2QEDA

Crystal structure of salmonella thyphimurium lt2 glyoxalase ii
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
252
structure length
252
Chain Sequence
SMNLNSIPAFQDNYIWVLTNDEGRCVIVDPGEAAPVLKAIAEHKWMPEAIFLTHHHHDHVGGVKELLQHFPQMTVYGPAETQDKGATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCYFSRPYLFCGDTLFSGGCGRLFEGTPSQMYQSLMKINSLPDDTLICCAHEYTLANIKFALSILPHDSFINEYYRKVKELRVKKQMTLPVILKNERKINLFLRTEDIDLINEINKETILQQPEARFAWLRSKKDTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Hydroxyacylglutathione hydrolase
publication title Biochemical and Structural Characterization of Salmonella typhimurium Glyoxalase II: New Insights into Metal Ion Selectivity
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 90
structure length 252
sequence length 252
ec nomenclature ec 3.1.2.6: Hydroxyacylglutathione hydrolase.
pdb deposition date 2007-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF16123 HAGH_C Hydroxyacylglutathione hydrolase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2qedA00
4Z5YA 2BFZA 2BC2A 4ZEJA 2AZ4A 5LCHA 1JJEA 2E7YA 4FSBA 4EYLA 3RPCA 4F6ZA 3MD7A 2I7XA 5LCAA 4EY2A 4RM5A 2NZEA 2FU7A 2Q42A 3AF5A 2QJSA 3IEMA 2YNVA 3DH8A 3SBLA 5A87A 3X2XA 4WD6A 3ESHA 4U4LA 1BMCA 2GMNA 5EW0A 1ZTCA 3H3EA 2P4ZA 2FM6A 2UYXA 1WRAA 4H0DA 4EXSA 4D1TA 4BP0A 3PY5A 3AF6A 5EV6A 3IE2A 2A7MA 2VW8A 2YCBA 4UWPB 4AX0B 2ZWRA 2P97A 2XR1A 4HL2A 2BFKA 2M5CA 2Y8BA 2BG7A 2BFZB 5FQCA 4AD9A 4UWOB 1K07A 5KIKA 2ZZIA 4AX1B 3SPUA 4CHLA 4V0HA 5FQAA 1A8TA 1KR3A 3Q6VA 2FHXA 3X30A 2WRSA 1A7TA 4AWYB 5AEBA 4Z5ZA 4NQ2A 1Y44A 4TZEA 4AWZA 3IE0A 4D1VA 2YNVB 3IDZA 3ZQ4A 2DKFA 3RKKA 3T9MA 5HIPA 2FK6A 3IEKA 5AHOA 5EVBA 4TZFA 4P62A 4ZO2A 2Y87A 3IOFA 5EH9A 4J5FA 2GKLA 2FU9A 4XUKA 3ZWFA 2GFJA 3I15A 4TYTA 3P2UA 3AJ3A 2BFLA 2H6AA 2OHJA 5AXRA 4TZ9A 5ACXA 1YCHA 4RAMA 4ZO3A 5ACRA 4HKYA 4Z7RA 3JXPA 2DOOA 4C1DA 1ZNBA 4DILA 2QEDA 2M5DA 1L9YA 1YCFA 2P18A 2BG2A 3T3NA 3IE1A 4LE6A 5LE1A 2P1EA 5K4KA 2GCUA 3DHBA 2BG6A 3RKJA 4RBSA 5A5ZA 2R2DA 4KEPA 3SD9A 4YSKA 2Q0IA 2FHXB 3BC2A 2NZFA 5EWAA 1JJTA 2Q9UA 5AYAA 3G1PA 3R2UA 2AIOA 5ACQA 4XWWA 2XF4A 1QH5A 2QDTA 4B87A 5HISA 2WHGA 5HH4A 5K0WA 3KNSA 2GFKA 2WYMC 5DPXA 1HLKA 5B1UA 3IELA 4RAWA 3ZNBA 5ACVA 3BK2A 5A0VA 3IOGA 5AHRA 4EYFA 1X8HA 3I13A 5ACSA 1WUPA 4GYQA 3S0ZA 2BIBA 4D02A 1X8GA 5LS3A 1DXKA 3WXCA 5EHTA 1MQOA 4C1FA 4GYUA 1ZKPA 3ADRA 5LMCA 4PVTA 4RL0A 4JO0A 2OHHA 4EXYA 2OHIA 2QINA 1KO3A 2BG8A 4EYBA 5ACPA 1DD6A 3QH8A 1QH3A 3SRXA 1X8IA 4O98A 1DDKA 5HH5A 3L6NA 5IQKA 5HH6A 2BTNA 1WW1A 2FU6A 5ACTA 1VGNA 2CBNA 4Z67A 4C1CA 2YNUA 5EV8A 3VQZA 3FAIA 4BZ3A 3I14A 4TZBA 4YSLA 3A4YA 2YNWA 2NYPA 4C1HA 2ZNBA 5AXOA 3KNRA 2BGAA 4UAMA 4Z6XA 2Y8AA 4HL1A 3KL7A 5EVDA 4NQ5A 4PVOA 5K4MA 5LLDA 3LVZA 5LSCA 1XTOA 3DHCA 2YNTA 1KO2A 4XWTA 4Z60A 3SFPA 3VPEA 4RL2A 5FQBA 3I0VA 2FU8A 2ZO4A 1E5DA 5LM6A 2BG8B 5A0TA 2QDSA 2HB9A 1BC2A 4UWSB 5KILA 1XM8A 1YCGA 3PG4A 5ACUA 4UWRB 4C1GA 2I7TA 3T3OA 3BK1A 3ZR9A 2Q0JA 5LCFA 1P9EA 4NQ4A 4UA4A 2WYMA 3SW3A 2I7VA 1VMEA 4DIKA 4F6HA 1SMLA 5ACWA 4UBQA 4GCWA 2BR6A 4C09A 3I11A 3BV6A 3PY6A 5B15A 2WYLA 4D1UA 4J5HA 1M2XA 2YZ3A 3FCZA 4FR7A 5EVKA 2YNTB 3X2ZA 4KEQA 4ZNBA 5HIQA 3F9OA 4FEKA 4EFZA 4C1EA 3TP9A 2NXAA 4YSBA 1WUOA 1BVTA 4NQ6A 1JT1A 1VJNA 5B3RA 3DHAA 2BMIA 3X2YA 5HIOA 4TYFA 4D1WA 5K4NA
chains in the Genus database with same CATH superfamily
4Z5YA 2BFZA 2BC2A 4ZEJA 2AZ4A 5LCHA 1JJEA 2E7YA 4FSBA 4EYLA 3RPCA 4F6ZA 3MD7A 2I7XA 5LCAA 4EY2A 4RM5A 2NZEA 2FU7A 2Q42A 3AF5A 2QJSA 3IEMA 2YNVA 3DH8A 3SBLA 5A87A 3X2XA 2CG2A 4WD6A 3ESHA 4U4LA 1BMCA 2GMNA 5EW0A 1ZTCA 3H3EA 2P4ZA 2FM6A 2UYXA 1WRAA 4H0DA 4EXSA 4D1TA 4BP0A 3PY5A 3AF6A 5EV6A 3IE2A 2A7MA 2VW8A 2YCBA 4UWPB 4AX0B 2ZWRA 2P97A 2XR1A 4HL2A 2BFKA 2M5CA 2Y8BA 2BG7A 2BFZB 5FQCA 4AD9A 4UWOB 1K07A 5KIKA 2ZZIA 4AX1B 3SPUA 4CHLA 4V0HA 5FQAA 1A8TA 1KR3A 3Q6VA 2FHXA 3X30A 2WRSA 1A7TA 4AWYB 5AEBA 4Z5ZA 4NQ2A 1Y44A 4TZEA 4AWZA 3IE0A 4D1VA 2YNVB 3IDZA 3ZQ4A 2CG3A 2DKFA 3RKKA 3T9MA 5HIPA 2FK6A 3IEKA 5AHOA 5EVBA 4TZFA 4P62A 2CFUA 4ZO2A 2Y87A 3IOFA 4NURA 5EH9A 4J5FA 2GKLA 2FU9A 4XUKA 3ZWFA 2GFJA 5AIJA 3I15A 2YHEA 4TYTA 3P2UA 3AJ3A 2BFLA 2H6AA 2OHJA 5AXRA 4TZ9A 5ACXA 1YCHA 4RAMA 4ZO3A 5ACRA 4HKYA 4Z7RA 3JXPA 2DOOA 4C1DA 1ZNBA 4DILA 2QEDA 2M5DA 1L9YA 1YCFA 2P18A 2BG2A 3T3NA 3IE1A 4LE6A 5LE1A 2P1EA 5K4KA 2GCUA 3DHBA 2BG6A 3RKJA 4RBSA 5A5ZA 2R2DA 4KEPA 3SD9A 4YSKA 2Q0IA 2FHXB 3BC2A 2NZFA 5EWAA 1JJTA 2Q9UA 5AYAA 3G1PA 3R2UA 2AIOA 5ACQA 4XWWA 2XF4A 1QH5A 2QDTA 4AV7A 4B87A 5HISA 2WHGA 5HH4A 5K0WA 3KNSA 2GFKA 2WYMC 5DPXA 1HLKA 4PDXA 5B1UA 3IELA 4RAWA 3ZNBA 5ACVA 3BK2A 5A0VA 3IOGA 5AHRA 4EYFA 1X8HA 3I13A 5ACSA 1WUPA 4GYQA 3S0ZA 2BIBA 4D02A 1X8GA 5LS3A 1DXKA 3WXCA 5EHTA 1MQOA 4C1FA 4GYUA 1ZKPA 3ADRA 5LMCA 4PVTA 4RL0A 4JO0A 2OHHA 4EXYA 2OHIA 2QINA 1KO3A 2BG8A 4EYBA 5ACPA 1DD6A 3QH8A 1QH3A 3SRXA 1X8IA 4O98A 1DDKA 5HH5A 3L6NA 5IQKA 5HH6A 2BTNA 1WW1A 2FU6A 5ACTA 1VGNA 2CBNA 4Z67A 4C1CA 2YNUA 5EV8A 3VQZA 3FAIA 4BZ3A 3I14A 4AXHA 4TZBA 4YSLA 3A4YA 2YNWA 2NYPA 4C1HA 2ZNBA 5AXOA 3KNRA 2BGAA 4UAMA 4Z6XA 2Y8AA 4HL1A 3KL7A 5EVDA 4NQ5A 4PVOA 5K4MA 5LLDA 3LVZA 5LSCA 1XTOA 3DHCA 2YNTA 1KO2A 4XWTA 4Z60A 3SFPA 3VPEA 4RL2A 5FQBA 5A23A 3I0VA 2FU8A 2ZO4A 1E5DA 5LM6A 2BG8B 5A0TA 2QDSA 2HB9A 1BC2A 4UWSB 5KILA 1XM8A 1YCGA 3PG4A 5ACUA 4UWRB 4C1GA 2I7TA 3T3OA 3BK1A 3ZR9A 2Q0JA 5LCFA 1P9EA 4NQ4A 4UA4A 2WYMA 3SW3A 2I7VA 2CFZA 1VMEA 4DIKA 4F6HA 1SMLA 5ACWA 4UBQA 4GCWA 2BR6A 4C09A 3I11A 3BV6A 3PY6A 5B15A 2WYLA 4D1UA 4J5HA 1M2XA 2YZ3A 3FCZA 4FR7A 5EVKA 2YNTB 3X2ZA 4KEQA 4ZNBA 5HIQA 3F9OA 4FEKA 4EFZA 4C1EA 3TP9A 2NXAA 4YSBA 1WUOA 1BVTA 4NQ6A 1JT1A 1VJNA 5B3RA 3DHAA 2BMIA 3X2YA 5HIOA 4TYFA 5AJLA 4D1WA 5K4NA
chains in the Genus database with same CATH topology
4Z5YA 2BFZA 2BC2A 4ZEJA 2AZ4A 5LCHA 1JJEA 2E7YA 4FSBA 4EYLA 3RPCA 4F6ZA 3MD7A 2I7XA 5LCAA 4EY2A 4RM5A 2NZEA 2FU7A 2Q42A 3AF5A 2QJSA 3IEMA 2YNVA 3DH8A 3SBLA 5A87A 3X2XA 4WD6A 3ESHA 4U4LA 1BMCA 2GMNA 5EW0A 1ZTCA 3H3EA 2P4ZA 2FM6A 2UYXA 1WRAA 4H0DA 4EXSA 4D1TA 4BP0A 3PY5A 3AF6A 5EV6A 3IE2A 2A7MA 2VW8A 2YCBA 4UWPB 4AX0B 2ZWRA 2P97A 2XR1A 4HL2A 2BFKA 2M5CA 2Y8BA 2BG7A 2BFZB 5FQCA 4AD9A 4UWOB 1K07A 5KIKA 2ZZIA 4AX1B 3SPUA 4CHLA 4V0HA 5FQAA 1A8TA 1KR3A 3Q6VA 2FHXA 3X30A 2WRSA 1A7TA 4AWYB 5AEBA 4Z5ZA 4NQ2A 1Y44A 4TZEA 4AWZA 3IE0A 4D1VA 2YNVB 3IDZA 3ZQ4A 2DKFA 3RKKA 3T9MA 5HIPA 2FK6A 3IEKA 5AHOA 5EVBA 4TZFA 4P62A 4ZO2A 2Y87A 3IOFA 5EH9A 4J5FA 2GKLA 2FU9A 4XUKA 3ZWFA 2GFJA 3I15A 4TYTA 3P2UA 3AJ3A 2BFLA 2H6AA 2OHJA 5AXRA 4TZ9A 5ACXA 1YCHA 4RAMA 4ZO3A 5ACRA 4HKYA 4Z7RA 3JXPA 2DOOA 4C1DA 1ZNBA 4DILA 2QEDA 2M5DA 1L9YA 1YCFA 2P18A 2BG2A 3T3NA 3IE1A 4LE6A 5LE1A 2P1EA 5K4KA 2GCUA 3DHBA 2BG6A 3RKJA 4RBSA 5A5ZA 2R2DA 4KEPA 3SD9A 4YSKA 2Q0IA 2FHXB 3BC2A 2NZFA 5EWAA 1JJTA 2Q9UA 5AYAA 3G1PA 3R2UA 2AIOA 5ACQA 4XWWA 2XF4A 1QH5A 2QDTA 4B87A 5HISA 2WHGA 5HH4A 5K0WA 3KNSA 2GFKA 2WYMC 5DPXA 1HLKA 5B1UA 3IELA 4RAWA 3ZNBA 5ACVA 3BK2A 5A0VA 3IOGA 5AHRA 4EYFA 1X8HA 3I13A 5ACSA 1WUPA 4GYQA 3S0ZA 2BIBA 4D02A 1X8GA 5LS3A 1DXKA 3WXCA 5EHTA 1MQOA 4C1FA 4GYUA 1ZKPA 3ADRA 5LMCA 4PVTA 4RL0A 4JO0A 2OHHA 4EXYA 2OHIA 2QINA 1KO3A 2BG8A 4EYBA 5ACPA 1DD6A 3QH8A 1QH3A 3SRXA 1X8IA 4O98A 1DDKA 5HH5A 3L6NA 5IQKA 5HH6A 2BTNA 1WW1A 2FU6A 5ACTA 1VGNA 2CBNA 4Z67A 4C1CA 2YNUA 5EV8A 3VQZA 3FAIA 4BZ3A 3I14A 4TZBA 4YSLA 3A4YA 2YNWA 2NYPA 4C1HA 2ZNBA 5AXOA 3KNRA 2BGAA 4UAMA 4Z6XA 2Y8AA 4HL1A 3KL7A 5EVDA 4NQ5A 4PVOA 5K4MA 5LLDA 3LVZA 5LSCA 1XTOA 3DHCA 2YNTA 1KO2A 4XWTA 4Z60A 3SFPA 3VPEA 4RL2A 5FQBA 3I0VA 2FU8A 2ZO4A 1E5DA 5LM6A 2BG8B 5A0TA 2QDSA 2HB9A 1BC2A 4UWSB 5KILA 1XM8A 1YCGA 3PG4A 5ACUA 4UWRB 4C1GA 2I7TA 3T3OA 3BK1A 3ZR9A 2Q0JA 5LCFA 1P9EA 4NQ4A 4UA4A 2WYMA 3SW3A 2I7VA 1VMEA 4DIKA 4F6HA 1SMLA 5ACWA 4UBQA 4GCWA 2BR6A 4C09A 3I11A 3BV6A 3PY6A 5B15A 2WYLA 4D1UA 4J5HA 1M2XA 2YZ3A 3FCZA 4FR7A 5EVKA 2YNTB 3X2ZA 4KEQA 4ZNBA 5HIQA 3F9OA 4FEKA 4EFZA 4C1EA 3TP9A 2NXAA 4YSBA 1WUOA 1BVTA 4NQ6A 1JT1A 1VJNA 5B3RA 3DHAA 2BMIA 3X2YA 5HIOA 4TYFA 4D1WA 5K4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z5Y A;  2BFZ A;  2BC2 A;  4ZEJ A;  2AZ4 A;  5LCH A;  1JJE A;  2E7Y A;  4FSB A;  4EYL A;  3RPC A;  4F6Z A;  3MD7 A;  2I7X A;  5LCA A;  4EY2 A;  4RM5 A;  2NZE A;  2FU7 A;  2Q42 A;  3AF5 A;  2QJS A;  3IEM A;  2YNV A;  3DH8 A;  3SBL A;  5A87 A;  3X2X A;  4WD6 A;  3ESH A;  4U4L A;  1BMC A;  2GMN A;  5EW0 A;  1ZTC A;  3H3E A;  2P4Z A;  2FM6 A;  2UYX A;  1WRA A;  4H0D A;  4EXS A;  4D1T A;  4BP0 A;  3PY5 A;  3AF6 A;  5EV6 A;  3IE2 A;  2A7M A;  2VW8 A;  2YCB A;  4UWP B;  4AX0 B;  2ZWR A;  2P97 A;  2XR1 A;  4HL2 A;  2BFK A;  2M5C A;  2Y8B A;  2BG7 A;  2BFZ B;  5FQC A;  4AD9 A;  4UWO B;  1K07 A;  5KIK A;  2ZZI A;  4AX1 B;  3SPU A;  4CHL A;  4V0H A;  5FQA A;  1A8T A;  1KR3 A;  3Q6V A;  2FHX A;  3X30 A;  2WRS A;  1A7T A;  4AWY B;  5AEB A;  4Z5Z A;  4NQ2 A;  1Y44 A;  4TZE A;  4AWZ A;  3IE0 A;  4D1V A;  2YNV B;  3IDZ A;  3ZQ4 A;  2DKF A;  3RKK A;  3T9M A;  5HIP A;  2FK6 A;  3IEK A;  5AHO A;  5EVB A;  4TZF A;  4P62 A;  4ZO2 A;  2Y87 A;  3IOF A;  5EH9 A;  4J5F A;  2GKL A;  2FU9 A;  4XUK A;  3ZWF A;  2GFJ A;  3I15 A;  4TYT A;  3P2U A;  3AJ3 A;  2BFL A;  2H6A A;  2OHJ A;  5AXR A;  4TZ9 A;  5ACX A;  1YCH A;  4RAM A;  4ZO3 A;  5ACR A;  4HKY A;  4Z7R A;  3JXP A;  2DOO A;  4C1D A;  1ZNB A;  4DIL A;  2QED A;  2M5D A;  1L9Y A;  1YCF A;  2P18 A;  2BG2 A;  3T3N A;  3IE1 A;  4LE6 A;  5LE1 A;  2P1E A;  5K4K A;  2GCU A;  3DHB A;  2BG6 A;  3RKJ A;  4RBS A;  5A5Z A;  2R2D A;  4KEP A;  3SD9 A;  4YSK A;  2Q0I A;  2FHX B;  3BC2 A;  2NZF A;  5EWA A;  1JJT A;  2Q9U A;  5AYA A;  3G1P A;  3R2U A;  2AIO A;  5ACQ A;  4XWW A;  2XF4 A;  1QH5 A;  2QDT A;  4B87 A;  5HIS A;  2WHG A;  5HH4 A;  5K0W A;  3KNS A;  2GFK A;  2WYM C;  5DPX A;  1HLK A;  5B1U A;  3IEL A;  4RAW A;  3ZNB A;  5ACV A;  3BK2 A;  5A0V A;  3IOG A;  5AHR A;  4EYF A;  1X8H A;  3I13 A;  5ACS A;  1WUP A;  4GYQ A;  3S0Z A;  2BIB A;  4D02 A;  1X8G A;  5LS3 A;  1DXK A;  3WXC A;  5EHT A;  1MQO A;  4C1F A;  4GYU A;  1ZKP A;  3ADR A;  5LMC A;  4PVT A;  4RL0 A;  4JO0 A;  2OHH A;  4EXY A;  2OHI A;  2QIN A;  1KO3 A;  2BG8 A;  4EYB A;  5ACP A;  1DD6 A;  3QH8 A;  1QH3 A;  3SRX A;  1X8I A;  4O98 A;  1DDK A;  5HH5 A;  3L6N A;  5IQK A;  5HH6 A;  2BTN A;  1WW1 A;  2FU6 A;  5ACT A;  1VGN A;  2CBN A;  4Z67 A;  4C1C A;  2YNU A;  5EV8 A;  3VQZ A;  3FAI A;  4BZ3 A;  3I14 A;  4TZB A;  4YSL A;  3A4Y A;  2YNW A;  2NYP A;  4C1H A;  2ZNB A;  5AXO A;  3KNR A;  2BGA A;  4UAM A;  4Z6X A;  2Y8A A;  4HL1 A;  3KL7 A;  5EVD A;  4NQ5 A;  4PVO A;  5K4M A;  5LLD A;  3LVZ A;  5LSC A;  1XTO A;  3DHC A;  2YNT A;  1KO2 A;  4XWT A;  4Z60 A;  3SFP A;  3VPE A;  4RL2 A;  5FQB A;  3I0V A;  2FU8 A;  2ZO4 A;  1E5D A;  5LM6 A;  2BG8 B;  5A0T A;  2QDS A;  2HB9 A;  1BC2 A;  4UWS B;  5KIL A;  1XM8 A;  1YCG A;  3PG4 A;  5ACU A;  4UWR B;  4C1G A;  2I7T A;  3T3O A;  3BK1 A;  3ZR9 A;  2Q0J A;  5LCF A;  1P9E A;  4NQ4 A;  4UA4 A;  2WYM A;  3SW3 A;  2I7V A;  1VME A;  4DIK A;  4F6H A;  1SML A;  5ACW A;  4UBQ A;  4GCW A;  2BR6 A;  4C09 A;  3I11 A;  3BV6 A;  3PY6 A;  5B15 A;  2WYL A;  4D1U A;  4J5H A;  1M2X A;  2YZ3 A;  3FCZ A;  4FR7 A;  5EVK A;  2YNT B;  3X2Z A;  4KEQ A;  4ZNB A;  5HIQ A;  3F9O A;  4FEK A;  4EFZ A;  4C1E A;  3TP9 A;  2NXA A;  4YSB A;  1WUO A;  1BVT A;  4NQ6 A;  1JT1 A;  1VJN A;  5B3R A;  3DHA A;  2BMI A;  3X2Y A;  5HIO A;  4TYF A;  4D1W A;  5K4N A; 
#chains in the Genus database with same CATH topology
 4Z5Y A;  2BFZ A;  2BC2 A;  4ZEJ A;  2AZ4 A;  5LCH A;  1JJE A;  2E7Y A;  4FSB A;  4EYL A;  3RPC A;  4F6Z A;  3MD7 A;  2I7X A;  5LCA A;  4EY2 A;  4RM5 A;  2NZE A;  2FU7 A;  2Q42 A;  3AF5 A;  2QJS A;  3IEM A;  2YNV A;  3DH8 A;  3SBL A;  5A87 A;  3X2X A;  2CG2 A;  4WD6 A;  3ESH A;  4U4L A;  1BMC A;  2GMN A;  5EW0 A;  1ZTC A;  3H3E A;  2P4Z A;  2FM6 A;  2UYX A;  1WRA A;  4H0D A;  4EXS A;  4D1T A;  4BP0 A;  3PY5 A;  3AF6 A;  5EV6 A;  3IE2 A;  2A7M A;  2VW8 A;  2YCB A;  4UWP B;  4AX0 B;  2ZWR A;  2P97 A;  2XR1 A;  4HL2 A;  2BFK A;  2M5C A;  2Y8B A;  2BG7 A;  2BFZ B;  5FQC A;  4AD9 A;  4UWO B;  1K07 A;  5KIK A;  2ZZI A;  4AX1 B;  3SPU A;  4CHL A;  4V0H A;  5FQA A;  1A8T A;  1KR3 A;  3Q6V A;  2FHX A;  3X30 A;  2WRS A;  1A7T A;  4AWY B;  5AEB A;  4Z5Z A;  4NQ2 A;  1Y44 A;  4TZE A;  4AWZ A;  3IE0 A;  4D1V A;  2YNV B;  3IDZ A;  3ZQ4 A;  2CG3 A;  2DKF A;  3RKK A;  3T9M A;  5HIP A;  2FK6 A;  3IEK A;  5AHO A;  5EVB A;  4TZF A;  4P62 A;  2CFU A;  4ZO2 A;  2Y87 A;  3IOF A;  4NUR A;  5EH9 A;  4J5F A;  2GKL A;  2FU9 A;  4XUK A;  3ZWF A;  2GFJ A;  5AIJ A;  3I15 A;  2YHE A;  4TYT A;  3P2U A;  3AJ3 A;  2BFL A;  2H6A A;  2OHJ A;  5AXR A;  4TZ9 A;  5ACX A;  1YCH A;  4RAM A;  4ZO3 A;  5ACR A;  4HKY A;  4Z7R A;  3JXP A;  2DOO A;  4C1D A;  1ZNB A;  4DIL A;  2QED A;  2M5D A;  1L9Y A;  1YCF A;  2P18 A;  2BG2 A;  3T3N A;  3IE1 A;  4LE6 A;  5LE1 A;  2P1E A;  5K4K A;  2GCU A;  3DHB A;  2BG6 A;  3RKJ A;  4RBS A;  5A5Z A;  2R2D A;  4KEP A;  3SD9 A;  4YSK A;  2Q0I A;  2FHX B;  3BC2 A;  2NZF A;  5EWA A;  1JJT A;  2Q9U A;  5AYA A;  3G1P A;  3R2U A;  2AIO A;  5ACQ A;  4XWW A;  2XF4 A;  1QH5 A;  2QDT A;  4AV7 A;  4B87 A;  5HIS A;  2WHG A;  5HH4 A;  5K0W A;  3KNS A;  2GFK A;  2WYM C;  5DPX A;  1HLK A;  4PDX A;  5B1U A;  3IEL A;  4RAW A;  3ZNB A;  5ACV A;  3BK2 A;  5A0V A;  3IOG A;  5AHR A;  4EYF A;  1X8H A;  3I13 A;  5ACS A;  1WUP A;  4GYQ A;  3S0Z A;  2BIB A;  4D02 A;  1X8G A;  5LS3 A;  1DXK A;  3WXC A;  5EHT A;  1MQO A;  4C1F A;  4GYU A;  1ZKP A;  3ADR A;  5LMC A;  4PVT A;  4RL0 A;  4JO0 A;  2OHH A;  4EXY A;  2OHI A;  2QIN A;  1KO3 A;  2BG8 A;  4EYB A;  5ACP A;  1DD6 A;  3QH8 A;  1QH3 A;  3SRX A;  1X8I A;  4O98 A;  1DDK A;  5HH5 A;  3L6N A;  5IQK A;  5HH6 A;  2BTN A;  1WW1 A;  2FU6 A;  5ACT A;  1VGN A;  2CBN A;  4Z67 A;  4C1C A;  2YNU A;  5EV8 A;  3VQZ A;  3FAI A;  4BZ3 A;  3I14 A;  4AXH A;  4TZB A;  4YSL A;  3A4Y A;  2YNW A;  2NYP A;  4C1H A;  2ZNB A;  5AXO A;  3KNR A;  2BGA A;  4UAM A;  4Z6X A;  2Y8A A;  4HL1 A;  3KL7 A;  5EVD A;  4NQ5 A;  4PVO A;  5K4M A;  5LLD A;  3LVZ A;  5LSC A;  1XTO A;  3DHC A;  2YNT A;  1KO2 A;  4XWT A;  4Z60 A;  3SFP A;  3VPE A;  4RL2 A;  5FQB A;  5A23 A;  3I0V A;  2FU8 A;  2ZO4 A;  1E5D A;  5LM6 A;  2BG8 B;  5A0T A;  2QDS A;  2HB9 A;  1BC2 A;  4UWS B;  5KIL A;  1XM8 A;  1YCG A;  3PG4 A;  5ACU A;  4UWR B;  4C1G A;  2I7T A;  3T3O A;  3BK1 A;  3ZR9 A;  2Q0J A;  5LCF A;  1P9E A;  4NQ4 A;  4UA4 A;  2WYM A;  3SW3 A;  2I7V A;  2CFZ A;  1VME A;  4DIK A;  4F6H A;  1SML A;  5ACW A;  4UBQ A;  4GCW A;  2BR6 A;  4C09 A;  3I11 A;  3BV6 A;  3PY6 A;  5B15 A;  2WYL A;  4D1U A;  4J5H A;  1M2X A;  2YZ3 A;  3FCZ A;  4FR7 A;  5EVK A;  2YNT B;  3X2Z A;  4KEQ A;  4ZNB A;  5HIQ A;  3F9O A;  4FEK A;  4EFZ A;  4C1E A;  3TP9 A;  2NXA A;  4YSB A;  1WUO A;  1BVT A;  4NQ6 A;  1JT1 A;  1VJN A;  5B3R A;  3DHA A;  2BMI A;  3X2Y A;  5HIO A;  4TYF A;  5AJL A;  4D1W A;  5K4N A; 
#chains in the Genus database with same CATH homology
 4Z5Y A;  2BFZ A;  2BC2 A;  4ZEJ A;  2AZ4 A;  5LCH A;  1JJE A;  2E7Y A;  4FSB A;  4EYL A;  3RPC A;  4F6Z A;  3MD7 A;  2I7X A;  5LCA A;  4EY2 A;  4RM5 A;  2NZE A;  2FU7 A;  2Q42 A;  3AF5 A;  2QJS A;  3IEM A;  2YNV A;  3DH8 A;  3SBL A;  5A87 A;  3X2X A;  4WD6 A;  3ESH A;  4U4L A;  1BMC A;  2GMN A;  5EW0 A;  1ZTC A;  3H3E A;  2P4Z A;  2FM6 A;  2UYX A;  1WRA A;  4H0D A;  4EXS A;  4D1T A;  4BP0 A;  3PY5 A;  3AF6 A;  5EV6 A;  3IE2 A;  2A7M A;  2VW8 A;  2YCB A;  4UWP B;  4AX0 B;  2ZWR A;  2P97 A;  2XR1 A;  4HL2 A;  2BFK A;  2M5C A;  2Y8B A;  2BG7 A;  2BFZ B;  5FQC A;  4AD9 A;  4UWO B;  1K07 A;  5KIK A;  2ZZI A;  4AX1 B;  3SPU A;  4CHL A;  4V0H A;  5FQA A;  1A8T A;  1KR3 A;  3Q6V A;  2FHX A;  3X30 A;  2WRS A;  1A7T A;  4AWY B;  5AEB A;  4Z5Z A;  4NQ2 A;  1Y44 A;  4TZE A;  4AWZ A;  3IE0 A;  4D1V A;  2YNV B;  3IDZ A;  3ZQ4 A;  2DKF A;  3RKK A;  3T9M A;  5HIP A;  2FK6 A;  3IEK A;  5AHO A;  5EVB A;  4TZF A;  4P62 A;  4ZO2 A;  2Y87 A;  3IOF A;  5EH9 A;  4J5F A;  2GKL A;  2FU9 A;  4XUK A;  3ZWF A;  2GFJ A;  3I15 A;  4TYT A;  3P2U A;  3AJ3 A;  2BFL A;  2H6A A;  2OHJ A;  5AXR A;  4TZ9 A;  5ACX A;  1YCH A;  4RAM A;  4ZO3 A;  5ACR A;  4HKY A;  4Z7R A;  3JXP A;  2DOO A;  4C1D A;  1ZNB A;  4DIL A;  2QED A;  2M5D A;  1L9Y A;  1YCF A;  2P18 A;  2BG2 A;  3T3N A;  3IE1 A;  4LE6 A;  5LE1 A;  2P1E A;  5K4K A;  2GCU A;  3DHB A;  2BG6 A;  3RKJ A;  4RBS A;  5A5Z A;  2R2D A;  4KEP A;  3SD9 A;  4YSK A;  2Q0I A;  2FHX B;  3BC2 A;  2NZF A;  5EWA A;  1JJT A;  2Q9U A;  5AYA A;  3G1P A;  3R2U A;  2AIO A;  5ACQ A;  4XWW A;  2XF4 A;  1QH5 A;  2QDT A;  4B87 A;  5HIS A;  2WHG A;  5HH4 A;  5K0W A;  3KNS A;  2GFK A;  2WYM C;  5DPX A;  1HLK A;  5B1U A;  3IEL A;  4RAW A;  3ZNB A;  5ACV A;  3BK2 A;  5A0V A;  3IOG A;  5AHR A;  4EYF A;  1X8H A;  3I13 A;  5ACS A;  1WUP A;  4GYQ A;  3S0Z A;  2BIB A;  4D02 A;  1X8G A;  5LS3 A;  1DXK A;  3WXC A;  5EHT A;  1MQO A;  4C1F A;  4GYU A;  1ZKP A;  3ADR A;  5LMC A;  4PVT A;  4RL0 A;  4JO0 A;  2OHH A;  4EXY A;  2OHI A;  2QIN A;  1KO3 A;  2BG8 A;  4EYB A;  5ACP A;  1DD6 A;  3QH8 A;  1QH3 A;  3SRX A;  1X8I A;  4O98 A;  1DDK A;  5HH5 A;  3L6N A;  5IQK A;  5HH6 A;  2BTN A;  1WW1 A;  2FU6 A;  5ACT A;  1VGN A;  2CBN A;  4Z67 A;  4C1C A;  2YNU A;  5EV8 A;  3VQZ A;  3FAI A;  4BZ3 A;  3I14 A;  4TZB A;  4YSL A;  3A4Y A;  2YNW A;  2NYP A;  4C1H A;  2ZNB A;  5AXO A;  3KNR A;  2BGA A;  4UAM A;  4Z6X A;  2Y8A A;  4HL1 A;  3KL7 A;  5EVD A;  4NQ5 A;  4PVO A;  5K4M A;  5LLD A;  3LVZ A;  5LSC A;  1XTO A;  3DHC A;  2YNT A;  1KO2 A;  4XWT A;  4Z60 A;  3SFP A;  3VPE A;  4RL2 A;  5FQB A;  3I0V A;  2FU8 A;  2ZO4 A;  1E5D A;  5LM6 A;  2BG8 B;  5A0T A;  2QDS A;  2HB9 A;  1BC2 A;  4UWS B;  5KIL A;  1XM8 A;  1YCG A;  3PG4 A;  5ACU A;  4UWR B;  4C1G A;  2I7T A;  3T3O A;  3BK1 A;  3ZR9 A;  2Q0J A;  5LCF A;  1P9E A;  4NQ4 A;  4UA4 A;  2WYM A;  3SW3 A;  2I7V A;  1VME A;  4DIK A;  4F6H A;  1SML A;  5ACW A;  4UBQ A;  4GCW A;  2BR6 A;  4C09 A;  3I11 A;  3BV6 A;  3PY6 A;  5B15 A;  2WYL A;  4D1U A;  4J5H A;  1M2X A;  2YZ3 A;  3FCZ A;  4FR7 A;  5EVK A;  2YNT B;  3X2Z A;  4KEQ A;  4ZNB A;  5HIQ A;  3F9O A;  4FEK A;  4EFZ A;  4C1E A;  3TP9 A;  2NXA A;  4YSB A;  1WUO A;  1BVT A;  4NQ6 A;  1JT1 A;  1VJN A;  5B3R A;  3DHA A;  2BMI A;  3X2Y A;  5HIO A;  4TYF A;  4D1W A;  5K4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...