2QEDA

Crystal structure of salmonella thyphimurium lt2 glyoxalase ii
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
252
structure length
252
Chain Sequence
SMNLNSIPAFQDNYIWVLTNDEGRCVIVDPGEAAPVLKAIAEHKWMPEAIFLTHHHHDHVGGVKELLQHFPQMTVYGPAETQDKGATHLVGDGDTIRVLGEKFTLFATPGHTLGHVCYFSRPYLFCGDTLFSGGCGRLFEGTPSQMYQSLMKINSLPDDTLICCAHEYTLANIKFALSILPHDSFINEYYRKVKELRVKKQMTLPVILKNERKINLFLRTEDIDLINEINKETILQQPEARFAWLRSKKDTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroxyacylglutathione hydrolase
publication title Biochemical and Structural Characterization of Salmonella typhimurium Glyoxalase II: New Insights into Metal Ion Selectivity
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Hydrolase
total genus 90
structure length 252
sequence length 252
ec nomenclature ec 3.1.2.6: Hydroxyacylglutathione hydrolase.
pdb deposition date 2007-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF16123 HAGH_C Hydroxyacylglutathione hydrolase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2qedA00
4RM5A 2A7MA 1WRAA 4KEPA 2BG8B 2Q42A 1WUPA 3SPUA 5LCFA 5HIQA 5ACTA 4Z5ZA 3X2ZA 5AXRA 5LS3A 2YNUA 1YCHA 3FAIA 1YCGA 5K4MA 5EWAA 1Y44A 4EYLA 3X30A 4NQ6A 5FQAA 3IE0A 3QH8A 4C1HA 4NQ2A 3VPEA 4EFZA 5A5ZA 3I15A 4Z67A 1MQOA 2BG6A 1DDKA 2ZNBA 3LVZA 1JJTA 3H3EA 4DILA 1KO3A 3IDZA 4EYBA 2Q0IA 1XTOA 4RL0A 5ACWA 3T3NA 2BFZB 4C09A 1VGNA 4BP0A 5EH9A 2ZZIA 2FHXA 3KNSA 4O98A 2QDSA 4AX1B 4YSLA 3DH8A 5HH4A 4YSBA 2VW8A 4WD6A 4EY2A 4RAWA 2HB9A 4D1TA 2Q9UA 1KR3A 4C1GA 4UWOB 3ZNBA 2Y87A 3P2UA 1JJEA 3BK2A 1KO2A 4GYUA 3ZQ4A 4V0HA 2M5DA 5EVBA 4YSKA 1WW1A 5HH6A 1E5DA 5HIPA 3IOGA 1YCFA 2QEDA 4D1VA 5KILA 4FEKA 4B87A 2BG7A 1P9EA 3PY5A 5K0WA 2DOOA 4PVOA 3RPCA 2WYMA 1QH5A 5ACSA 3PY6A 2YNTB 5LCHA 4J5FA 1SMLA 3DHCA 4ZO2A 5LSCA 1X8GA 5FQCA 3ADRA 5EV6A 4TZEA 5AHRA 2I7TA 3A4YA 3L6NA 2I7XA 2BMIA 5EHTA 3SFPA 4Z60A 2OHHA 4NQ4A 2FU7A 4UWRB 4UAMA 2P18A 4U4LA 4C1DA 3MD7A 3I0VA 2GCUA 3AJ3A 3WXCA 4AX0B 5ACQA 5K4KA 2FU9A 1XM8A 2OHJA 3RKJA 1JT1A 1ZKPA 2E7YA 5KIKA 1BVTA 4AWYB 4FR7A 4ZNBA 2BFLA 5LCAA 4FSBA 2BG8A 3VQZA 4CHLA 5LE1A 4JO0A 2QJSA 4LE6A 4XUKA 1QH3A 2WYMC 1X8HA 2BGAA 1VMEA 5A0TA 4RL2A 5EW0A 5AEBA 1ZTCA 2FU6A 4UWSB 2WHGA 3SRXA 2P4ZA 4HL2A 3JXPA 2DKFA 3AF6A 4HKYA 3TP9A 2M5CA 1HLKA 3IEKA 2FK6A 2YNWA 2ZWRA 4DIKA 3IEMA 5HIOA 3KNRA 4GCWA 2BFZA 3PG4A 4EXSA 3BC2A 1BC2A 5B3RA 5HISA 3T3OA 4UA4A 5FQBA 4RAMA 3DHBA 1A8TA 5A87A 2YZ3A 3IE1A 4D1UA 2YNVB 2GFKA 4TZFA 4UWPB 4AD9A 5A0VA 1M2XA 2BFKA 2BIBA 2R2DA 3IOFA 3F9OA 2NXAA 5EVKA 4XWTA 3ZWFA 2GKLA 3IELA 2Y8BA 4D1WA 1BMCA 2BG2A 5IQKA 5ACPA 2P97A 2BC2A 2FHXB 3S0ZA 2CBNA 5EV8A 3SW3A 3BK1A 3IE2A 3I11A 5DPXA 2GMNA 3SD9A 5AYAA 5ACUA 4Z6XA 2YNTA 4KEQA 4TYTA 2YNVA 3Q6VA 5EVDA 2NZFA 2OHIA 3X2YA 5B15A 4J5HA 2Q0JA 2Y8AA 4EYFA 2WRSA 2BR6A 1K07A 2AIOA 4NQ5A 1WUOA 3R2UA 1ZNBA 1A7TA 3RKKA 4GYQA 2GFJA 4F6HA 2NYPA 3KL7A 3I14A 4AWZA 5ACVA 3BV6A 1DD6A 2XF4A 3X2XA 2QINA 2NZEA 2QDTA 2UYXA 1VJNA 4HL1A 4EXYA 3I13A 3FCZA 4P62A 5AXOA 4UBQA 3T9MA 5HH5A 3SBLA 4RBSA 2BTNA 4PVTA 4ZO3A 1L9YA 3AF5A 5ACXA 5K4NA 5LM6A 1DXKA 1X8IA 4D02A 4ZEJA 2P1EA 5AHOA 4Z7RA 4BZ3A 3G1PA 2I7VA 2WYLA 2FM6A 4TYFA 3DHAA 5ACRA 4H0DA 4TZBA 4C1EA 2AZ4A 4C1CA 2YCBA 4TZ9A 2XR1A 4F6ZA 4Z5YA 2H6AA 3ZR9A 4XWWA 3ESHA 5B1UA 2ZO4A 5LMCA 5LLDA 4C1FA 2FU8A
chains in the Genus database with same CATH superfamily
4RM5A 2A7MA 1WRAA 4KEPA 2BG8B 2Q42A 1WUPA 3SPUA 5LCFA 5HIQA 5ACTA 4Z5ZA 3X2ZA 5AXRA 5LS3A 2YNUA 1YCHA 3FAIA 1YCGA 5K4MA 5EWAA 1Y44A 4EYLA 3X30A 4NQ6A 5FQAA 3IE0A 3QH8A 4C1HA 4NQ2A 3VPEA 4EFZA 5A5ZA 3I15A 4Z67A 1MQOA 2BG6A 1DDKA 2ZNBA 3LVZA 1JJTA 3H3EA 2YHEA 4DILA 1KO3A 3IDZA 4EYBA 2Q0IA 1XTOA 4RL0A 5ACWA 3T3NA 2BFZB 4C09A 1VGNA 4BP0A 5EH9A 2ZZIA 2FHXA 3KNSA 4O98A 2QDSA 4AX1B 4YSLA 3DH8A 5HH4A 4YSBA 2VW8A 4WD6A 4EY2A 4RAWA 2HB9A 4D1TA 2Q9UA 1KR3A 4C1GA 2CFUA 4UWOB 3ZNBA 2Y87A 3P2UA 1JJEA 3BK2A 1KO2A 4GYUA 3ZQ4A 2CFZA 2M5DA 4V0HA 5EVBA 4YSKA 1WW1A 5HH6A 1E5DA 5HIPA 3IOGA 1YCFA 2QEDA 4D1VA 5KILA 4FEKA 4B87A 2BG7A 1P9EA 5AJLA 3PY5A 5K0WA 2DOOA 4PVOA 3RPCA 2WYMA 1QH5A 5ACSA 3PY6A 2YNTB 5LCHA 4J5FA 1SMLA 3DHCA 4ZO2A 5LSCA 1X8GA 5FQCA 3ADRA 5EV6A 4TZEA 5AHRA 2I7TA 3A4YA 3L6NA 2I7XA 2BMIA 5EHTA 3SFPA 4Z60A 2OHHA 4NQ4A 4PDXA 2FU7A 4UWRB 4UAMA 2P18A 4U4LA 4C1DA 3MD7A 3I0VA 2GCUA 3AJ3A 3WXCA 4AX0B 5ACQA 5K4KA 2FU9A 1XM8A 2OHJA 3RKJA 1JT1A 1ZKPA 2E7YA 5KIKA 1BVTA 4AWYB 4FR7A 4ZNBA 2BFLA 5LCAA 4FSBA 2BG8A 3VQZA 4CHLA 5LE1A 5A23A 5AIJA 4JO0A 2QJSA 4LE6A 4XUKA 1QH3A 2WYMC 1X8HA 2BGAA 2CG3A 1VMEA 5A0TA 4RL2A 5EW0A 5AEBA 1ZTCA 2FU6A 4UWSB 2WHGA 3SRXA 2P4ZA 4HL2A 3JXPA 2DKFA 3AF6A 4HKYA 3TP9A 2M5CA 1HLKA 3IEKA 2FK6A 2YNWA 2ZWRA 4DIKA 3IEMA 5HIOA 3KNRA 4GCWA 2BFZA 3PG4A 4EXSA 3BC2A 1BC2A 5B3RA 5HISA 3T3OA 4UA4A 5FQBA 4RAMA 3DHBA 1A8TA 5A87A 2YZ3A 3IE1A 4D1UA 2YNVB 2GFKA 4TZFA 4UWPB 4AD9A 5A0VA 1M2XA 2BFKA 2BIBA 2R2DA 3IOFA 3F9OA 2NXAA 5EVKA 4XWTA 3ZWFA 2GKLA 3IELA 2Y8BA 4D1WA 4NURA 1BMCA 2BG2A 5IQKA 5ACPA 2P97A 2BC2A 2FHXB 3S0ZA 2CBNA 5EV8A 3SW3A 3BK1A 3IE2A 3I11A 5DPXA 2GMNA 3SD9A 5AYAA 5ACUA 4Z6XA 2YNTA 4KEQA 4TYTA 2YNVA 3Q6VA 5EVDA 2NZFA 2OHIA 3X2YA 5B15A 4J5HA 2Q0JA 2Y8AA 4EYFA 2WRSA 2BR6A 1K07A 2AIOA 4NQ5A 1WUOA 3R2UA 1ZNBA 1A7TA 3RKKA 4AV7A 4GYQA 2GFJA 4F6HA 2NYPA 3KL7A 3I14A 4AWZA 5ACVA 3BV6A 1DD6A 2XF4A 3X2XA 2QINA 2NZEA 2QDTA 2UYXA 1VJNA 4HL1A 4EXYA 3I13A 3FCZA 4P62A 5AXOA 4UBQA 3T9MA 4AXHA 2CG2A 5HH5A 3SBLA 4RBSA 2BTNA 4PVTA 4ZO3A 1L9YA 3AF5A 5ACXA 5K4NA 5LM6A 1DXKA 1X8IA 4D02A 4ZEJA 2P1EA 5AHOA 4Z7RA 4BZ3A 3G1PA 2I7VA 2WYLA 2FM6A 4TYFA 3DHAA 5ACRA 4H0DA 4TZBA 4C1EA 2AZ4A 4C1CA 2YCBA 4TZ9A 2XR1A 4F6ZA 4Z5YA 2H6AA 3ZR9A 4XWWA 3ESHA 5B1UA 2ZO4A 5LMCA 5LLDA 4C1FA 2FU8A
chains in the Genus database with same CATH topology
4RM5A 2A7MA 1WRAA 4KEPA 2BG8B 2Q42A 1WUPA 3SPUA 5LCFA 5HIQA 5ACTA 4Z5ZA 3X2ZA 5AXRA 5LS3A 2YNUA 1YCHA 3FAIA 1YCGA 5K4MA 5EWAA 1Y44A 4EYLA 3X30A 4NQ6A 5FQAA 3IE0A 3QH8A 4C1HA 4NQ2A 3VPEA 4EFZA 5A5ZA 3I15A 4Z67A 1MQOA 2BG6A 1DDKA 2ZNBA 3LVZA 1JJTA 3H3EA 4DILA 1KO3A 3IDZA 4EYBA 2Q0IA 1XTOA 4RL0A 5ACWA 3T3NA 2BFZB 4C09A 1VGNA 4BP0A 5EH9A 2ZZIA 2FHXA 3KNSA 4O98A 2QDSA 4AX1B 4YSLA 3DH8A 5HH4A 4YSBA 2VW8A 4WD6A 4EY2A 4RAWA 2HB9A 4D1TA 2Q9UA 1KR3A 4C1GA 4UWOB 3ZNBA 2Y87A 3P2UA 1JJEA 3BK2A 1KO2A 4GYUA 3ZQ4A 4V0HA 2M5DA 5EVBA 4YSKA 1WW1A 5HH6A 1E5DA 5HIPA 3IOGA 1YCFA 2QEDA 4D1VA 5KILA 4FEKA 4B87A 2BG7A 1P9EA 3PY5A 5K0WA 2DOOA 4PVOA 3RPCA 2WYMA 1QH5A 5ACSA 3PY6A 2YNTB 5LCHA 4J5FA 1SMLA 3DHCA 4ZO2A 5LSCA 1X8GA 5FQCA 3ADRA 5EV6A 4TZEA 5AHRA 2I7TA 3A4YA 3L6NA 2I7XA 2BMIA 5EHTA 3SFPA 4Z60A 2OHHA 4NQ4A 2FU7A 4UWRB 4UAMA 2P18A 4U4LA 4C1DA 3MD7A 3I0VA 2GCUA 3AJ3A 3WXCA 4AX0B 5ACQA 5K4KA 2FU9A 1XM8A 2OHJA 3RKJA 1JT1A 1ZKPA 2E7YA 5KIKA 1BVTA 4AWYB 4FR7A 4ZNBA 2BFLA 5LCAA 4FSBA 2BG8A 3VQZA 4CHLA 5LE1A 4JO0A 2QJSA 4LE6A 4XUKA 1QH3A 2WYMC 1X8HA 2BGAA 1VMEA 5A0TA 4RL2A 5EW0A 5AEBA 1ZTCA 2FU6A 4UWSB 2WHGA 3SRXA 2P4ZA 4HL2A 3JXPA 2DKFA 3AF6A 4HKYA 3TP9A 2M5CA 1HLKA 3IEKA 2FK6A 2YNWA 2ZWRA 4DIKA 3IEMA 5HIOA 3KNRA 4GCWA 2BFZA 3PG4A 4EXSA 3BC2A 1BC2A 5B3RA 5HISA 3T3OA 4UA4A 5FQBA 4RAMA 3DHBA 1A8TA 5A87A 2YZ3A 3IE1A 4D1UA 2YNVB 2GFKA 4TZFA 4UWPB 4AD9A 5A0VA 1M2XA 2BFKA 2BIBA 2R2DA 3IOFA 3F9OA 2NXAA 5EVKA 4XWTA 3ZWFA 2GKLA 3IELA 2Y8BA 4D1WA 1BMCA 2BG2A 5IQKA 5ACPA 2P97A 2BC2A 2FHXB 3S0ZA 2CBNA 5EV8A 3SW3A 3BK1A 3IE2A 3I11A 5DPXA 2GMNA 3SD9A 5AYAA 5ACUA 4Z6XA 2YNTA 4KEQA 4TYTA 2YNVA 3Q6VA 5EVDA 2NZFA 2OHIA 3X2YA 5B15A 4J5HA 2Q0JA 2Y8AA 4EYFA 2WRSA 2BR6A 1K07A 2AIOA 4NQ5A 1WUOA 3R2UA 1ZNBA 1A7TA 3RKKA 4GYQA 2GFJA 4F6HA 2NYPA 3KL7A 3I14A 4AWZA 5ACVA 3BV6A 1DD6A 2XF4A 3X2XA 2QINA 2NZEA 2QDTA 2UYXA 1VJNA 4HL1A 4EXYA 3I13A 3FCZA 4P62A 5AXOA 4UBQA 3T9MA 5HH5A 3SBLA 4RBSA 2BTNA 4PVTA 4ZO3A 1L9YA 3AF5A 5ACXA 5K4NA 5LM6A 1DXKA 1X8IA 4D02A 4ZEJA 2P1EA 5AHOA 4Z7RA 4BZ3A 3G1PA 2I7VA 2WYLA 2FM6A 4TYFA 3DHAA 5ACRA 4H0DA 4TZBA 4C1EA 2AZ4A 4C1CA 2YCBA 4TZ9A 2XR1A 4F6ZA 4Z5YA 2H6AA 3ZR9A 4XWWA 3ESHA 5B1UA 2ZO4A 5LMCA 5LLDA 4C1FA 2FU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RM5 A;  2A7M A;  1WRA A;  4KEP A;  2BG8 B;  2Q42 A;  1WUP A;  3SPU A;  5LCF A;  5HIQ A;  5ACT A;  4Z5Z A;  3X2Z A;  5AXR A;  5LS3 A;  2YNU A;  1YCH A;  3FAI A;  1YCG A;  5K4M A;  5EWA A;  1Y44 A;  4EYL A;  3X30 A;  4NQ6 A;  5FQA A;  3IE0 A;  3QH8 A;  4C1H A;  4NQ2 A;  3VPE A;  4EFZ A;  5A5Z A;  3I15 A;  4Z67 A;  1MQO A;  2BG6 A;  1DDK A;  2ZNB A;  3LVZ A;  1JJT A;  3H3E A;  4DIL A;  1KO3 A;  3IDZ A;  4EYB A;  2Q0I A;  1XTO A;  4RL0 A;  5ACW A;  3T3N A;  2BFZ B;  4C09 A;  1VGN A;  4BP0 A;  5EH9 A;  2ZZI A;  2FHX A;  3KNS A;  4O98 A;  2QDS A;  4AX1 B;  4YSL A;  3DH8 A;  5HH4 A;  4YSB A;  2VW8 A;  4WD6 A;  4EY2 A;  4RAW A;  2HB9 A;  4D1T A;  2Q9U A;  1KR3 A;  4C1G A;  4UWO B;  3ZNB A;  2Y87 A;  3P2U A;  1JJE A;  3BK2 A;  1KO2 A;  4GYU A;  3ZQ4 A;  4V0H A;  2M5D A;  5EVB A;  4YSK A;  1WW1 A;  5HH6 A;  1E5D A;  5HIP A;  3IOG A;  1YCF A;  2QED A;  4D1V A;  5KIL A;  4FEK A;  4B87 A;  2BG7 A;  1P9E A;  3PY5 A;  5K0W A;  2DOO A;  4PVO A;  3RPC A;  2WYM A;  1QH5 A;  5ACS A;  3PY6 A;  2YNT B;  5LCH A;  4J5F A;  1SML A;  3DHC A;  4ZO2 A;  5LSC A;  1X8G A;  5FQC A;  3ADR A;  5EV6 A;  4TZE A;  5AHR A;  2I7T A;  3A4Y A;  3L6N A;  2I7X A;  2BMI A;  5EHT A;  3SFP A;  4Z60 A;  2OHH A;  4NQ4 A;  2FU7 A;  4UWR B;  4UAM A;  2P18 A;  4U4L A;  4C1D A;  3MD7 A;  3I0V A;  2GCU A;  3AJ3 A;  3WXC A;  4AX0 B;  5ACQ A;  5K4K A;  2FU9 A;  1XM8 A;  2OHJ A;  3RKJ A;  1JT1 A;  1ZKP A;  2E7Y A;  5KIK A;  1BVT A;  4AWY B;  4FR7 A;  4ZNB A;  2BFL A;  5LCA A;  4FSB A;  2BG8 A;  3VQZ A;  4CHL A;  5LE1 A;  4JO0 A;  2QJS A;  4LE6 A;  4XUK A;  1QH3 A;  2WYM C;  1X8H A;  2BGA A;  1VME A;  5A0T A;  4RL2 A;  5EW0 A;  5AEB A;  1ZTC A;  2FU6 A;  4UWS B;  2WHG A;  3SRX A;  2P4Z A;  4HL2 A;  3JXP A;  2DKF A;  3AF6 A;  4HKY A;  3TP9 A;  2M5C A;  1HLK A;  3IEK A;  2FK6 A;  2YNW A;  2ZWR A;  4DIK A;  3IEM A;  5HIO A;  3KNR A;  4GCW A;  2BFZ A;  3PG4 A;  4EXS A;  3BC2 A;  1BC2 A;  5B3R A;  5HIS A;  3T3O A;  4UA4 A;  5FQB A;  4RAM A;  3DHB A;  1A8T A;  5A87 A;  2YZ3 A;  3IE1 A;  4D1U A;  2YNV B;  2GFK A;  4TZF A;  4UWP B;  4AD9 A;  5A0V A;  1M2X A;  2BFK A;  2BIB A;  2R2D A;  3IOF A;  3F9O A;  2NXA A;  5EVK A;  4XWT A;  3ZWF A;  2GKL A;  3IEL A;  2Y8B A;  4D1W A;  1BMC A;  2BG2 A;  5IQK A;  5ACP A;  2P97 A;  2BC2 A;  2FHX B;  3S0Z A;  2CBN A;  5EV8 A;  3SW3 A;  3BK1 A;  3IE2 A;  3I11 A;  5DPX A;  2GMN A;  3SD9 A;  5AYA A;  5ACU A;  4Z6X A;  2YNT A;  4KEQ A;  4TYT A;  2YNV A;  3Q6V A;  5EVD A;  2NZF A;  2OHI A;  3X2Y A;  5B15 A;  4J5H A;  2Q0J A;  2Y8A A;  4EYF A;  2WRS A;  2BR6 A;  1K07 A;  2AIO A;  4NQ5 A;  1WUO A;  3R2U A;  1ZNB A;  1A7T A;  3RKK A;  4GYQ A;  2GFJ A;  4F6H A;  2NYP A;  3KL7 A;  3I14 A;  4AWZ A;  5ACV A;  3BV6 A;  1DD6 A;  2XF4 A;  3X2X A;  2QIN A;  2NZE A;  2QDT A;  2UYX A;  1VJN A;  4HL1 A;  4EXY A;  3I13 A;  3FCZ A;  4P62 A;  5AXO A;  4UBQ A;  3T9M A;  5HH5 A;  3SBL A;  4RBS A;  2BTN A;  4PVT A;  4ZO3 A;  1L9Y A;  3AF5 A;  5ACX A;  5K4N A;  5LM6 A;  1DXK A;  1X8I A;  4D02 A;  4ZEJ A;  2P1E A;  5AHO A;  4Z7R A;  4BZ3 A;  3G1P A;  2I7V A;  2WYL A;  2FM6 A;  4TYF A;  3DHA A;  5ACR A;  4H0D A;  4TZB A;  4C1E A;  2AZ4 A;  4C1C A;  2YCB A;  4TZ9 A;  2XR1 A;  4F6Z A;  4Z5Y A;  2H6A A;  3ZR9 A;  4XWW A;  3ESH A;  5B1U A;  2ZO4 A;  5LMC A;  5LLD A;  4C1F A;  2FU8 A; 
#chains in the Genus database with same CATH topology
 4RM5 A;  2A7M A;  1WRA A;  4KEP A;  2BG8 B;  2Q42 A;  1WUP A;  3SPU A;  5LCF A;  5HIQ A;  5ACT A;  4Z5Z A;  3X2Z A;  5AXR A;  5LS3 A;  2YNU A;  1YCH A;  3FAI A;  1YCG A;  5K4M A;  5EWA A;  1Y44 A;  4EYL A;  3X30 A;  4NQ6 A;  5FQA A;  3IE0 A;  3QH8 A;  4C1H A;  4NQ2 A;  3VPE A;  4EFZ A;  5A5Z A;  3I15 A;  4Z67 A;  1MQO A;  2BG6 A;  1DDK A;  2ZNB A;  3LVZ A;  1JJT A;  3H3E A;  2YHE A;  4DIL A;  1KO3 A;  3IDZ A;  4EYB A;  2Q0I A;  1XTO A;  4RL0 A;  5ACW A;  3T3N A;  2BFZ B;  4C09 A;  1VGN A;  4BP0 A;  5EH9 A;  2ZZI A;  2FHX A;  3KNS A;  4O98 A;  2QDS A;  4AX1 B;  4YSL A;  3DH8 A;  5HH4 A;  4YSB A;  2VW8 A;  4WD6 A;  4EY2 A;  4RAW A;  2HB9 A;  4D1T A;  2Q9U A;  1KR3 A;  4C1G A;  2CFU A;  4UWO B;  3ZNB A;  2Y87 A;  3P2U A;  1JJE A;  3BK2 A;  1KO2 A;  4GYU A;  3ZQ4 A;  2CFZ A;  2M5D A;  4V0H A;  5EVB A;  4YSK A;  1WW1 A;  5HH6 A;  1E5D A;  5HIP A;  3IOG A;  1YCF A;  2QED A;  4D1V A;  5KIL A;  4FEK A;  4B87 A;  2BG7 A;  1P9E A;  5AJL A;  3PY5 A;  5K0W A;  2DOO A;  4PVO A;  3RPC A;  2WYM A;  1QH5 A;  5ACS A;  3PY6 A;  2YNT B;  5LCH A;  4J5F A;  1SML A;  3DHC A;  4ZO2 A;  5LSC A;  1X8G A;  5FQC A;  3ADR A;  5EV6 A;  4TZE A;  5AHR A;  2I7T A;  3A4Y A;  3L6N A;  2I7X A;  2BMI A;  5EHT A;  3SFP A;  4Z60 A;  2OHH A;  4NQ4 A;  4PDX A;  2FU7 A;  4UWR B;  4UAM A;  2P18 A;  4U4L A;  4C1D A;  3MD7 A;  3I0V A;  2GCU A;  3AJ3 A;  3WXC A;  4AX0 B;  5ACQ A;  5K4K A;  2FU9 A;  1XM8 A;  2OHJ A;  3RKJ A;  1JT1 A;  1ZKP A;  2E7Y A;  5KIK A;  1BVT A;  4AWY B;  4FR7 A;  4ZNB A;  2BFL A;  5LCA A;  4FSB A;  2BG8 A;  3VQZ A;  4CHL A;  5LE1 A;  5A23 A;  5AIJ A;  4JO0 A;  2QJS A;  4LE6 A;  4XUK A;  1QH3 A;  2WYM C;  1X8H A;  2BGA A;  2CG3 A;  1VME A;  5A0T A;  4RL2 A;  5EW0 A;  5AEB A;  1ZTC A;  2FU6 A;  4UWS B;  2WHG A;  3SRX A;  2P4Z A;  4HL2 A;  3JXP A;  2DKF A;  3AF6 A;  4HKY A;  3TP9 A;  2M5C A;  1HLK A;  3IEK A;  2FK6 A;  2YNW A;  2ZWR A;  4DIK A;  3IEM A;  5HIO A;  3KNR A;  4GCW A;  2BFZ A;  3PG4 A;  4EXS A;  3BC2 A;  1BC2 A;  5B3R A;  5HIS A;  3T3O A;  4UA4 A;  5FQB A;  4RAM A;  3DHB A;  1A8T A;  5A87 A;  2YZ3 A;  3IE1 A;  4D1U A;  2YNV B;  2GFK A;  4TZF A;  4UWP B;  4AD9 A;  5A0V A;  1M2X A;  2BFK A;  2BIB A;  2R2D A;  3IOF A;  3F9O A;  2NXA A;  5EVK A;  4XWT A;  3ZWF A;  2GKL A;  3IEL A;  2Y8B A;  4D1W A;  4NUR A;  1BMC A;  2BG2 A;  5IQK A;  5ACP A;  2P97 A;  2BC2 A;  2FHX B;  3S0Z A;  2CBN A;  5EV8 A;  3SW3 A;  3BK1 A;  3IE2 A;  3I11 A;  5DPX A;  2GMN A;  3SD9 A;  5AYA A;  5ACU A;  4Z6X A;  2YNT A;  4KEQ A;  4TYT A;  2YNV A;  3Q6V A;  5EVD A;  2NZF A;  2OHI A;  3X2Y A;  5B15 A;  4J5H A;  2Q0J A;  2Y8A A;  4EYF A;  2WRS A;  2BR6 A;  1K07 A;  2AIO A;  4NQ5 A;  1WUO A;  3R2U A;  1ZNB A;  1A7T A;  3RKK A;  4AV7 A;  4GYQ A;  2GFJ A;  4F6H A;  2NYP A;  3KL7 A;  3I14 A;  4AWZ A;  5ACV A;  3BV6 A;  1DD6 A;  2XF4 A;  3X2X A;  2QIN A;  2NZE A;  2QDT A;  2UYX A;  1VJN A;  4HL1 A;  4EXY A;  3I13 A;  3FCZ A;  4P62 A;  5AXO A;  4UBQ A;  3T9M A;  4AXH A;  2CG2 A;  5HH5 A;  3SBL A;  4RBS A;  2BTN A;  4PVT A;  4ZO3 A;  1L9Y A;  3AF5 A;  5ACX A;  5K4N A;  5LM6 A;  1DXK A;  1X8I A;  4D02 A;  4ZEJ A;  2P1E A;  5AHO A;  4Z7R A;  4BZ3 A;  3G1P A;  2I7V A;  2WYL A;  2FM6 A;  4TYF A;  3DHA A;  5ACR A;  4H0D A;  4TZB A;  4C1E A;  2AZ4 A;  4C1C A;  2YCB A;  4TZ9 A;  2XR1 A;  4F6Z A;  4Z5Y A;  2H6A A;  3ZR9 A;  4XWW A;  3ESH A;  5B1U A;  2ZO4 A;  5LMC A;  5LLD A;  4C1F A;  2FU8 A; 
#chains in the Genus database with same CATH homology
 4RM5 A;  2A7M A;  1WRA A;  4KEP A;  2BG8 B;  2Q42 A;  1WUP A;  3SPU A;  5LCF A;  5HIQ A;  5ACT A;  4Z5Z A;  3X2Z A;  5AXR A;  5LS3 A;  2YNU A;  1YCH A;  3FAI A;  1YCG A;  5K4M A;  5EWA A;  1Y44 A;  4EYL A;  3X30 A;  4NQ6 A;  5FQA A;  3IE0 A;  3QH8 A;  4C1H A;  4NQ2 A;  3VPE A;  4EFZ A;  5A5Z A;  3I15 A;  4Z67 A;  1MQO A;  2BG6 A;  1DDK A;  2ZNB A;  3LVZ A;  1JJT A;  3H3E A;  4DIL A;  1KO3 A;  3IDZ A;  4EYB A;  2Q0I A;  1XTO A;  4RL0 A;  5ACW A;  3T3N A;  2BFZ B;  4C09 A;  1VGN A;  4BP0 A;  5EH9 A;  2ZZI A;  2FHX A;  3KNS A;  4O98 A;  2QDS A;  4AX1 B;  4YSL A;  3DH8 A;  5HH4 A;  4YSB A;  2VW8 A;  4WD6 A;  4EY2 A;  4RAW A;  2HB9 A;  4D1T A;  2Q9U A;  1KR3 A;  4C1G A;  4UWO B;  3ZNB A;  2Y87 A;  3P2U A;  1JJE A;  3BK2 A;  1KO2 A;  4GYU A;  3ZQ4 A;  4V0H A;  2M5D A;  5EVB A;  4YSK A;  1WW1 A;  5HH6 A;  1E5D A;  5HIP A;  3IOG A;  1YCF A;  2QED A;  4D1V A;  5KIL A;  4FEK A;  4B87 A;  2BG7 A;  1P9E A;  3PY5 A;  5K0W A;  2DOO A;  4PVO A;  3RPC A;  2WYM A;  1QH5 A;  5ACS A;  3PY6 A;  2YNT B;  5LCH A;  4J5F A;  1SML A;  3DHC A;  4ZO2 A;  5LSC A;  1X8G A;  5FQC A;  3ADR A;  5EV6 A;  4TZE A;  5AHR A;  2I7T A;  3A4Y A;  3L6N A;  2I7X A;  2BMI A;  5EHT A;  3SFP A;  4Z60 A;  2OHH A;  4NQ4 A;  2FU7 A;  4UWR B;  4UAM A;  2P18 A;  4U4L A;  4C1D A;  3MD7 A;  3I0V A;  2GCU A;  3AJ3 A;  3WXC A;  4AX0 B;  5ACQ A;  5K4K A;  2FU9 A;  1XM8 A;  2OHJ A;  3RKJ A;  1JT1 A;  1ZKP A;  2E7Y A;  5KIK A;  1BVT A;  4AWY B;  4FR7 A;  4ZNB A;  2BFL A;  5LCA A;  4FSB A;  2BG8 A;  3VQZ A;  4CHL A;  5LE1 A;  4JO0 A;  2QJS A;  4LE6 A;  4XUK A;  1QH3 A;  2WYM C;  1X8H A;  2BGA A;  1VME A;  5A0T A;  4RL2 A;  5EW0 A;  5AEB A;  1ZTC A;  2FU6 A;  4UWS B;  2WHG A;  3SRX A;  2P4Z A;  4HL2 A;  3JXP A;  2DKF A;  3AF6 A;  4HKY A;  3TP9 A;  2M5C A;  1HLK A;  3IEK A;  2FK6 A;  2YNW A;  2ZWR A;  4DIK A;  3IEM A;  5HIO A;  3KNR A;  4GCW A;  2BFZ A;  3PG4 A;  4EXS A;  3BC2 A;  1BC2 A;  5B3R A;  5HIS A;  3T3O A;  4UA4 A;  5FQB A;  4RAM A;  3DHB A;  1A8T A;  5A87 A;  2YZ3 A;  3IE1 A;  4D1U A;  2YNV B;  2GFK A;  4TZF A;  4UWP B;  4AD9 A;  5A0V A;  1M2X A;  2BFK A;  2BIB A;  2R2D A;  3IOF A;  3F9O A;  2NXA A;  5EVK A;  4XWT A;  3ZWF A;  2GKL A;  3IEL A;  2Y8B A;  4D1W A;  1BMC A;  2BG2 A;  5IQK A;  5ACP A;  2P97 A;  2BC2 A;  2FHX B;  3S0Z A;  2CBN A;  5EV8 A;  3SW3 A;  3BK1 A;  3IE2 A;  3I11 A;  5DPX A;  2GMN A;  3SD9 A;  5AYA A;  5ACU A;  4Z6X A;  2YNT A;  4KEQ A;  4TYT A;  2YNV A;  3Q6V A;  5EVD A;  2NZF A;  2OHI A;  3X2Y A;  5B15 A;  4J5H A;  2Q0J A;  2Y8A A;  4EYF A;  2WRS A;  2BR6 A;  1K07 A;  2AIO A;  4NQ5 A;  1WUO A;  3R2U A;  1ZNB A;  1A7T A;  3RKK A;  4GYQ A;  2GFJ A;  4F6H A;  2NYP A;  3KL7 A;  3I14 A;  4AWZ A;  5ACV A;  3BV6 A;  1DD6 A;  2XF4 A;  3X2X A;  2QIN A;  2NZE A;  2QDT A;  2UYX A;  1VJN A;  4HL1 A;  4EXY A;  3I13 A;  3FCZ A;  4P62 A;  5AXO A;  4UBQ A;  3T9M A;  5HH5 A;  3SBL A;  4RBS A;  2BTN A;  4PVT A;  4ZO3 A;  1L9Y A;  3AF5 A;  5ACX A;  5K4N A;  5LM6 A;  1DXK A;  1X8I A;  4D02 A;  4ZEJ A;  2P1E A;  5AHO A;  4Z7R A;  4BZ3 A;  3G1P A;  2I7V A;  2WYL A;  2FM6 A;  4TYF A;  3DHA A;  5ACR A;  4H0D A;  4TZB A;  4C1E A;  2AZ4 A;  4C1C A;  2YCB A;  4TZ9 A;  2XR1 A;  4F6Z A;  4Z5Y A;  2H6A A;  3ZR9 A;  4XWW A;  3ESH A;  5B1U A;  2ZO4 A;  5LMC A;  5LLD A;  4C1F A;  2FU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...