3BK1A

Crystal structure analysis of rnase j
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
551
structure length
551
Chain Sequence
GPQDHVEIIPLGGMGEIGKNITVFRFRDEIFVLDGGLAFPEEGMPGVDLLIPRVDYLIEHRHKIKAWVLTHGHEDHIGGLPFLLPMIFGKESPVPIYGARLTLGLLRGKLEEFGLRPGAFNLKEISPDDRIQVGRYFTLDLFRMTHSIPDNSGVVIRTPIGTIVHTGDFKLDPTPIDGKVSHLAKVAQAGAEGVLLLIADATNAERPGYTPSEMEIAKELDRVIGRAPGRVFVTTFASHIHRIQSVIWAAEKYGRKVAMEGRSMLKFSRIALELGYLKVKDRLYTLEEVKDLPDHQVLILATGSQGQPMSVLHRLAFEGHAKMAIKPGDTVILSSSPIPGNEEAVNRVINRLYALGAYVLYPPTYKVHASGHASQEELKLILNLTTPRFFLPWHGEVRHQMNFKWLAESMSRPPEKTLIGENGAVYRLTRETFEKVGEVPHGVLYVDGLGVGDITEEILADRRHMAEEGLVVITALAGEDPVVEVVSRGFVKAGERLLGEVRRMALEALKNGVREKKPLERIRDDIYYPVKKFLKKATGRDPMILPVVIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Metal dependent hydrolase
publication title Structural insights into the dual activity of RNase J
pubmed doi rcsb
source organism Thermus thermophilus
total genus 167
structure length 551
sequence length 551
ec nomenclature ec 3.-.-.-:
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bk1A03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 3bk1A02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3bk1A01
4Z60A 4NQ4A 4U4LA 2FU9A 4LE6A 4RAWA 5ACTA 4C1GA 3AF6A 4C1DA 2GFJA 4HKYA 3LVZA 1QH3A 2I7XA 3IE2A 5LM6A 5HIOA 4EXYA 5HIPA 1DXKA 3DH8A 2FHXB 2Q0JA 3I11A 3KNSA 4D1VA 2BTNA 5KIKA 1X8HA 4WD6A 3IELA 2DKFA 5A5ZA 4F6HA 4TZEA 2XR1A 2CBNA 3BV6A 5B15A 2P4ZA 3IE0A 3AJ3A 3IEMA 2YNTA 3ADRA 2QEDA 5ACSA 1BMCA 4TZBA 2FM6A 4TZFA 2YNUA 2VW8A 1VJNA 2WRSA 3P2UA 4D02A 4C1FA 3KL7A 2YNVB 4TYTA 2QDSA 2NYPA 4AD9A 4C1EA 5A0TA 2YCBA 2FU8A 1M2XA 5FQBA 2YNWA 3G1PA 4UWOB 3SPUA 4H0DA 5HISA 3MD7A 1YCGA 2H6AA 5LLDA 1JJEA 4UWPB 4ZEJA 1HLKA 3F9OA 4EYLA 2BR6A 3X2ZA 1X8IA 2DOOA 4PVTA 5FQCA 1JT1A 5EHTA 3BC2A 3SD9A 2AZ4A 3IDZA 2XF4A 3I13A 1KO2A 2AIOA 2FU7A 2BC2A 5A87A 3ZWFA 1ZKPA 3BK1A 4RL0A 1XTOA 2I7VA 2BG8A 2GFKA 2NZEA 2Y8BA 3RKKA 2YNTB 4RL2A 5HH4A 1DD6A 4GYUA 2Y8AA 5EH9A 1P9EA 5ACXA 2BGAA 4V0HA 5ACWA 3RKJA 3WXCA 4KEPA 3SBLA 2BFLA 4RAMA 4RBSA 4FR7A 3VPEA 4J5HA 2BG6A 4NQ6A 1X8GA 3ZQ4A 3PY5A 1JJTA 4DILA 5B3RA 4XWTA 1WUOA 1VMEA 5EW0A 2BFZA 4EFZA 4ZO3A 4D1UA 3Q6VA 3X2XA 4CHLA 5HH5A 4HL1A 2M5CA 4TYFA 4RM5A 2NXAA 4XUKA 4NQ5A 4NQ2A 4F6ZA 2YZ3A 4AX1B 3R2UA 3H3EA 5ACUA 3RPCA 5HH6A 1QH5A 2OHJA 3FCZA 3BK2A 2R2DA 4AWYB 3IOGA 4ZNBA 4UAMA 2M5DA 5LSCA 5A0VA 4Z6XA 3IE1A 1A8TA 4AWZA 3IOFA 5ACVA 1KR3A 4UWSB 2BG8B 2WHGA 3QH8A 3X2YA 2ZO4A 3DHCA 3IEKA 5HIQA 2HB9A 4GYQA 4BZ3A 3KNRA 1WUPA 4B87A 5LE1A 4KEQA 4C1CA 5DPXA 1DDKA 1MQOA 4UA4A 4HL2A 1WW1A 3ZNBA 5LS3A 5KILA 4Z5ZA 3I0VA 2WYMA 3FAIA 3T3OA 2BFZB 5EVDA 2BIBA 5K4NA 5EV6A 1BC2A 4Z7RA 4ZO2A 2FU6A 3TP9A 2P97A 3JXPA 2GCUA 4XWWA 3AF5A 3A4YA 5AYAA 4TZ9A 1SMLA 2OHIA 2Q42A 4JO0A 2QINA 5EVBA 3L6NA 1BVTA 4Z67A 5AXOA 2Q0IA 4PVOA 5EVKA 5AXRA 4FEKA 2WYLA 3I15A 5K4MA 5IQKA 4YSLA 2BFKA 4D1TA 4EYBA 5K4KA 2ZZIA 2Q9UA 4C1HA 4EY2A 4YSKA 4AX0B 3SRXA 4O98A 4D1WA 1WRAA 3T3NA 5AHRA 5LCHA 3VQZA 2ZNBA 4BP0A 5EWAA 2QDTA 2BG2A 1E5DA 1K07A 5FQAA 4UBQA 3ESHA 2E7YA 1YCFA 1VGNA 1ZNBA 3S0ZA 2FHXA 3DHBA 4EYFA 1A7TA 2A7MA 4DIKA 1Y44A 4EXSA 5LMCA 5ACRA 4FSBA 4Z5YA 5K0WA 2P1EA 2P18A 4P62A 5EV8A 4YSBA 1L9YA 4UWRB 3I14A 2GMNA 2OHHA 4J5FA 4GCWA 2BMIA 2Y87A 3ZR9A 5ACPA 1KO3A 1YCHA 3SFPA 2WYMC 3DHAA 2BG7A 5LCFA 5B1UA 3X30A 5AEBA 3T9MA 2FK6A 2YNVA 2QJSA 5AHOA 2ZWRA 3PG4A 2UYXA 2I7TA 2NZFA 3PY6A 4C09A 5LCAA 5ACQA 1ZTCA 3SW3A 1XM8A 2GKLA
chains in the Genus database with same CATH superfamily
3QKSA 2ZM6B 2PN1A 2W82A 3QSGA 3AF2A 1CRWG 4NCBA 3EXFB 3D4BA 3OFJA 3PXDA 2XADA 2CL7X 2WILA 3Q8LA 3CZMA 4BMXA 5D3ZA 2WHRA 1Y89A 2C4VA 4D1VA 5CURA 3HE3A 2CF6A 2HHLA 3A1CA 5L95A 5KOJB 2BFEB 1OPRA 4NMHA 5COQA 3O1IC 3DE0X 5SYNA 4TZTA 4AJ2A 1PJZA 1VG0B 5JAZA 1H42A 1D2MA 2WRSA 2QRQA 4RFVA 5AKKA 1XROA 4Q9AA 4ZQCB 4HQ6A 1HOXA 4XE0A 3PNOA 2R7LA 3GEBA 3HJCA 4ZYXA 3GZJA 3ESYA 4AXXA 3O1LA 1WB5A 2V0GA 2CZGA 2QLFA 2G0TA 2JFVA 1J24A 4ZYNA 3E22A 4PBSA 1AKNA 3NBYC 3AY3A 4F71A 5IG2A 2CL0X 4BFCA 1JWLA 2BC2A 3K4PA 1H6AA 5HP4A 3K9OB 4OVVA 2MOKA 2HYIC 3FKQA 3W9CB 2KTRA 1GARA 2FSIA 1I01A 3FOWA 3ZCPA 4EZIA 2OD2A 1WL8A 2P3SA 3L13A 3C1AA 1WUIS 1INLA 1UH5A 2K25A 2WP9B 1A4UA 3R3ZA 1NUQA 1E8NA 2ID9A 1OHHA 3KT6A 2FZWA 1NPDA 4DA7A 4CKCB 1WEHA 2J3LA 4AN0A 1KETA 4P7BA 4OOFA 3I01A 1QH8A 5ECWA 2I62A 4QSMA 5HCUA 4GLSC 5IDXA 3OI7A 4R9RA 3JYUA 1OBHA 4IS2A 3D7KA 5EUMA 3FCZA 2V74B 4QYMA 4E22A 1P19A 4LS3A 1XTSA 4W1SA 4ICUA 1XZDA 2G07A 2WWRA 3R5XA 4JYPA 1U8ZA 3L0PA 4WERA 4E74A 4G81A 4W9IA 4DJTA 2QRVB 3SQDA 3OLCX 1F14A 3GRKA 1ESCA 2BONA 9LDTA 1UOEA 3KNRA 1ZCAA 3KQUA 3TIVA 2NTYC 1ACJA 3LK7A 4CMKA 1PR5A 2HMVA 1YQUA 3WBBA 5ESXA 2M32A 1P0IA 3TGPA 1G8YA 3COWA 3C1UA 4A9AA 1IAVA 2C3YA 4D6XA 4I8XA 1Q84A 3T3OA 3KR2A 4V2UA 1G291 2DZMA 2O6VB 3OLYA 1CUHA 4FMDB 2JI8A 4GX0A 4AC9A 4NZPA 1M2WA 2Q07A 5LZ8A 2I29A 3TSYA 4N12A 2VQSA 5L40A 4M86A 1UFKA 1BMLC 5GGXA 2Q8QA 3R6LA 3HU3A 5JR3A 5J2TB 3HK2A 3VOBA 2HWYA 4V0RA 3ZN2A 4DLRA 3PE3A 2H16A 3KIPA 3HG7A 4GXNA 2JS7A 3KEOA 4WLNA 3OJCA 4NZMA 1ZH0A 4KE7A 3OQNA 1VSBA 2WJZB 3NTUA 4HB4A 1U3FA 5BO4B 2I9PA 2XNSA 4RGNA 1J0CA 4CMAA 1ZY2A 3DHEA 4RHYA 4JI8B 5CFRA 3QKRB 3CZQA 3N1UA 4GBED 3UIEA 5DOZA 4K2HA 3UFXB 1A5RA 2LEKA 5E6PA 2M0AA 1XCJA 3DQPA 2Q6IA 2VZEA 4A55A 4BGUA 1I7NA 1Q44A 4X66B 3K6SB 3IKLA 3T12A 2QXTA 3FI9A 1T24A 2WD9A 1E77A 3SKYA 1IWOA 1X19A 3L4BA 5A23A 2JJMA 4WX2B 4GXRA 2KDFB 1YI1A 1O58A 2JYEA 3A9JB 1KVRA 1SXJA 2DF8A 2NPOA 4E2ZA 1U5AA 5ACQA 2K3UA 2QTGA 4E7OA 5E4TA 3IEIA 4NP6A 5FBVB 1SBCA 1D6SA 2X41A 3SYLA 1KSJA 4JL8A 5KSZA 2PK3A 3ZTTA 1KEUA 1ZCZA 4RTPA 4ZJUA 4S0RA 3SR4A 1PYGA 3C4JA 2PYDA 2WVHA 1W96A 5DBIA 3U7QA 1SVLA 1J9GA 1DV1A 2X4GA 1JLHA 1ITZA 5IF9A 1LW6E 5EKXA 1VPLA 3BV6A 1J0DA 2HNAA 3HKCB 1X7DA 1GCAA 2YYSA 1TTQB 4CWAA 1Z2OX 4NY1A 4PWZA 2W83A 4EKIA 2ZBGA 3ZK7A 1Z2MA 5IAEA 1OBVA 1Y7LA 4BMDA 1KFYB 5DCLA 4FFSA 3DSRA 3EAQA 2HJ8A 4MUGA 1IDOA 1K0UA 3LHDA 4IBOA 1UQTA 5J1SB 3KPYA 4HDNA 1NQ5A 3IHPC 4YRGA 3U6BA 4MP3A 1N5RA 1YSCA 1FLAA 3TTXA 1DO2A 5E9JA 2BPOA 2FW9A 1XU4A 4A8JB 3I9V6 3N20C 1GPH1 2LMCA 2Z0DB 2D74A 4IEIA 4N6OA 4M46A 1TUGA 4YUWA 2W22A 1PFVA 3ANXA 2GPJA 2QG6A 3B9PA 1VKJA 1QO7A 2BQQA 5AXAA 3LG2A 4BP3A 3NC4A 1IRXA 3ANSA 5EGNA 3PX3A 4YMUA 2I6FA 3PDCA 4L1BA 3DP9A 4RIFA 1JR3A 4JL9A 5IXSA 1EP2B 1MJ5A 2Q9CA 4WZBA 1YR6A 3UHFA 1N36B 3I6QA 3S5JA 4DILA 1JKMA 5B3RA 1BVRA 4Y0AA 5EW0A 4FYMA 4MT5A 4H27A 3CG4A 2QROA 2KX7A 4ZOLA 4J3JA 5J2UA 1SCUB 1V9SA 2Z5VA 4ZVNA 4ED9A 1F77A 4IRUB 1ULTA 1AARA 1BW9B 2WZDA 2BFFB 4C14A 1GQOA 2FZEA 3IFWB 2X2PA 4PZUA 2GMWA 2BGRA 2C96A 3S2YA 4DA9A 1NRJB 4WVLA 2Z2IA 1Z38A 3OJ4B 2BN4A 2X9QA 4E07A 4UVEA 3PS9A 1TAGA 3DO5A 1T0RC 2L32A 4WLFA 4J76A 5SV2A 5LA6A 4C20A 1KY2A 3I72A 2DTDA 5BN4A 1CK1A 4EVIA 2V9CA 2GBKA 5HJ7A 4JSTA 2KWCA 1NDUA 1DELA 2KZRA 4Q24A 4RK1A 4UPVA 4NJMA 3L4SO 1W47A 3E2MA 4NU0A 4AW9A 3U3JA 1TK9A 5T4BA 3W5BA 1CNMA 1QONA 2EERA 5L51A 3RVOA 1Z4MA 4WUTA 4OFBA 1EM7A 1C8BA 1CZUA 3B6ZA 3KWJA 1RMQA 1DE0A 4XGIA 5FKAC 4JU9A 3ECCA 1G2IA 2XJ9A 4L4ZA 4S0XA 1PKEA 2HADA 2JUOA 1N3LA 3Q3OC 1FFVA 4KUGA 1ZS9A 4PX2A 5JOQA 3I58A 4CG0A 2D7CA 1AVTA 2DEUA 4I55A 4Q4LA 2WZCA 2R6GA 3MHPA 1X8XA 1KMMA 4ADSG 3OJ3A 3K9LA 1WCWA 3LT5A 1C9EA 4E11A 1U2SA 4J94A 4Q9JA 1A8HA 3NUHB 1VBNA 5ALVA 2OCDA 4ZMSA 3IR6A 3ESHA 5KQRA 3U7RA 2D5IA 6REQA 4W8HA 3WRXC 3AVYA 4KQKA 2LJIA 4M55A 4L76A 1W52X 2E4XA 1MNQA 3NDRA 5HIMA 2O8BA 3OQJA 1U1GA 2BMIA 4GDLA 2RGBA 1G60A 5ERYA 5B7QA 1N5DA 4H7DA 2Y1CA 4B3JA 2E0IA 3FDFA 5B6PA 4L9AA 4N58A 2F67A 1WRBA 3EC8A 3JQQA 3OEHA 4RTMA 3K09C 5DNDA 3NWOA 2CHVA 1Z9BA 4DADA 3IR5A 1R4MA 3ZWXA 4DXGA 2EOAA 5LIRA 2IUFA 3NFYA 4PFQA 1GZ3A 5J2RA 4DWOA 1LNZA 3SJCA 4C3VA 1QYWA 3QPUA 2IEGA 3NU1A 1Z28A 2C98A 3GA7A 4AUMA 1KAOA 2J9ZB 4I19A 1MTOA 2N9LA 1V97A 2O2HA 4BOZB 2V03A 5DF1A 4NOLA 5BY2A 2ZBUA 3OPMA 4YT5A 3KALA 1YL7A 2PYIA 3EHDA 2WNSA 2VDRB 2BKAA 2QUJA 1S9DA 2OJWA 1T9AA 1GR0A 3V7FA 7GPBA 4OLAA 4FDLA 5GTDA 2BFCB 3V4ZA 3E53A 1DEXA 3UANA 3V1KA 4ZKEA 3KR1A 2YMLA 3D3EA 1N7JA 5FYQA 1UFRA 3UA3A 3IAAA 3JD0A 1M6WA 2AFIE 4IWOA 2NUPA 2EL9A 3TLCA 4ODIA 1QHGA 2OHXA 1KMCA 4H7IA 2O2YA 3AUYA 3QE4A 2UUCB 1JJEA 3K20A 2VDUE 3BGOS 3RWMB 1KDZA 3BH6A 4IMJB 4QECA 1G17A 1U28A 4CEJA 3R9XB 2N7JA 5DHSA 3QPDA 1XPRA 3GFVA 4URKA 4RD3A 3X2FA 1PZXA 3IHTA 4Y6LA 3I13A 4RV9A 4ZEVA 3PC6A 3KYIB 1WQ4A 2WMOB 1M66A 4RUKA 3RGWS 3C7DB 2BG8A 4OQ4A 3RWOA 4MJSA 3QLTA 1ULAA 4MW6A 2ZG6A 2AQIA 2P75A 1I7HA 2EEZA 3G1UA 3DDCB 5B12A 4AMVA 4C4ZA 3TXYA 4TRRA 1CZOA 1VDZA 1NVMB 2ZVPX 5EYPA 5F35A 5K2OA 1EIWA 1E10A 5C1IA 3E18A 4I9GA 2B7LA 4R2HA 1AD2A 3TLZA 4LFCB 1BVUA 2I1JA 1C30A 1RRFA 4N48A 3NFRA 3KJXA 5LDGA 2BSQA 2WQYB 1LPPA 4NBRA 1W19A 1X7HA 4EZJA 4NS4A 4FR5A 3L5OA 1CR0A 3S0JA 2PMVA 3HADA 1JJAA 5AUNB 2OBMA 3LW7A 2XWSA 4BB6A 4MW7A 4AZ3A 2P35A 4C0HA 1YVEI 4I8DA 1LTKA 3GGGA 2GVDC 1HQYE 5FUMA 4RY9A 2OXCA 2QRNA 3OZCA 3L1UA 4YTMB 1SJ9A 1ZXBA 4K05A 1WX8A 1YZNA 4YAOA 1SULA 1P9NA 2EKPA 5JDCA 3KAPA 2ZZPB 2O2XA 5C7YA 3VOAA 3C5VA 4CCYA 2EGUA 3GNTA 3STYA 1EXVA 3N2IA 1JLKA 4L6IA 1ZJWA 2WLBA 1TUEA 2CYAA 2H5IA 3G2MA 3ZJVA 5C8YB 2H3EA 1QVZA 3ZJUA 4KXXA 3BN3A 1ULBA 2FJ0A 1LKZA 4BP9A 5AK6A 4LOJA 2C97A 1DEAA 1N6ZA 2J08A 3H8VA 5B3KA 3BE8A 4RH6A 3VC1A 1HZ6A 3L01A 2ZRHA 1OTRB 1A9ZA 2CU3A 1L5QA 3K1YA 4RCZA 5JJBA 4KLZA 3MK31 2YVQA 1IEVA 5IZCC 2KBEA 4KH1A 3I6BA 4TSFA 1OCEA 1GZ4A 3LCVB 5CCEA 3URKA 3TB4A 2L18A 4ZRKA 1E62A 1G8AA 3FPHA 4AUQC 4ZGGA 4RS3A 4Q16A 1ECFA 1P4SA 4JQCA 3LLUA 2VP4A 3AVUA 3S2SA 3GLHB 1NN1A 3NWJA 4NC9A 2RGAA 2FGKA 1C9YA 2GASA 2VP3A 1BROA 4K28A 2XYPA 1XCTL 2OVBA 3ZVVA 2UXCB 2A9RA 4DPKA 3ZI0A 4HT3B 2WJ4A 4LOLA 5I4BA 3IBYA 5GY7A 3HDTA 2QI9C 4GQAA 2AI1A 3QV1A 4ZC1A 3WKCA 2A84A 3RFCA 3RJ5A 3KZOA 2BCJQ 2JA1A 3OCUA 1PBNA 3HNOA 4JT4A 1O8BA 2H2HA 1FYWA 3NVMB 1CQWA 1B0AA 4WCVA 6PFKA 1M5UA 2PD3A 2YV1A 4KFTA 4F45A 2C5GA 5T3UA 4DQOC 3QI2A 4HKYA 3PL1A 1RWWA 3Q88A 4FLEA 2P7IA 4G0NB 1TQ6A 4DIBA 1SQSA 4JMLA 4HNHA 4F3CA 2B3DA 5INTA 3KOOA 3MJTA 1ZUIA 3KQSA 3LXUX 1XVLA 4Z9BA 3T1VA 5IUNC 4UUBA 1HDXA 5KOHA 4A23A 4B0OA 2H1HA 1F2TB 4R8VA 1L5MA 2HJWA 5AFSA 4HH1A 2WXQA 1GQQA 2Q3LA 1C1YA 1H9AA 4QGSA 5EFZA 1ACCA 3EEFA 4BNFA 2WXFA 4RO0A 1ZOYB 1E79D 2VEDA 2GEBA 3UO8B 5IYZB 4QRIA 5JMTA 4WN9B 5CW1A 1SBTA 5L3RA 1TMKA 1EIZA 1ZRMA 3VUWA 4IG7B 3ZV6A 1P72A 4KDRA 1GJZA 2X6RA 4LV8B 1HNWB 5DIZA 2Q7XA 2P6PA 4CZ2A 4ZDWA 2Z30A 5PGMA 1BMFD 3FTPA 3BQ9A 3U7GA 3ESXA 2H4ZA 4RY2A 3E3MA 4QBHA 2R0QC 4KSLC 3O4GA 2IPAB 5G3YA 1KJNA 4PXYA 3HABA 4KEPA 4HK4A 4NBTA 4H1WA 2OGWA 5IBQA 1P4AA 3BA1A 4YRPA 3QLVA 4RMNA 4M0LA 3RADC 2LXNA 5H82A 1NV9A 2SBTA 4C22A 4EUFA 4OJYA 4Z3OA 3V4OA 2GCOA 3AIOA 2BHSA 2OP0A 4UFOA 3AH7A 2J9RA 4XDGA 3RC1A 2JFQA 2FFQA 2WM8A 2ZYDA 1CVLA 3KSZO 4AZ0B 5A1JA 2PS3A 3F8TA 2REOA 3IBEA 1HDZA 3Q8MA 1W94A 3TE6A 2P65A 4QDUA 1ZCJA 1BJRE 1HT1E 4QHTA 1YBFA 1R6AA 3QI7A 4BFXA 4UNIA 1N9ZA 1BXGB 4HKZE 6ADHA 3OZGA 4YCSA 2W2NA 4IAOA 3E9RA 3C39A 3VO1A 3VX3A 5CPBA 3PEYA 4R3WA 1YJCA 4G5GA 4AIIA 2C7HA 4TSKA 1T6ZA 1WY8A 4TWAA 1PBTA 1NNSA 2VHYA 4B33A 4MEAA 1WGGA 1RCFA 1YVRA 1MEEA 3UG6A 3OZIA 3J80A 3W5CA 2Z59B 5DHQA 3T9AA 5FTJA 4EKNB 1RQGA 1YKGA 2XF2A 3P9ZA 1ISMA 3M4YA 5T8KC 4M9QA 4KX3A 4M98A 1Z4QA 1N62A 1MUUA 1VPTA 5JISA 3QZUA 4G86A 3MYYA 3R7DA 2AC4A 2C4HA 4Q4DA 3FDZB 3E56A 3UHJA 2ZSBA 1G8PA 3KLPX 5JAIA 3KE8A 4ETMA 5J58A 4B4UA 1FCLA 1UEJA 4LECA 4KZ0A 4HXDA 1H1TA 5K3SA 2W9XA 2ZNBA 2F00A 3IDSA 3E9MA 3WAGA 3PPVA 5CLGA 3SXUA 1EFKA 4JP8A 3IT6B 2JCYA 3PK0A 1JQBA 4L6CA 5THKA 5FLEX 3ZZMA 4KUEA 2CVQA 3BCSA 4IO1A 2H1FA 4FSBA 3KQQA 1T4CA 4GOKA 3HC7A 1L9YA 2OHHA 2Y87A 1EZZA 1KC1A 5ECGC 4K46A 3QUSA 4LZJA 4LCEA 3MM4A 3FCXA 1CULC 3EXHA 2BBCA 4CG2A 3MFQA 3URYA 1UEIA 3DVGX 4C7YA 2BHLA 2VDWA 4K9DA 3P2YA 2B4KA 1VLLA 3MB8A 1ZSNA 3B0AA 4XYGA 4KDCA 3MCAA 2Y4OA 2YV4A 2Y0BA 2GA8A 3A4RA 2VHVA 1WHTA 3ESRA 1XM8A 3PPAA 2RGCA 3MWJA 2AQHA 3OCYA 2O50A 1U0RA 1V1PA 1EUDA 1I10A 1E2IA 2O3UA 4G8JA 1HE1C 2K1FA 4DJEC 5GMVA 4JE3B 4U7GA 1OFTA 1LK5A 4LC0A 4M49A 1DQRA 5ADWA 2BGNA 4QKQA 1FLDA 2VRCD 1UP6A 1YZHA 4NABA 4OHUA 3JYHA 5ALHA 3A2LA 4EHNA 4FULA 1KF0A 4I5GA 3QU5A 1TZCA 4MI1A 1OX6A 4CFZA 1FMLA 4CETA 1CYDA 2E1RA 1KEPA 3PDIA 5CA0B 2PVOD 1SJED 3UMVA 3LVBA 4JBHA 4CU2A 2ZIXA 2B34A 1OX5A 1DWOA 3C0RB 3KZVA 2L42A 4KQEA 4PICA 2GEJA 3QOXA 2JYTA 5G41A 3VH2A 3T7IA 5L3VA 4YQFA 4LWPA 1OZHA 1F60A 4TL9A 1C76A 4LVOA 3MQ4A 4G5YA 5KUTA 4CG3A 2W42A 3OM0A 5JH7B 4ZEJA 3UAGA 1B23P 5FR2A 4Q3CA 1GB1A 4MVJE 2AJCA 4Q05A 5E6JA 4DREA 1XLUA 2ICIA 2I6XA 2NS5A 2PWBA 5FUYA 3UYKA 4TQ1A 1NBAA 3JQDA 1ZM7A 3NZ3A 3RAGA 4B7XA 3T06B 3JWEA 2FQ1A 3K1ZA 1IBLB 1KJYA 2B36A 2WMDA 5GAJA 3WA7A 2P1DA 3GR6A 1XYVA 4F96A 3STUA 4B3CA 3VR8B 2HTFA 1XCBA 2EG9A 1JECA 4LJAA 9ABPA 1CZHA 1KDYA 4TUYA 3HI6A 2B9EA 2GX6A 2E5LB 3A4MA 5GM1A 5JWRA 3DMTC 2IYYA 3RK4A 1UOOA 4F3NA 1W1UA 1N2EA 1NURA 3T8MA 3EIEA 1RJFA 3HB4X 4FSXA 4E3ZA 1EBFA 1VI6A 4PPGA 1D03A 5CAEA 3AKDA 1SXPA 5DNEA 1QH5A 1DC6A 1XTZA 1YVDA 4Y1FA 2JHGA 1R12A 3N6XA 3IT0A 3TJZA 4X8OA 3UT0A 1P3QU 5D3MA 3RSLA 2FXVA 4F1WA 2ODWA 3PWZA 1GV0A 4JPSA 2GRJA 3I9FA 4B6PA 2YMPA 2F59A 4K03A 2O1WA 2ZI4A 4HLUA 1UWCA 2IBMA 2G5GX 5F5LA 2I2FA 1NA5A 1OASA 1MABA 2KKCA 2G5PA 3O93A 5AM3A 5LQUA 1W29A 2IXBA 1QDLB 2RK6A 5F5XA 2A59A 3JQ8B 2CSUA 4ZHQA 4L15A 4IX9A 1EWQA 3F9IA 2GN1A 1KZ1A 4YX9A 3RTAA 4DBLE 2WOOA 1FSFA 1KS9A 3N6VA 3DTNA 2C9ZA 5CTJA 3DD5A 4TKZA 1K06A 4DJAA 2YVLA 1Q0WB 3N70A 5CX1B 4UU8A 1ZIPA 4UM5A 4DXAA 1MB3A 5KI6A 3EC2A 2J42A 3RHSA 1DV2A 1D0IA 5H9VA 3VR5A 2O2CA 1IQ0A 1Y3FE 4DZZA 2B0CA 1EB8A 1D8AA 3VPFA 1RADA 4DV3B 4A0QA 4I5EA 1EP3B 1QLJA 4WNCA 4BNMA 2C7PA 2F7SA 3ZBTA 1AXGA 4HFRA 4PSUA 3OZTA 3GCDA 2GN4A 1BXRB 1V45E 3H18A 5CGQB 1CR6A 3FLEA 1SVWA 5AJYA 1RTTA 5K0ZA 1CQIB 1MD9A 1U7TA 3PNMA 5K5EA 4RJJA 5FNVB 1Y1TA 3LBHA 4HH3C 4OHPA 2DQSA 1EINA 3AR5A 4TOIA 5KTMA 2Q45A 1UH6A 1V1MB 4MKZA 4ANVA 2HUNA 4Z4HA 4YGYA 2RHJA 3AERA 1E58A 3AE6B 2OOBB 2AG5A 1UPCA 5EJFA 1II8A 1REQB 4AJIA 5L3SA 2IT1A 4I6EA 3RFZB 1KEWA 2M8SA 3A9CA 1C1XA 3REFA 2VQDA 5EHZA 2NUBA 3EDOA 4RMIA 5K4GA 3KKMA 2IQ5A 2K8CA 2V5AA 1WXWA 5ACTA 4Z4CA 3OBIA 1MVKA 2VF8A 4XJXA 5I7SA 4W9NC 1IIRA 3DEZA 4YAFA 2QVXX 4TS1A 4XB1A 5G5GA 3ZYYX 1LC3A 2B69A 1YJIA 2ZBVA 1I3NA 2G0AA 2WKQA 3SJ7A 1QFZA 2EFDB 5AO9A 9GPBA 4LYDA 4LXQA 2RGNA 2OCKA 1UPAA 4J29A 3NS1A 1LA2A 3OT1A 2ILTA 1TU3A 1RFGE 4EX7A 1P8AA 2H2DA 5DBGA 1HNZB 2Y6VA 4MK4A 4RVFA 1E64A 2Q2VA 5EMKA 4DGSA 4ENSA 3P45A 3I42A 1UBKS 1YZFA 1NONA 2XB9A 3S55A 3CT6A 2C7VA 2O2EA 1KTKA 2JAWA 1RFAA 1XLTA 2WZQA 2UAGA 4AXBA 2B30A 3F90A 3QWZB 1ID8A 1A5SB 2R6HA 1GUBA 4J0HA 2R6DA 4OHRA 1CG6A 1PVDA 1N2CE 3U7EB 4U7JA 3JAWA 3D6HA 4QPNA 1P73A 1PG0A 2IU3A 2BJWA 5LP6F 1QQRA 2HTME 1JAZA 2PX6A 1TUBA 2P9QA 4WBNA 2ZBQA 3H4MA 2COEA 3DFUA 1FFBA 2CVFA 1ZKPA 4RM2A 4MGKE 1I42A 3D3NA 4DK5A 2D10A 3TDMA 3ILYA 1M1YE 4ZEOA 3L8GA 4GOOD 4B3BA 3SY8A 4N65A 1ZR2A 5ACWA 2CHWA 3B5IA 3BWCA 1EU4A 3NNDA 1ISJA 3U4EG 1SGWA 2R6JA 4IIJB 2IS2A 2BG6A 4K6HA 3W6NA 4YWGG 2AWNA 2FQYA 3PY5A 3G9UA 4RMGA 5DM2A 1ZRHA 1RIFA 3MBIA 3V4PB 1Q3TA 3P71T 1UAYA 2EBUA 5KSYA 3WIEA 3DOCA 1QQ7A 2EDCA 1I9CA 2POCA 2IX3A 1GHTA 1Z5VA 4E0BA 4TXMA 3HB9A 3PQ4A 4AP4C 4A26A 4Q0MA 1B3RA 4OATA 2HGZA 3K9WA 2GYWA 4ZNBA 1IPFA 3TL5A 4RY8A 1SBYA 1O2DA 4CT4B 4BRUA 3HP7A 4G67A 2GK7A 4Q3KA 1PR2A 3G2QA 2JKZA 3ZDTA 3U09A 3BRSA 5LOVA 1K53A 4DBLC 4KQGA 2WP8J 1ZVJA 3UJ7A 1HC7A 3HBMA 2FWIA 4EATA 4C7JA 4W9LA 4XVUA 2IBIB 4XYMA 3BMOB 1H8ED 2UU7A 3MCWA 1PQSA 3PZ8A 4IDOA 4ND4A 2BMWA 1DDKA 1JAYA 1LVUA 4FFBB 4MOWA 5FB3A 1ZH6A 3FOCA 5LQAA 1WQ3A 3UVEA 2AI2A 1C4KA 2O2VB 5FXMA 1Q7CA 1P7VA 3LL7A 4YXDB 2PEAA 3HN6A 1KYTA 4UBLA 2PWZA 2EVWX 5IANA 4ZCTA 1GSOA 3NIWA 3HWSA 1VGRA 1YC5A 1HA3A 3WMRA 1VE3A 4JO0A 2FPWA 4L5AA 1RXIA 5KINB 1GP2A 1JCKB 1EHCA 1ZGHA 1K7XB 2AWTA 1JTVA 1CW2B 2CNLA 3CEJA 4RF1A 3QAQA 4C4VA 4BFSA 1U31A 1JIJA 5H4HA 2CJPA 1Q3HA 4W1PA 3W9SA 1NIPA 1PD0A 3ZLJA 1JDTA 3UBTA 1CZRA 2QTAA 4PC6A 1L4KA 1RRBA 2OD9A 2J6BA 1ZFNA 3TEMA 3DWGA 5AM4A 3BD8A 2B8JA 3AU8A 4EW6A 1G8MA 4WVFA 1OH7A 1FSZA 3RO7A 3HJUA 3DHIC 4Q37A 1E3MA 4HDMA 1DKNA 2FHXA 3C3BA 3OA0A 4D9CA 4EYFA 4DQUA 5E3IA 4L2IA 4R5MA 1NYTA 2EF0A 2Y4NA 5FF9A 1JXAA 2VR1A 5E1MA 5FK9C 3RYIB 2ADMA 5BR8B 4J5FA 3U2QA 3D81A 4TROA 3OE1A 3IILA 3TZLA 3AE1B 5EI5A 1LM8B 2GLXA 1SZJG 2FP4B 5TQ2A 3GDWA 3PI7A 3FTEA 2QRGA 4MLDA 1XZKA 3CPHA 4R2WA 3BWEA 5G4LA 3U52E 5A6VA 4QAYA 2XMDA 2ZWPA 1X39A 3WNQA 4GAEA 1ANKA 1T2NA 4GD3Q 4CBVA 1DXQA 3FVRA 2XRMA 1W44A 1CBUA 2HK9A 5ELMA 4J43A 2QYTA 5EXDA 5BYRA 1POWA 3H97A 4TLBA 2OGTA 3CRMA 2FF5A 1CZKA 1LW7A 2A57A 1W46A 4DSNA 3PJGA 3QJGA 4KLNA 3DDOA 4NOJA 1QOGA 1PLLA 2J33A 4IHKA 4F12A 3RSGA 1SBIA 1VCIA 1DEHA 1DXYA 1ZW1A 5DCNA 1A9OA 4X92A 5ECYA 3U60B 1NFRA 1S3FA 5K01A 3G7NA 5JXGA 3BK7A 1IM5A 2VWHA 2PEZA 2BEWA 1UQRA 1U99A 4B8YA 5REQA 4XKJA 1NXOA 1KNXA 4DM7A 4AOFA 2DZIA 1RWPA 3IPXA 2M4NA 2LNDA 2HAEA 3PC8A 4V1CB 1T9GS 1XFDA 4XR4A 3LBAA 3I63C 5BQ5A 4V0MA 4WRRA 1X1QA 3VAAA 4QXPA 4ZVTA 2OM6A 1USUA 5AK3A 3JX9A 4J8PA 3UCEA 2LDXA 4CU5A 3WYEA 3SVZA 4FINA 2J9XB 3SX0A 2J3KA 2VBIA 6CHYA 5JHHB 5FQCA 2AZ4A 3AETA 4BC0A 4GYKA 5KYNA 3C3CA 2MWMA 3AHJA 2YJGA 3HGMA 1R4NB 3LBIA 3UATA 3RKKA 1GNUA 4P86A 1YRHA 3QJYA 3BMCB 4V0HA 2VJNA 3QKIA 3ITNA 2Z43A 1LWOA 4FK8A 3IAUA 1CCWA 3CLKA 2HD4A 1Z82A 5HM8A 2PZ8A 5C8VA 1WSDA 3NG1A 1N9GB 1PGAA 1K7YA 4NIMA 3AFOA 1FDTA 1P1AA 2QM0A 4BFTA 1K6MA 2DFNA 5HH5A 4CHLA 4KIUA 4JUDX 2OZEA 1WM3A 3R3YA 2D6FA 5GJCA 3OTGA 1B16A 3G0CA 4PINA 3WZ2A 3GFTA 2H9AA 4P35A 2I67A 4XQ9A 3BG5A 3NC0C 3PQFA 2ERYA 1LJUA 1HQCA 2WWWA 3H3XA 4TXLA 1GY8A 3P8ZA 1NVGA 3IUNA 4JOQA 5CFQA 5K3FB 4RM8A 3VVLA 1XZLA 1ATIA 4HCJA 3QENA 4EVRA 2H0RA 4R69A 4JD5A 1VHJA 5DW0A 1GGJA 4JFAA 2HK7A 2A5DA 2XODA 5CEJA 3WIOA 1QVRA 5EJ4A 3W5AA 1LBTA 1F38A 2CJFA 2P2GA 3BWMA 3TW8A 4YV7A 2LFIA 2P11A 2Q4OA 1PZNA 2AFRA 4QXOA 2IYSA 2CXQA 4LXHA 1IVYA 3T8YA 4ZJPA 7REQA 4I4IA 1S89A 4S1WA 4WHMA 4RKWA 1X1BA 2INNE 4O2BB 4U2CA 4BLTA 1JNYA 1RJ9B 4U6NA 3KXIA 4FADA 2VDNB 1VYVA 4B7CA 5JHGB 1XRNA 3OETA 4K1RB 5IVDA 4MKFA 1P7YA 4QM6A 3FROA 3VPDA 3KPWA 4ND8B 4BAZA 3EK2A 2J67A 1YD7A 2BUAA 2QE6A 2E82A 5EZYA 4TT3D 1D09A 4IDHA 4PAQA 1WABA 2AYZA 2Y5PA 3ANTA 3P4YA 1BHSA 1T1GA 3HV2A 1AKWA 3VH4A 1IBXA 2WPDA 1FUIA 4U9UA 2IHBA 1MP0A 3LXRA 1DIAA 1FB5A 4ARCA 3CVJA 3NBFA 2PU5A 1HDCA 1RW4A 1A9TA 2JCVA 2ORYA 1GDHA 2QP4A 1Q5WB 4E5SA 5EMNA 1RKQA 2ZIEA 3RVKA 2VH1A 2CS4A 5FFMA 1Z36A 4FD2A 5JADA 3MTIA 3OWOA 1XOIA 2NO4A 3L7AA 2Y6UA 3W2GA 4WNIA 1DMRA 2V5VA 4HAWA 2NVOA 1WDLA 2O3QA 4Q21A 3NC1C 4OFZA 2FRDA 1JZSA 1EYZA 3DA8A 2OV3A 3OU2A 4G0VA 2N47A 1QRAA 3K0BA 1ZDMA 4BJHB 5IKXA 4X3OA 5J43A 1UBJS 2H4XA 2MBEA 2ZYGA 1TLFA 4OTZA 4XCVA 3WLHA 3QELB 1NT2A 2J0EA 3OZVA 2NU8B 1JYSA 4MICA 3WIUA 2GH1A 4FDTA 1R0RE 5EXSA 2XBUA 4Q1DA 5D94A 2VF5X 3PQ7A 3OVMA 2FDRA 1V4NA 3EGRA 4JP1A 3DNMA 2Z98A 4UDUC 4PYNA 1BMCA 2B21A 3NTQA 1GL6A 3ASVA 4Y2XA 1TVCA 2A5GA 2PH5A 1LQBA 2FUNB 3TKYA 4MI9A 4Z8YA 1YAJA 3MINA 4XPIB 4QBFA 1Q1ZA 3NOQA 3FKJA 4MVJA 1Z5WA 4HAXA 1NN3A 1K3UB 3ESBA 1L7XA 3VSDA 3BD9A 5FKJA 3AGQA 1MIHA 4U9IS 4ACBA 1LUAA 3VR6H 3K9CA 1FW6A 3F71A 3IG3A 4U6QA 2NIPA 1ZGAA 3BC2A 3W1SA 16PKA 3FF1A 1UXIA 1EA5A 3IRVA 4X94A 1RKVA 2VYCA 1R5OA 3KYCD 4YTNB 3PX2A 3NH9A 3PBKA 2G06A 3NVWA 1E6LA 2UU9B 4UUAA 4KGXA 3ZD9A 5LZ4A 2P40A 2OK8A 5IXJA 4ARZB 1EGMB 3QEOA 2V96A 2TMDA 5KNBD 2BEVA 4WBXC 4MNTA 4IRXA 2FEXA 4Q6WA 4BKTA 4G11A 4DA6A 4FT2A 1TEVA 1R4MI 4EO4A 1DWPA 2V1XA 1GWNA 3MWEA 4WA7A 1DAFA 3L8YA 4CQMB 3SF0A 4HRAA 3FYUC 1T3LA 1GCOA 2PKCA 2ZIAA 1X9HA 3WWYA 2KMMA 3CA8A 1XALA 2IU0A 5L45A 3TBKA 1ORRA 3ZGVA 3F67A 1D1TA 1ACMA 2HSJA 3GT4A 2WUEA 2NTTA 2DPYA 3N7TA 1TW3A 2R6ZA 1NU6A 3GNLA 3KH0A 4OVZA 2O6LA 4F2GA 3H6NA 1SUSA 2X2FA 1SXQA 3L8FA 1Z0JA 1DC3A 3PGMA 4HUQA 1P9DU 1NUSA 3IJPA 2F4VB 1XDWA 3TTSA 3ZV5A 2BFZB 3OTWA 2QN8A 1V8CA 4BMZA 4LNIA 1DLJA 2Y1DA 3ZWPA 4ZO2A 5DX0A 2RGWA 1U9IC 4HZUB 3DBRA 1Z7EA 2FCNA 3M1IA 1I32A 2H2FA 4B3IA 5HKBA 8LDHA 3RHTA 3OD1A 1E0SA 4Z2YA 3EVNA 5H4GA 1IJEA 3RU2A 3FR8A 4NX2A 2JLVA 1QG2A 4IUBS 1C3LA 4O2AA 1R6XA 3CX8A 4KGZA 3SIRA 5AH0A 1KEKA 3UHOA 2G4VA 2H1LA 4N7JA 4II3B 1AQNA 4IF4A 3G82C 1GU0A 1PFUA 1QU2A 2PHZA 3WMXA 4S1OA 5IN4A 4CLRA 3U31A 5D2MB 1YCFA 1J5PA 2XB8A 3UK0A 1WUTA 1PZMA 2EZ4A 3MS4A 2QJTA 4BZQA 3PXXA 2YV5A 3GLFE 3PU6A 3RKRA 3FCUB 2YWDA 2HV9A 4GC9A 3RUIA 5LZ9A 1Q20A 4JJZA 1Q19A 3JQBC 3GCZA 2WDQB 1R8JA 1AGXA 1ZO8A 4NJCA 3JQAB 3TNDA 2VHZA 3IMEA 5JZBA 1QHFA 1Q0RA 1ZA2A 3LA6A 1TRKA 1JMVA 4P83A 3QK7A 1I14A 1LNQA 2BSXA 5D2CA 2PCLA 5CFNA 1RXCA 1WP9A 3C3YA 3ZWAA 4U4LA 1GA1A 1VJTA 2B20A 3I2FA 3MTGA 4C2AA 1M3SA 3K0FA 4GPIB 2CBZA 3IE2A 3E1GA 2ZAGA 2YL2A 1U5BA 4MMYB 1KI2A 5LM6A 4U02A 4EF6A 3P63A 3OO0A 5AK5A 3VR1A 3T9FA 2H2GA 1T4DA 1YE8A 1MV5A 1ODJA 1YZVA 4IUMB 4BBNC 1N1MA 4F2WA 3Q0EA 1T10A 2JRHA 1C2YA 4NXMB 1FFYA 2X6QA 3K0CC 2PPHA 3H3JA 3NHWA 4TV9B 4QNRA 1GPJA 3RS5A 3S81A 3UMFA 1XVUA 1ORTA 3OQ1A 1N2CA 2ZYHA 1GO2A 1Z18A 2J6HA 1NFFA 1IHYA 2A58A 1Y0BA 3X23A 1ZUD2 3ZDDA 2HRDA 2OGUA 1RZVA 5KNDD 4JK3A 1E1QA 1LRJA 3QV2A 1RPZA 2HLDD 1PGJA 3LPDA 2HRRA 3ND7A 4FSHA 2HF9A 1I35A 1MVOA 5IVKA 2DOOA 1M1YA 2AXQA 1R7RA 3DVNV 1TEZA 4R2MA 1T9DA 5KC9A 1SBHA 4Q9DA 3C3PA 3T5DA 2YV2A 3I5AA 2YY5A 1CMXB 5IJ0A 3PQEA 4YO8A 2YY7A 1MC8A 3EB9A 5DSZA 1VGVA 1N60A 3DL4A 3N2NA 3THYA 3KZCA 1G38A 1PUTA 3NHEB 3WGIA 4XA8A 5KVSA 2V9HA 5BW8A 1EQAA 3EOZA 1QYCA 2NQTA 2JA2A 5LC1A 4KXYA 1UPXA 1RWKA 4X0EA 5AKLA 2JCBA 5BN5A 2B25A 5ALTA 4RZUA 1UK7A 4F5YA 3NBQA 1AS3A 2CT8A 2WJ3A 1HLPA 4XD7A 1WMEA 1BE6A 4AJ1A 4FNMA 2ZRNA 3M83A 3BFKA 2UV8A 2C4UA 3VZQA 1PWYE 2C95A 1HORA 3P9IA 3A2NA 3BWYA 4KFSA 1ND6A 4DT1A 1JHMA 3EYWA 4BQEA 4KHZA 5JHAA 2G9UA 2KN5A 2O3JA 3OBBA 2XWBF 4RF2A 2JWZA 2RDMA 4MGZR 3FNGA 3FLAA 1WMFA 3U1TA 1Q0PA 1BDMA 1N61A 3N05A 4U63A 2D5BA 2PV0A 1SA0A 3NI2A 3DAYA 2C54A 2NYVA 3R40A 2C2BA 5AUQA 2AS0A 4X54A 1BXTA 3RYFA 1X1SA 3T52A 2IXGA 4YDRA 2IYOA 4EFNA 1UMCA 1BWRA 2F6RA 4BE7B 2DWOA 1AUVA 2HPHA 1R15A 2IHUA 3NOXA 1I3CA 2EJTA 3WLKX 1BHO1 3SM9A 1B1AA 2JLAA 3NO4A 2R96A 1FYFA 1RQ2A 3DZFA 1SHLA 4BEBA 4ZZIA 3CUSA 3AJDA 2J9YB 3PD0A 3PGA1 3QQ8B 3L7DA 1G8FA 4YT2A 4X20B 3HHMA 3SZRA 2HW8A 2BKVA 4R8RA 5H80A 3VTVA 1CJMA 2QN6A 3EIWA 5AHWA 4FZVA 2VHJA 4IG9A 2W6MA 2XQVA 2DBYA 1EH5A 1VCNA 4NKRA 1X15A 2V6GA 3GLIB 5CHWA 4WKGA 2BGKA 1UL1X 4IKOA 2JIQA 2I7CA 2ORVA 4KJZA 2KACA 1W5EA 3SE0A 5EHGA 2VK2A 2YXNA 4UWRB 3I14A 3HRDD 2WLTA 3BHJA 4PXSA 3IVCA 4L08A 2XUHA 4WW0A 4EF4A 4ARVA 1ISFA 1HTBA 2I3BA 3WG9A 3NZUA 5I45A 2BTQA 2WABA 4WLVA 2CKDA 2KLGA 4RMJA 2ZYTX 2CLLB 2BP7A 4QUGA 3I09A 1MPTA 3N8NA 2ZPTX 2GKLA 3PC3A 1VA4A 1M67A 4DCGA 4TYQA 10MHA 3PRKE 1FVXA 2I6TA 1LXCA 1ZG3A 1FP7A 2R79A 1OIXA 1HE8B 4GKVA 5JNVA 3JATB 1ZN9A 3CN9A 3I9LA 2PXHA 2PWPA 4BQIA 2ZIWB 4EL0A 5DM70 3LY8A 1QORA 4ZAYA 1C7RA 3CFYA 4R1OA 2C3OA 3PCTA 3LF1A 1JB1A 5AM2A 2VPZA 1G4UR 4OKSA 1NC1A 4C6RA 3QYFA 5KSOA 3DJYA 1J90A 5EUCA 3OTOB 3R5SA 2GAOA 1JH9A 3W5VA 3APDA 5B36A 4PEVA 3QVXA 1T3QA 1W30A 5SY6A 4GH5A 1OQRA 1YQWA 4X84A 2UDPA 5BRJA 1CF9A 2GN8A 5LBIA 3WLQA 3FNRA 5AJUA 4N41A 4FFWA 4BE4A 1DOYA 2I4IA 3ZQUA 3KKQA 4ENUA 2BGIA 2KLBA 1GL7A 1Z2PX 3FHCB 2MSED 3CUWA 4EYLA 1Z6ZA 4UEQA 3DLIA 4Y67A 4TMVA 4NQKE 5M3BA 3RTCA 4ABTA 3C7CB 3USCS 2VXYA 1YDHA 4KYVA 1UXGA 4UHEA 3TCAA 1N6LA 3MSCA 2AVNA 2ZUWA 2KJQA 5C3UA 5HH4A 2FE1A 4GLBA 4OJTA 1OXMA 2RBGA 1RU3A 5IVHA 3A1NA 3GBPA 3F46A 4QU9A 3BWDD 5C1ZA 1T9GR 2KOXA 1J8YF 4C6TA 4RAMA 1CEXA 4HUJA 3GFOA 1KI7A 3EZ2A 3PEVA 4I08A 2JRIB 1DKPA 1Y5NA 5TY0A 3JASB 1J7BA 3OFSA 2PH1A 3SNHA 4MVCA 3EG9A 2YBDA 3SJAA 4N40A 1NM5A 3K9HA 5DPSA 5A62A 3SMQA 5ESRA 1OWNA 3NYWA 5AOAA 1ZLXA 2EQBA 2LHDA 3JARB 3T5BA 1ZNQO 3G2PA 1Y33E 1BOOA 4XVQA 2J9GA 2NV6A 4MW2A 4ID3A 3G9QA 3DMYA 3K96A 3PFFA 4CM4B 2CDCA 3CRZA 2CUKA 3MRXA 4OLFA 2C0QA 4E03A 1P0FA 3O8OA 4C7VA 5FBLB 1RI4A 3PWTA 3VTWA 1TM5E 4FN4A 1TM3E 1JPJA 1VE9A 2DHEA 3T5MA 3USES 1PE0A 1ODSA 1FA9A 2AN4A 1J99A 2HSDA 5D51S 4KIWA 3DGFC 3WKEA 3M4JA 2HJHA 1Z39A 3NV7A 4OF4A 3EFBA 2WAMA 3QG5A 5CBPA 4M9XA 2N0SA 8AT1A 2E49A 4I6NB 3BH0A 3JXPA 3KTOA 2ZT5A 4YECA 4QVGA 5FT9A 1TK2A 2CLFB 2WM3A 2FFRA 1R9JA 2F1HA 4FKZA 3MTBA 3ALBA 4KNYA 5A1TA 3GUVA 1FMFA 2Q0IA 3N1YC 4YT4A 3LVRE 2Z0MA 1AUQA 4BASA 1XO3A 2C7BA 3MRTA 1PGBA 3DFKA 4DCSA 1N32B 5EIHA 4MRNA 3DBHA 1KE2A 2HLPA 3UK6A 3E9NA 2BMJA 3WYCA 2H85A 1U7UA 1WV1A 4ZXPA 2PIDA 4X6LA 1NRIA 1L5HA 2NBWB 5EQDA 5BSWA 4GWKA 2G77B 2RHOA 1Y6GA 4CW7A 1SB9A 3U3OA 2VRWA 2JZNA 2ZTSA 1ZXXA 4AP6A 1V25A 3TLAA 5J4YA 2KW5A 2PKWA 2I91A 1NV8A 2ZRJA 2JLSA 3NIDB 1UPTA 2P4UA 2EMSA 4RCOA 3D0RA 3LBFA 2FPUA 3L2OB 1OBOA 3DHAA 1JQ4A 4E4RA 1N2OA 3SQMA 4HN2A 2W58A 3ZJYA 3HKEA 4YRMA 2MP2B 2R87A 2XUZA 1CUJA 3MS7A 2IXTA 1JAXA 4CQJA 1P31A 3IHWA 1M6EX 4OK3A 3L16A 3CS3A 3PNVA 1L6RA 3S70A 1YHZA 2BJHA 4DHZB 1D07A 4NMMA 1YJ5A 3HCWA 1NW8A 5K3BA 2A5YB 5DBFA 3ND6A 4NURA 3T1NA 1DRUA 5AVOA 4PYZA 1CVIA 3UMYA 3C24A 5JDIC 4ZGBA 1PP4A 2FPXA 3C3AA 1BDBA 5HOEA 5CUQA 3D2CA 4OHOA 3GK3A 1OYYA 2VTBB 1W2WB 3UK2A 2YNUA 1HEUA 3DT9A 4Z7JA 3LLSA 3F74A 3NNNA 4D3YA 4K86A 5B7NA 2RGFA 3TTUA 2AEHA 4G85A 4FMDF 5C7OO 3SPUA 3D8UA 4K87A 4B82A 2C7NB 2OZLA 4ON9A 2VWGA 4G9GA 5J2TF 8ATCA 1JNXX 2HA7A 3KJEA 4JEIA 4QYSA 4HO1X 2KAJA 1K98A 3CJQA 3PR3A 4GPEA 3UJPA 3VNVA 1AO3A 5BSHA 3OLXA 2MDTA 1FPYA 4AY3A 2HJGA 4OLBA 3KJIA 5AVSA 4ZJZA 3WLFA 5EZQA 3NJRA 3BKWA 4RPGA 2D07B 2HPZA 3LT0A 3Q1LA 3JD3A 1PL6A 5LUBA 2NUAA 4HADA 3R3MA 1H3FA 3BGVA 2JJYA 3Q3EA 5AYVA 2ZYIA 1WSWA 2GBLC 2KMLA 3FR7A 4IM3A 4NOMA 3N30A 3QPCA 3AEUA 4RIEA 4HX2A 4IDAA 4EPRA 4LMBA 3KZXA 2EP5A 4MPJA 3M3DA 1BDIA 2HTEA 2HD5B 3EFUA 2QN3A 3PYLA 4Y9TA 4ROTA 1T0BA 2OSVA 2Q7OE 4MJXA 1RZRD 1Y8QA 2C83A 4TQUS 2IF2A 5ARCA 3WRXA 2JCGA 4L3VA 1IZYA 2R5WA 3HBFA 1RXSA 4NBSA 1J0XO 3U4QB 3A9KA 2QDXA 2IH5A 2WE8A 4YYEA 1YDMA 4LOKA 2H31A 2JD0A 5CXXA 4DVJA 1PAUA 3THOA 4EA9A 1X1DA 1Q7BA 3WAMA 4IWYA 4LTNA 4OHKA 1D5ZC 3DWIA 1ONSA 3VMFA 4NBKA 1O89A 4B85A 4K9PA 4BMCA 3K09A 4X7PA 3TR0A 1SE3A 1JF8A 1RJWA 1VBMA 3O9MA 2BFDB 1PJQA 4Q3OA 4FGLA 1ZD4A 2G6BA 1J06A 3HCRA 3HCNA 5CVJA 2CCJA 4PVOA 5J59A 3T9CA 4MUEA 2HRBA 5CVDA 4IUDS 2OL4A 2F48A 1FD6A 1AGYA 3UAZA 2P9CA 3LOUA 2V6FA 5K4MA 1QHIA 3ZDMC 4BVJA 1DP4A 1PDVA 3MELA 4QUKA 1OLXB 1L4BA 3ETNA 5BXYA 4OHVA 1GNRA 2HWXA 1W25A 5TT1A 2JJQA 3WTCA 4RHEA 4YROA 1U65A 2NP7A 4RA6B 2QRLA 4LFBB 1KZ9A 3ELYA 3VR2D 1VQ1A 2Y0CA 1Q50A 2H4JA 3D5TA 2I6UA 3AR3A 1CQPA 5IZ4A 3WYDA 1C50A 3NAQA 3NZSA 3VNQA 5K3OA 2IWHA 4UBJA 3TQIA 4MEBA 1N0VC 4P80A 2A6PA 1T6YA 2DECA 4Q19A 4MGHA 2GEUA 4G5XA 5J47A 2BGGA 3Q2AC 3I23A 3OHSX 3QFSA 5ALNA 4JDUA 4ZOEA 2GJ4A 3QWHA 4FN5A 2O5RA 3LUJA 1UC5B 4FFOA 1QHYA 4DR2B 2BF4A 4LXUA 1NUUA 2X8AA 1L7RA 3GJYA 2G9RA 1OOEA 3EEIA 1DLIA 3PJRA 4YP1A 3SJBA 1M7BA 3PQCA 1CR1A 1XL1A 2CZQA 4O4HA 1YZGA 4Y2GA 3S28A 4KH0A 4ZT6A 4DIFA 1T2CA 1FTYA 5CXUA 4ANFA 3W2EA 2DKFA 1RAXA 1DZ3A 1N0UA 3GJRA 3W7AA 5KYXB 3SEQA 1WF3A 2BJVA 3QVMA 3KQVA 4HDSB 4ZRMA 1UM8A 3K94A 1OD6A 3QVVA 4KVGA 5JMPA 4AWAA 1KYYA 3WMFA 1ARZA 4KVFA 4NE2A 4LMAA 2CJNA 1YB5A 4EI2A 4MUHA 3TQCA 2AMFA 3TRKA 4JKYA 3SG0A 2DHQA 1U4AA 4K3UA 2VOJA 3ZWOA 3D8BA 2ES4A 3R0ZA 2CDAA 1Z5ZA 1SHZA 3O8QA 2J41A 3K72B 3S8YA 2PSSA 2IIVA 3QXHA 1LLCA 1GU7A 2NNWB 1TQDA 1M0TA 4WESA 4KNWA 3HVKA 1SZPA 1WCIA 1JT1A 1YHYA 5AI6A 1Z88A 3SFZA 4EAQA 4A8HA 4L9RA 4B3TB 3U0VA 3U0BA 4BLSA 5FO0A 4LXTA 2VLBA 2RDGA 4IY1A 4HGOA 4UNQA 3C7AA 3VQTA 2YW2A 4XD2A 2P9TA 4RIIA 3OUZA 4OV6B 2I4MA 4YI3A 3DMFA 5AI4A 4ESHA 1P9LA 4OQFA 3CBQA 3ZQ4A 4Y2YA 2ZI7A 2YX1A 4H4CA 3NEJA 1JQ5A 1I8TA 4OXIA 3FYCA 1RKBA 4ZARA 4MR8A 1PR1A 1IULA 2JBAB 4GI1A 3HDVA 2XWQA 1GZ7A 4G5OA 2Y71A 3VR4D 2L82A 4F4IA 5IZCA 2NSLA 3AVPA 1CUUA 1P1CA 1UBTS 3CH7A 1HNXB 2EJUA 5GZ1A 2GRUA 4OJQA 3MSXA 4Q02A 1AQLA 3NM4A 2QTVB 5HNKA 3KWMA 2FN9A 1MIOB 4XQGA 5JZSA 1GYQA 3CNLA 3ELDA 3AVTA 2HH9A 1V1RA 4LJLA 1W36B 4MKRA 4X8HA 4CMJA 4EEKA 5JYDA 4P4SA 4KV7A 3HU5A 1LSSA 4RQTA 5ALIA 2WM2A 3GEPA 3ZW3A 4HYQA 3FDXA 5FQNA 3Q12A 4UPEA 4WSOA 1CUWA 4FBLA 4G3XB 3W6UA 1TKCA 1MQOA 2R60A 1GPNA 3RPFC 1ZZEA 4L4UA 5I5EA 2QRKA 4MUMA 4H31A 4LTMA 1ZSYA 3B48A 3NBZC 2A4ZA 3LWZA 4H17A 1Y1RA 1EVYA 2FBWB 3GS2A 2DLNA 2X0JA 1RPTA 2VF7A 1SOVA 1PSDA 2WPNA 3RYCA 2H5EA 3DZCA 5AXOA 5EVKA 1OWPA 2GARA 2OCPA 1J22A 5LPNA 1H2HA 3DBIA 3N8HA 3ZHSA 2I71A 1BJKA 1MX3A 4I66A 3IDOA 3NVDA 4DJJA 4FQ5A 5FEUA 4AN1A 4HNQA 3EY4A 3TDKA 3TBLD 4ZOBA 3RVLA 3SEAA 1SXHA 4DLTA 3BICA 3PXCX 2QD3A 1X2EA 2O57A 3SDSA 1O96A 3BGWA 1VECA 1ECCA 4G0YA 3LXMA 2AFIA 1VGNA 1ZUNB 5DWQA 4CKWA 3RNAC 1M94A 1HV8A 1UJBA 2JGRA 3L0SA 1U3DA 4FYVA 1OLSA 5ACRA 1YS1X 5EV8A 1K66A 3W6OA 2Q4RA 3ZXRA 1WZNA 1NQUA 2VZ8A 5LYJA 1QCDA 4MUJA 1DKOA 1OFIA 2II6A 4IFIA 2XVXA 1FQWA 1UFQA 1EU3A 1Y5LA 3KB8A 1XTIA 3P9YA 3IA2A 5AW5A 3LYAA 4I3FA 5E6SA 1USIA 3MJCA 3M6XA 1AHNA 1L8OA 5KYWA 3ZRCA 3Q7EA 2H89B 4BAXA 2J7QB 2O6HA 2FEMA 5F98A 2XKJE 2FSPA 2OQVA 4WNAB 1ZWLA 1RAEA 3OJLA 3IIKA 1E1LA 2X42A 4N0PA 1CY1A 5KAPA 4FN2A 1L4FA 4HNGA 4JWTA 1ZU4A 1JWUD 4HZIA 4YJKA 4MJ7A 3DYBA 3ZU3A 5KJEA 3HH8A 4QDJA 4EA6A 3PHXB 3H1FA 4WLUA 2H9IA 2XNDD 5F9MA 1J97A 1DOIA 4PV7A 2B4YA 2N1VA 1FE8A 3Q72A 1CD5A 1CUFA 4Q7MB 4MARA 1RYYA 4PYLA 3G2OA 3UOAB 1L4GA 2D3BA 1QIJA 2Z8XA 3UENA 3E5NA 5C8YF 2O7SA 2XTMA 1M2JA 3FH0A 5KAMA 2O8DA 4GYYA 3I9NA 2WF5A 3KB2A 1IXYA 2YIVX 3KKNA 3LK6A 5FR1A 3SC3A 3FC4A 1DRJA 1NF2A 5BORA 3RJ9A 2Q6VA 5DPWA 4KBFA 3LDZE 4DW8A 1E9BA 4JKIA 3O83A 3D5QA 1JWBB 1NDHA 4ALJA 2J85A 4FKBA 1S8OA 5AW7A 2BGLA 4R4JA 1KPGA 4JEMA 1IFXA 1NXWA 4B2IA 3O75A 3KOWA 1JVNA 2PJUA 3CUEF 1F6BA 3FRHA 5HJ2A 2VPYA 2BMFA 2XCSB 4NMWA 2K7FA 5BWLA 3DLCA 3DXZA 1F8UA 5T8KA 3TOZA 2OMEA 3V2UA 5CB6A 1ZK0A 4B6SA 3PNPA 3WOHA 1YMHE 3CF2A 2FW8A 3DM5A 3Q6VA 2DUNA 3UMMA 4K9RA 4B3XA 5AW3A 1OH6A 2X8JA 3S2GA 5F1PA 2X23A 1YX5B 1ZAKA 4BJ3A 2ZWOA 1T0PA 2ZT6A 3QHAA 5CB4B 2F3SA 1H0SA 3LZ6A 3RU9A 3FGNA 4JOBA 4HNTA 3BFJA 2GNPA 4D79A 5BUCA 1TZMA 1KLUD 2Y1KA 2O3RA 5D01A 4FGUA 1EJ2A 2X7HA 3FW1A 1R6VA 4RD0A 3B85A 3LX4A 2P8JA 1FQKA 1EK5A 5DI9A 4HY3A 1BA2A 2XT6A 4URHA 1TZBA 2I4OA 1E98A 1BMFA 3FSEA 4V3BA 2CG2A 2E4AA 3VR9B 1CQVA 1K4KA 3TTWA 3OX1A 4NYMQ 3ASZA 2Q6KA 2QSYA 3DHGC 1OU4A 4FMCB 3N0XA 3PV0A 1SKBA 3F98A 5EP3A 4GU5A 2V6MA 3TRDA 4KRGA 5JSZB 3E9DA 2E6XA 3RNLA 3R0XA 5E8RA 1D6MA 1G41A 1P2FA 4PLZA 3GQVA 1C0EA 4WXEA 1V6AA 4B73A 2J87A 3KFLA 3Q5GA 3UPUA 1C3TA 2N9EB 4TLMB 3Q7SA 3IVFA 2OAP1 2Z8YA 2JPDA 5JZ9A 4PF1A 3C48A 5C18A 5E4JA 5BNWA 1KBQA 1DDGA 3WR5A 2C77A 2X7JA 3VPGA 1WX1A 1WMHA 3EAFA 2J0SA 5IYZF 2IYQA 1NG9A 4IZHA 3EVDA 3U81A 4FGJA 1UBFA 2Z2KA 4GVLA 3ZIUA 3UJ3X 1GPDG 2HJ9A 4QM7A 3IAEA 3G5AA 3LC1O 4MH0E 5H9WA 4MI6A 1P2DA 4A82A 1LF0A 3GROA 3N7AA 4QASA 3F5QA 1HMYA 1UM9B 1QKIA 2N9PC 3HDGA 2WJGA 3V6LA 4DNFA 3F47A 3V1NA 1OYWA 3H1GA 1WW8A 3UMSA 3Q3GE 4OBBA 3VNUA 3G2JA 4MM3B 4B17A 4R8SA 1VYHA 4WK4B 3DAOA 1E5TA 3QVGA 4Q4HA 4N8SA 3HSYA 4I4TA 3KHKA 4RORA 1LLDA 1YBAA 3DLBA 3FNEA 1NP6A 3TMYA 5GQSA 3G8BA 4NQZA 3AHDA 3ZK9A 5GZ3A 3K9FC 2A5UA 1FDRA 1TGYA 5LCAA 1D7AA 3LQ4A 4ASUD 2FZVA 4EABA 1IWPB 2CNKA 2FWNA 3K4HA 1CUYA 2QW0X 2W2MA 3HJNA 3WZMA 3X2EA 4MUFA 5IH3A 3PGEA 4JYBA 1YB1A 1CEQA 2VUUA 4O8ZA 1YA6A 1NJ6A 4W8GA 1DIRA 2R7AA 3GB1A 1J8FA 1IG3A 1QZTA 1L4UA 3ILXA 1PX0A 1GPYA 4NBWA 3DMTA 5C5EA 4LG1A 5ARBA 3O8LA 3IVAA 2G1PA 4MQEA 1Z0AA 4NAWB 1AB6A 1ZIXA 5DEIA 1TJ3A 1I0ZA 3AE9B 2HX1A 1TI7A 1Z75A 4NE7A 4YMGA 1TMYA 3OOYA 2CY0A 4RPHA 3EARA 3WB0A 5LN1A 4D4GA 4B4DA 2VT6A 2ZETA 4TM8A 4ND1A 3EISA 2QPLA 4LF8B 2ZZMA 4ZPJA 4MV4A 4IIHA 2R4QA 4IMRA 2QAJA 3AFMA 1M5TA 4RENA 2ZJ6A 4BATA 3TTVA 4CTKA 4N6GA 2OCGA 1X9IA 4EEZA 4KODA 5KTOA 2YY6A 3GJ6A 4FFDA 2VRCA 4EJFA 1I4RA 3KQPA 3ZHVA 1CJBA 5A3QA 3UG7A 2CK3D 1JSLA 2APJA 2JNWA 1NRWA 4P2BA 4KR9A 3T1TA 3DC2A 1EG7A 3JR3A 3WWOA 5G2OA 1QVWA 3E1SA 3VBCA 3HUTA 3F5MA 3V8BA 2FPRA 4II2B 3APCA 4WZAE 3S1AA 1YN4A 4DQDA 3IQIX 5FOXA 1XNJA 4FX5A 4D81A 1ZUWA 3C6QA 2LRUA 1WH3A 3V3KA 2Y2UA 2YXDA 4LJYA 4FIDA 2CD9A 3E4CA 1OZAA 3H99A 2DFPA 5LXIB 5M7EA 3ZGLA 1HH4A 3TJPA 2WWHA 3OZEA 4LQCA 1E7PB 1FJ2A 4AULA 1YFJA 3ZOZA 1VSUA 1GNQA 4YRAA 1N3BA 2PSEA 2DC1A 5B7GA 4JQOA 2R2AA 5BR7A 1G8SA 1E99A 5JNUA 1Z0FA 2NP6A 4IJWA 1NZFA 1LDBA 2HA4A 2J07A 5DPTA 4KKIA 2UVPB 4IS3A 4U2DA 1EFUA 4DQ0A 3TI7A 1J7CA 4OMDA 1SB8A 1GUZA 1QE3A 4EUTA 5JEEA 1QTNA 5CDGA 5LNK6 5K0TA 2YZMA 3AF1A 1I4LD 1JPVA 1L2NA 1E6WA 1XF5L 2J0UB 2FSGA 5CM9C 5CA0F 1OFUX 5GPBA 2IY8A 4ITUA 4LBZA 2DQKA 1R9MA 2PGLA 2Q3MA 2VP0A 2XIJA 1MQSA 2ZYAA 4FEKA 1I51A 3PSEB 5DHRA 1LDEA 1Z8HA 1MO4A 3R6TA 3TWOA 1EE1A 2L83A 4CKBA 2CHZA 4NMXB 2ZROA 2GETA 4B35A 4PANA 2FI1A 2ECQA 1XB2A 2PKXA 4Q15A 2FU5C 1J2RA 4JI5B 1XTPA 4WURA 4HRVA 5JH7F 4JB8A 1WPRA 4MV6A 1SBBB 3U3KA 2XHZA 3HR7A 3FKSD 5ICCA 3AEGB 1GPXA 3BA6A 2UKDA 1QHHB 4DR1B 4PYMA 4TWZA 4M0MA 3NXKA 4G23A 1TT7A 2JI6A 4RJIA 4GP6A 1T13A 4LRUA 3PQ6A 2WHYA 2P18A 4FUQA 3H13A 4KXNA 1OTXA 2QSJA 2WFZA 3NQ41 3KXDA 1N2JA 3RF7A 4RA9A 1Y9ZA 4KBYA 3LQ1A 3KM0A 1RLJA 4PSCA 2XF8A 3WAJA 1Y3DE 2HQ1A 2KI5A 1MRNA 2C2WA 1W88B 3IA7A 2BELA 4X1KA 1UJ6A 2QX8A 3X1YA 4MWSA 4G9EA 1P61B 2C59A 3VSAA 4KFRA 5A6SB 3UB2A 2GXQA 2OKCA 1QO9A 3SEFA 4Y18A 4RHCA 4AYXA 3L77A 3RREA 1F2UB 4NJOA 4E5UA 3C87A 3RIHA 1XA4A 4R7GA 1YDEA 2CLIB 3GRUA 4D6YA 5FWAA 2ZDQA 4CR6A 1P91A 3KVVA 1PJLA 4X63A 4EHHA 3C4QA 2RBEA 2X1MA 1YA4A 2XZOA 2MJEA 2GLSA 3IJEB 3P0EA 4HRYA 1F0NA 3IULA 2NYPA 3SBEA 1FNUA 5YASA 1J8VA 4HATA 2DB3A 3QKSB 3ENEA 4NJ7A 3OURA 4BZZA 5JRZA 1TS5A 4W9FA 1Q3KA 4HDRA 1PIWA 1CDZA 1P1JA 5EFOA 5CDSA 2J45A 2J8ZA 2C0CA 4UCWA 4EE2A 4D8VA 4Q9HA 4UOEA 3L6EA 1L0VB 3L6BA 1EVJA 1SXIA 1YQ9A 2GCIA 3H5TA 3AHGA 1JYEA 2O0KA 5JRJA 5ACXA 3K70B 4YO7A 1FDUA 3DEIA 3GRFA 1ONNA 3ICWA 3KUXA 3E82A 1PD1A 3AZQA 1I7LA 5M5BA 2BBWA 4YP9A 1AYFA 1XLPA 3GPBA 4EQ6A 4C1NA 3W1VA 3AY0A 5FNVF 1B3BA 4OX9Y 4CIWA 1MC1A 2VUHB 2ZREA 4M0DA 3N5KA 1ZBDA 1YQ4B 2KT7A 3ZZUA 1JKIA 4JB2A 1PJ2A 3B38A 5H59A 4EHDA 1EF1A 4JR2A 4DDMA 3G2HA 1NE7A 4J4BA 1JXQA 1MORA 1FX0A 4AURA 1CQXA 1TA0A 1FLVA 2IC5A 3A6EA 2IUUA 2GHTA 3ROKA 4UAMA 3QHQA 3N8GA 1OFHA 4OHXA 1VPWA 2CNOA 2JZOA 3R20A 2V4LA 2NXJA 3VX4A 1RQNA 4IXDA 4B8WA 1UDRA 4LYJA 2KTRB 3FCSB 2HB9A 2G8NA 3K35A 3L9WA 1RXWA 4A1OA 1KO7A 4UTVA 5E7QA 4X5OA 3KLSX 5EKTA 4YMLA 2CHEA 4EA8A 1JIUA 2OBXA 4JCCA 5LNK1 4FKMA 4DTCA 2O5EA 2IEZA 3C6XA 4NEGA 4P54A 3RNBC 4W7HA 4L75A 2BIBA 1TZOA 1KDOA 5JO9A 1UBQA 4QULA 5BR4A 3SQXA 4HD8A 4RTKA 3GFQA 1QH8B 4NCJA 6NULA 2HF7A 1GKKA 2NXNA 1G18A 3TJRA 5AZFA 2GSWA 5FTKA 1YJQA 2IOQA 3WAOA 3WYBA 2REQB 4CR7A 4GMHA 3AM5A 3OE7D 4DWWA 1P1HA 3SYNA 5K9ZA 2DFLA 4IDQA 3HR8A 1EUVB 4MACA 4PYQA 3RIMA 1DQPA 4WIAA 5J5AA 4N3GA 4C3UA 4B0EA 2R8OA 1SXGA 5IQKA 4FW9A 2Z9CA 5C35A 3ZGZA 4Z2AA 1DQSA 2VH5R 1JI3A 4OXYA 3QEMB 5LU9A 2VBCA 4E15A 3CPSA 2JCSA 4QNNA 5EJGA 3UINB 3WLJA 4MSMB 3DLPX 5KDDA 1GM5A 2C9DA 1H8EA 1QFMA 1A4IA 4LJPB 3DEFA 1KRWA 3NX4A 4QUIA 1C3VA 5FPKA 3WWDA 2W43A 4EW1A 1N63A 4LN1A 4NZNA 3B1VA 5CT4A 4BL5A 1AGRA 4WKCA 1T0IA 2OCXA 1ENPA 3VAYA 2OCAA 1MHTA 5LLTA 4R71A 4PPNA 4IIJF 2I2DA 2YZNA 3DW3X 2P27A 3JCZA 4EKGA 3R5HA 5IFLA 4ZHSA 5FOQA 3TZQA 1BSVA 3WFJA 2IEDA 4TTTS 1V9JA 1JFTA 4MWOA 5HA5A 3KXKA 1CUIA 4PX9A 1VHWA 5EHNA 5EJ6A 4P33A 1ZQ1A 2AIRA 3TINA 3F49S 2MW5A 4HAOA 5IT9A 2YXPX 5JI2E 3SHQA 2EZUA 4P7GA 4DJFC 4OHCA 2WJYA 4DKXA 1XC7A 2A33A 4HLCA 4DEVA 4WD6A 2ZYSA 5MFZA 3DO6A 1XVTA 4KQMA 4JI0B 3VUYA 4TL7A 3ZWVA 5K0GA 2FW6A 1H85A 1X3LA 4A2CA 1WDWB 3C8ZA 1JG3A 1JUDA 5E0KB 2BFMA 4HWIB 5CD1A 4W1RA 2VDPB 1XEEA 3RSSA 4RGVA 2ZB2A 1Z35A 1SXJB 3B7WA 4INJA 1W34A 3G5TA 4BV9A 3DBHI 3RVSA 3W06A 4V39A 3C6ZA 1JEEA 3ICEA 4ZEWA 3SXJA 1E92A 4ZHPA 1NULA 1PX2A 1IMOA 2AQ3B 2D06A 3ZNQA 2H4WA 3N75A 1LB1B 3DT6A 4DA8A 4ZODA 2ZSIA 4U0JA 4I3HA 4D97A 3U7QB 5AIBA 4O1NA 3UQBA 3GBVA 5B1YA 4V03A 1T1EA 5KYUA 4D26A 1Z2DA 1CS0B 3BF8A 2DAFA 3D6NB 3H4VA 4S0ZA 1L5FA 3TMKA 2NV2B 2WXHA 1V86A 1THTA 2XV1A 1JZTA 3UJBA 5C8ZA 4HQOA 1NBME 2AQ1B 4W5RA 3MJRA 1NNI1 2L0FA 4HXYA 4CDGA 5E0OA 4HDNB 2XNKA 3QW4B 1JXOA 4K5QA 4CF5A 3DHNA 2YZ3A 4H08A 4M54A 1E8WA 4KQ9A 3TIFA 3X1JA 3GJZA 1T1IA 4BZAA 3AY6A 5F4ZA 3A1DA 3OQMA 3DONA 3ROPA 5E6UA 2IELA 2OT3B 2FE4A 3Q6BA 4ITVA 4D3ZA 2W8BA 4NQLB 4HLEA 2P90A 3H65A 5JBQA 1E3TA 3ND8A 1XPUA 2PE6B 3PDHA 4H6VA 5LSAA 2PMCA 4OAPA 4QGAA 2HWKA 3KCQA 4LMRA 4MLZA 1G0OA 4WZBB 2OJRA 3KSUA 4ER0A 2PE5A 5BYJA 2MSDB 3LKVA 2FY8A 3FOBA 1TYAE 2A9QA 1MG8A 4Z7NB 2EKIA 5FBKA 3SE7A 2HMTA 4R54A 4EQZA 4ZOLB 5J2UB 1EQ2A 4BNGA 5CLIA 5A3RA 5BW6B 1KKUA 4NBUA 1ULSA 3ET4A 3L0ZA 3DYVA 4BAGA 2N9KA 1QE0A 4MV3A 3LAWA 1K86A 1R8QA 2Q29A 4RVUA 4S05A 2OWDA 4BO0A 3U13A 4NE9A 4J3FA 1GUFA 1DJMA 4MB2A 2OKGA 2GM9A 1NBMD 4I7EA 3AJ9A 5KJ6A 1MJHA 1IE3A 4UCXA 4NZ9A 5AJZA 2EATA 1KM7A 2GWHA 5LA6B 1XUOA 3U62A 1VL2A 4X6YA 1NXPA 3OFVA 4YAKA 4MS4A 4HDKA 5BN4B 3KBBA 4F3RA 4E70A 1FJXA 2L2QA 1H9BA 3V4VB 1PTKA 2L0TA 4PS8A 1NR5A 2Y92A 3CR3C 2CMGA 1JI0A 1E3DA 4UQPA 4RIGA 2XCRB 1DO0A 1T9CA 3AQIA 3E9ZA 4YQZA 2SNIE 4BKSD 4EY8A 4ZYZA 1LSJA 1GN8A 2FUG6 1RVDA 2IZVB 1FXSA 2QTWB 3DZHA 3GJ0A 3GCGA 4P0TA 1GFZA 3E5RA 4XR9A 1YD8U 5J63A 4PTZA 4TS9A 1J5EB 3BDAA 1HDEA 4KGDA 4OYHA 1CZPA 5ACPA 1RWMA 4U00A 1YCHA 2QENA 4GNKA 1RRVA 4ISCA 2BG7A 2I1QA 4F4CA 2Q3CA 2ORIA 1JR4A 5F4BA 4I55B 4EPWA 1WU8A 3UGQA 3VRHA 3B3QA 1AUXA 2I7TA 1PFQA 3H5VA 2RCNA 2GGSA 2Z56A 3I4LA 4KUHA 3AH8A 5G0TA 4UAJA 4MQBA 2FX2A 4LCDE 4N0QA 1MTZA 3FAZA 4L57A 1NVXQ 1EVQA 1SIFA 3PHJA 4DOMA 4I1IA 3M95A 1O1YA 2VJCA 1MA0A 6REQB 3H6HA 2J0VA 4U2GA 1U7OA 2ANCA 5DT2A 3ZCUA 3DAGA 4ZZ0A 1SIBE 3CPEA 1IB0A 3R6DA 4C3OB 1YZLA 4KX6B 2RHRA 1TC2A 2O8BB 4O4LA 5FADA 3H2SA 2OP1A 3F6BX 4POAA 4QQ8A 4TKVA 4GDLB 2JI7A 1XNRB 3HYNA 1GEGA 3MIZA 1VIAA 4NBNA 4OW0A 1LDGA 1WZ2A 3GI1A 4NYIR 3BFXA 1BDJA 2KLCA 1NNEA 3DHHC 4LISA 1GTRA 1HZ5A 4C1FA 3FYUA 3NHRA 2WHXA 1JEYA 4AD9A 2IWRA 3H1UA 4V0LA 1BWSA 3U3ZA 3RS8A 4Q93A 1R4MB 2WS3B 4M01A 1IHXA 2WDTB 2GFQA 1GTVA 4LHWA 4U7PB 3ZQKA 1I0LA 2WSLA 3AX6A 1KRXA 4O2BF 1SBNE 1TQHA 3F7TA 1QGAA 4NFLA 3Q87B 4DIMA 4G0PA 4F5DA 4GPD1 5HPYB 3SYMA 1U9JA 4QXRA 2XWPA 1ZR4A 3R8FA 1I2CA 2ONZA 5A05A 4G50A 1U9IA 4BBPA 2WKSA 3KFVA 4QLAA 2LCQA 2AX5A 2ATVA 1U6KA 5TMPA 4ER3A 2P77A 4EO9A 4UHBA 2JGDA 2H52A 3OAAD 1Z4PX 4L07A 1EXDA 4FCWA 5T4FA 1CUSA 3I1IA 1CK4A 2NUPB 3ES9A 1DT5A 3SEBA 2JHFA 2C8KA 1BNCA 3SC6A 3GQBA 1FNBA 2WINI 3OTHA 2RONA 2UYQA 4RGOS 1QQ5A 2O8CA 1R10A 3C2QA 2NYAA 4CEJB 4BN4A 3ZXUB 3NGXA 1FUKA 5B6JA 1QGED 4EHLA 4CGYA 3P2EA 2YC2C 5ACVA 4UNSA 4OP1A 2BG8B 2KHZA 4AZVA 4MJSB 3HM3A 2INCC 3D32A 1T9BA 2CZCA 1MT3A 3V8NA 5EJ5A 5ESDA 3WYGA 2A7XA 3KYCA 2EQAA 3UAVA 1HDOA 3TQTA 2FPOA 3K5IA 3GDHA 3KW5B 4Y3UA 3A4SC 3BSYA 1FXWF 1OR8A 5EYPB 2H59A 2PUCA 3EZLA 3LWBA 3QOWA 4JP3A 3JQBA 5IN5A 2O48X 2EX1A 5FBRB 4IF6A 3VNRA 4YRKA 1Y5RA 2YN0A 1VYUA 1S1MA 5DM1A 3AUTA 3L0CA 1C30B 4NNPA 2O2GA 5KNBA 3KWVA 3RIEA 5C2TB 4R3NA 2PMWB 3ZCRA 3NTRA 4XE5A 5JV5A 2IZ0A 3NHMA 4ZYYA 1IXKA 3EZXA 4KDFA 1SMLA 1R64A 2G4CA 3H1PA 2J31A 1GZSA 4MW5A 3BSWA 5BV0A 4ZYSA 4Z67A 1WR8A 1DEOA 2QTRA 3T99A 4AZ3B 1UJ5A 2XTJA 4F6RA 4NV3A 2Q41A 4MV7A 1RNLA 2OG1A 1X1RA 2BAGA 2WJIA 2J7PD 2C88A 1PUJA 3H2BA 5JNLA 1E1MA 2WIKA 3LB8C 1E63A 3AV3A 1SCQA 4K81B 3CM0A 2AF4C 3DT8A 1SU4A 2ZU6A 4C1HA 2H11A 2R65A 5KIAA 2FX5A 3O2JA 2HSWA 3FNBA 1T26A 2V3NA 1F3LA 4QOIA 3K0CA 2XJ4A 1A8UA 1BFUA 4BDTA 2AUMA 4RWZA 2FUG1 2P62A 1QG0A 3N8DA 2JL1A 2V1YA 1BEEA 2V3CC 3A8TA 1G8JA 2VNIA 1ZD3A 4WIPA 2HC9A 1SKQA 1WDTA 5K0WA 1X8LA 1T1JA 2ZUCA 2AR7A 1MZPA 4GDKA 4X3PA 3FPEA 4PIMA 3M63B 4RKFA 3C15C 4P34A 3K1JA 1WRIA 1WXHA 3UKOA 5F7OA 3UJ8A 3IP7A 4FBGA 3A9VA 1DAIA 5H5JA 3DVGY 1CPYA 3SZLA 3O3MB 4X00A 1FNSA 1RI3A 4WWHA 3PY6A 4GYJA 1EFCA 3KDPA 5TARA 2WAAA 3N2YA 2XUJA 4E2FA 2IGHA 5LBUA 4RNAA 1L8QA 3HVUA 3RUDA 2CNNA 1AW7A 1D5WA 1PT8A 2O8VA 4AV7A 2GBGA 3ETGA 2L05A 2NCNA 1YA8A 3KSAC 2N1MA 1WOMA 2F8TA 4JLOA 5JJLA 4W9MC 4KRFA 3MPOA 3V32A 2KSQA 3FMPB 4JC0A 1IWBB 3OQOA 2WJVA 3CURA 3KT3A 2M6LA 3MUOA 3N5CA 1EDOA 5ACSA 5E1BA 2EW2A 1IHPA 3PHCA 2C20A 3LZDA 5F2OA 2REXA 3L54A 3WLNA 5T41A 1HE3A 4UE2A 3MFGA 3BDIA 2GFHA 1PS9A 3ACCA 2J5KA 2F3PA 1Q1QA 1GC7A 1TMGE 1P44A 3GRAA 3DNPA 4R9VA 4PG6A 3DZGA 2F55A 1I4DD 3KUDA 4RVDA 4CMCA 3N2ZB 2QU8A 1YB2A 3DKPA 3OIFA 4L85A 4LIPD 3UK1A 4JOSA 4B6WA 3RTEA 5JO0A 1CIPA 4ZVRA 1FMTA 1QV7A 3OZWA 3RGGA 4JS0A 2VSYA 3X2SA 4DUZB 4AN4A 5KOHB 2BSAA 4Q9IA 1Z33A 3V1TC 1Z7BA 3CWIA 1DUVG 1YK0A 3B36A 3W2DA 4WL0A 3AVWA 3W3ZB 3RK0A 3PS6A 5K0CA 1BGXT 3I04A 3GNSA 1DIHA 1C1YB 1LI4A 1S7GA 1Y63A 1KH1A 3AT1A 3PPIA 2R61A 3WLMA 2G40A 2YDYA 4JLVA 3D3JA 1KQFA 2V4UA 3I2YX 4F3KA 2IUEA 4MW4A 3G85A 2EQ5A 3MC0B 4LDAA 2N42A 5A04A 3OFND 3I8SA 2R8BA 3T38A 3KUCA 4MRRA 4U39A 3J81k 4KQ1A 2WKWA 1X42A 5KNDA 1DRKA 5FPPA 721PA 1DAHA 4YFVA 4P7IA 4UBKA 3GLFA 1TKEA 1D4BA 3KDAA 3SIWA 1CIJA 4G1EB 1CY8A 3MAAC 4OI2A 2X14A 1R9GA 3UIPB 3NWPA 1W6UA 3YASA 4L0CA 2YC4C 1VD2A 1W5TA 5HS4A 4N6NA 3OJFA 3ONVA 4B87A 1XKXA 4LYGA 4KEQA 1RRKA 3GW8A 1Z3IX 3MA0A 2QMEA 3UJAA 3NJ4A 3AUSA 4WAUA 1RXUA 2GHQA 3LUCA 1H2EA 2PX3A 2OMKA 2QX9A 3E48A 4IILA 1KDVA 3HO6A 3L10B 2UVQA 2GCOB 1ESNA 2GN9A 3UWDA 3RODA 5BVGA 1LVGA 1QRUA 2NZXA 3GGJA 2L52A 2JLBA 4DMKA 4DC1A 2FFHA 2V58A 2ZVDA 4TV9F 1Z3CA 5AKYA 4ZDIA 4B1FA 3QXJA 2QBYA 8GPBA 4V02A 5H7XA 4WFIA 5JQGA 5TNXA 2LZ0A 4MUXA 4CF4A 5D7GA 3L6RA 2XW6A 3AG6A 3UGJA 1T6NA 3UZUA 3TXAA 1XELA 1FFXA 2CG3A 3UPTA 5HKHA 1PV4A 2BFKA 4LSZA 3JWJA 2V7PA 3LU1A 3HB7A 5K4HA 3KL2A 1R37A 1HK7A 3RNOA 1MLDA 4JDPA 4RTQA 1FYXA 3LGSA 4NXNB 1U4OA 1XK6A 1AIPA 1R6DA 3PIRA 2LRHA 4RX1A 3B78A 3ZGYA 2GFIA 2IP4A 1G19A 3G1WA 4GSYA 3OCJA 4AMUA 1F3OA 3EWIA 3FZYA 1JILA 5EP2A 3PT9A 1L4LA 3JALA 4QHYA 2ZBFA 1A04A 3IXSA 3FUUA 2X3YA 1X13A 1M0WA 4ZCLA 4QE3A 3TR6A 3WK4A 3TOVA 4K6OA 3PXEA 3QNWA 2BGTA 1VRVA 3THSA 1OC2A 1POXA 3IESA 5KDOA 4BLUA 5GJBA 4OI4A 1A9SA 2IHZA 4CE6A 1GA6A 1II9A 4MVYA 2XK5A 2ZW9A 3EUB2 1YONA 3SXUB 2V54A 5HQJA 3KC2A 3AESA 4B31A 1EK0A 3D6FA 4XM1A 3RZFA 5LD2B 5C81A 4JZYA 3UB4A 1T4CB 2IUTA 1UXHA 2KE5A 2VZ9A 1VFPA 3FGPA 3NHLA 1A71A 4PVDA 3L7NA 1J0AA 3CF6R