA 3A1VA 4LV8B 1EBBA 2GEDA 2QTNA 3PZBA 2JVKA 1YOVB 5JSUA 4U6SA 5JSQA 1KI4A 2JLZA 4LS3A 5F7XA 1FNMA 3ZV4A 2X8BA 3H8VA 1VGRA 1BC5A 2H2GA 3CH5A 3MZ0A 4MAMA 4XXHA 2QLFA 4CDGA 4YT2A 1T6YA 5AVSA 1MW8X 4IMPA 4EGFA 4ZEVA 3TWOA 1FP7A 1Y3CE 2OQRA 3K09A 3U60B 4NTZA 3UAWA 4E51A 3ZGVA 3TG8A 1L1QA 2JAXA 3FOBA 1JTEA 3WISA 3NEPX 2VSYA 4Z7QB 4TZ6A 1CR1A 1FSFA 4C3ZA 3LBHA 3CW8X 2QGFA 4UPEA 4MW9A 3BXXA 4TVBA 1FDRA 1V5IA 3CEHA 3HKBA 4GL4A 4OYHA 3JVEA 1CUFA 2LV8A 3RT7A 1W94A 1Q12A 2BMAA 3G8AA 3EIUA 3FPCA 4IFIA 4NBTA 3RIGA 4LQLA 5H3CA 2Y99A 1Q6YA 4Q9IA 1OX4B 3N2GB 4UQPA 5AVTA 4BJ5A 1UPCA 4GNKA 2JAPA 5EUQB 3IJRA 1WB6A 3LT4A 5FPQA 3Q0EA 4ND1A 3NM4A 4G37A 2ZAOA 2ZBRA 4G8BA 1HZZA 1VIVA 3O4FA 2WKRA 2FP3A 3SX0A 1YQ9A 2JZCA 3FCCA 4QWWA 5TB5A 1BVRA 2Q3FA 4GLOA 1XMJA 3ZWWA 2REQA 1L7QA 1KR2A 2IP2A 3KLOA 3NATA 4M0UA 4EK9A 2FKNA 4TSFD 4LI3X 1VJNA 2WYLA 4FWBA 4TWZA 3I9MA 4JI7B 1XNQB 2BG8B 3D1JA 3HB4X 2EFYA 5COBA 3IMGA 1KAEA 5ALSA 1CDZA 4DTIA 4NSNA 1KEZA 3PIRA 5K3FA 3WJ7A 1JSRA 2O3UA 2XV1A 5LC1A 1GDTA 1RJ9A 3O1JC 1G8PA 2EJTA 3PPYA 1ZJWA 2F48A 2HWWA 2BD0A 3E81A 2JEYA 1TUBB 1J90A 2VG8A 3D31A 2YTZA 3DZKA 4I0WB 2DX7A 2GLUA 1POXA 3X1MA 4H17A 1DO0A 1SULA 1HE5A 2O2GA 4UU7A 4IUYA 3T5BA 1I3NA 3E8SA 2AE1A 4EH1A 4FU0A 1PZMA 1GVNB 4TPKA 4L9RA 2KE5A 4NVRA 4D9GA 1I36A 2WHQA 2WU8A 1F0KA 1HA3A 2VK8A 3UPTA 2IYFA 2YWJA 2CNLA 2Q2NA 3FDXA 1WKCA 1OBFO 3H2KA 3P0HA 4YV0A 1GU0A 3HU5A 1BVUA 1A9OA 2YKGA 2R00C 3EUWA 4MW4A 1CFJA 4PPQA 3KJNA 1LZLA 4LBYA 1PUXA 4C1CA 4G26A 1YAHA 2O0MA 1KI7A 2P9EA 2QNBA 3GDFA 3CGGA 3RAJA 4FM9A 3T3OA 4Z9AA 5CDHA 3HDYA 5DWVA 2X0EA 1JJAA 4IDAA 3GZNB 1LDBA 3X43A 2KYRA 4RHYA 4JJ7A 2EZUA 4OXRA 1QS0B 3Q3IA 3DNMA 4N03A 1Q74A 4RLSA 4V0MA 4CXMA 2PL1A 3I5XA 4BZPA 1CRWG 5A5ZA 4J1NA 1IHYA 2B4TO 1UH5A 2IYZA 1TW3A 2CHUA 2CKDA 1ITZA 3AGQA 3IXMA 3MWJA 5LR6A 5M5BA 3VVBA 5H8WA 4B6GA 4BNNA 1DAKA 4BWVA 4M46A 2HT6A 3WGOA 1BEZA 3A9SA 4NBWA 1LV8A 1PVOA 3V8QA 3MINB 2V5UA 5A2GA 3JQFA 8ATCA 3WLOA 5C52B 1N0HA 4C0XA 1E2HA 2Q5JA 2XMZA 4PCAA 3NKLA 1ZONA 1LY1A 1XLVA 4XQCA 5EIHA 3VC3A 3Q8MA 4XLTA 1KP3A 2X42A 3GLQA 3OEHA 2O19A 1EFDN 2N42A 2O3TA 5D51S 4OHMA 4OXXA 3THXB 2F8SA 4J3FA 4H0DA 5I4CA 2V74B 1M2WA 1KI9A 2IYPA 4HFRA 4GYJA 3F3KA 2QQGA 4NI5A 5KYUB 3HQ4O 4KHPB 2G0AA 1R6TA 4IOKA 2P6UA 4KQ6A 3URMA 4BNJA 4Z4QA 1C0PA 1RPJA 4OYLA 4H1VA 3S0JA 1JKFA 1UC5B 2BC2A 5FBWB 1CLEA 1NKVA 2JB9A 2VYFA 4K9NA 4EA8A 5C46F 1PZXA 1OU4A 2BELA 3MBKA 3MK31 3R3HA 1UK9A 1JLMA 3GO4A 1NDHA 4PN7A 2GHQA 2UVDA 4ND7A 4D6PA 1YBAA 1L4NA 2GF9A 3A1WA 3AF4A 1KJZA 4NONA 4P58A 4PYQA 2BFAA 4RMIA 3WHLA 3NVMB 1I8TA 3ZXYA 1CU1A 1L5WA 1N75A 5DWQA 4DYHA 1XF1A 2FQ1A 1IZZA 1JU9A