3BK1A

Crystal structure analysis of rnase j
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
551
structure length
551
Chain Sequence
GPQDHVEIIPLGGMGEIGKNITVFRFRDEIFVLDGGLAFPEEGMPGVDLLIPRVDYLIEHRHKIKAWVLTHGHEDHIGGLPFLLPMIFGKESPVPIYGARLTLGLLRGKLEEFGLRPGAFNLKEISPDDRIQVGRYFTLDLFRMTHSIPDNSGVVIRTPIGTIVHTGDFKLDPTPIDGKVSHLAKVAQAGAEGVLLLIADATNAERPGYTPSEMEIAKELDRVIGRAPGRVFVTTFASHIHRIQSVIWAAEKYGRKVAMEGRSMLKFSRIALELGYLKVKDRLYTLEEVKDLPDHQVLILATGSQGQPMSVLHRLAFEGHAKMAIKPGDTVILSSSPIPGNEEAVNRVINRLYALGAYVLYPPTYKVHASGHASQEELKLILNLTTPRFFLPWHGEVRHQMNFKWLAESMSRPPEKTLIGENGAVYRLTRETFEKVGEVPHGVLYVDGLGVGDITEEILADRRHMAEEGLVVITALAGEDPVVEVVSRGFVKAGERLLGEVRRMALEALKNGVREKKPLERIRDDIYYPVKKFLKKATGRDPMILPVVIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights into the dual activity of RNase J
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
molecule keywords Metal dependent hydrolase
total genus 167
structure length 551
sequence length 551
ec nomenclature ec 3.-.-.-:
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bk1A03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 3bk1A02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3bk1A01
3IDZA 4V0HA 1VGNA 5AXOA 3FCZA 5LM6A 3IEMA 5LS3A 1HLKA 2QEDA 3JXPA 4DIKA 3H3EA 4C1GA 3KNRA 5IQKA 4GCWA 4D02A 2BG6A 1JJEA 2NXAA 5ACSA 5K0WA 1K07A 4UBQA 3ZQ4A 2AIOA 4JO0A 4RL0A 2YCBA 5EVKA 4FEKA 3SD9A 2Y8BA 1VMEA 3MD7A 1DXKA 4Z6XA 1X8GA 4TZEA 4C1EA 2M5DA 4FR7A 3S0ZA 1KO2A 2WYMC 5HISA 3TP9A 5FQCA 1X8IA 4C1DA 2P1EA 4DILA 1WUPA 2BMIA 5HIPA 2OHJA 4HL2A 2WYLA 4HKYA 4HL1A 1SMLA 4Z5YA 3KL7A 2M5CA 1P9EA 3RKJA 5A0VA 4AWZA 3VQZA 4KEQA 5FQBA 4C09A 2GCUA 4YSKA 2WRSA 3ESHA 3RPCA 5KILA 4CHLA 2P18A 4TYFA 1BVTA 4NQ4A 3AF6A 4ZO2A 5HH5A 5ACUA 4UAMA 5LCFA 4TZBA 2HB9A 4YSLA 1L9YA 3IELA 3SRXA 1XTOA 5LSCA 2Q0IA 3R2UA 4O98A 2BIBA 1WUOA 4D1VA 2H6AA 2OHHA 3IE1A 2DKFA 5EWAA 3SPUA 3IOFA 4F6HA 5K4KA 2QDSA 5EW0A 2BC2A 3WXCA 2QJSA 1QH3A 3X2YA 2YNVA 2FHXB 3X2ZA 2BFZA 1JT1A 1WRAA 1JJTA 1BMCA 2Y87A 4C1CA 3T3OA 5ACPA 5HH4A 2ZNBA 3DHBA 3KNSA 4XWWA 4EYFA 1KO3A 2XR1A 5K4MA 2BFLA 3T3NA 2YNTA 5A87A 2UYXA 4NQ6A 4TYTA 4RL2A 1ZKPA 3P2UA 5AHRA 5AYAA 4D1WA 5EV8A 2NYPA 2XF4A 1BC2A 1DDKA 2YZ3A 4EYLA 5ACWA 2ZWRA 3LVZA 4AWYB 1DD6A 4KEPA 1WW1A 4TZFA 5AHOA 2FK6A 4Z7RA 1MQOA 2DOOA 2A7MA 2Y8AA 4EXSA 2R2DA 3ADRA 1E5DA 5B1UA 4Z67A 1ZNBA 3SBLA 3L6NA 2BR6A 4ZEJA 2FU7A 1ZTCA 2Q0JA 1VJNA 5B3RA 4C1FA 4AX1B 5FQAA 3DH8A 5B15A 5A5ZA 4F6ZA 5LCAA 3I11A 4XUKA 4FSBA 3BK1A 3G1PA 4ZO3A 2GMNA 3ZWFA 4RBSA 3X2XA 1A8TA 4C1HA 3FAIA 2BFKA 5ACVA 3DHAA 4AD9A 2BTNA 4D1TA 5ACXA 5KIKA 2I7VA 2BG8A 2P97A 3QH8A 4D1UA 3AJ3A 4UWSB 1A7TA 5ACTA 4H0DA 5LCHA 4UWRB 2GKLA 5EVDA 2CBNA 4NQ5A 4GYUA 4NQ2A 2WHGA 2FU8A 4ZNBA 3IE0A 2GFKA 4XWTA 2P4ZA 4EY2A 4UA4A 4YSBA 2Q9UA 5EVBA 3I13A 5HIOA 3SFPA 2BGAA 5LMCA 4EFZA 2FM6A 2NZEA 5EHTA 2I7TA 2FU6A 5HH6A 2YNVB 2BFZB 5ACRA 4RM5A 4WD6A 3PG4A 3BK2A 4Z60A 5K4NA 2YNUA 3I0VA 4TZ9A 5EH9A 2I7XA 2QINA 1YCGA 5HIQA 5DPXA 1YCHA 4PVOA 4PVTA 1KR3A 4BZ3A 3PY6A 4U4LA 5EV6A 2WYMA 1XM8A 5LE1A 2FHXA 3ZNBA 4GYQA 2YNWA 2Q42A 2GFJA 5LLDA 3A4YA 3PY5A 3X30A 3ZR9A 4B87A 2BG2A 2OHIA 4RAMA 2E7YA 4P62A 5ACQA 4EYBA 3RKKA 4J5HA 4EXYA 4Z5ZA 3SW3A 1YCFA 2QDTA 3BC2A 3IOGA 2AZ4A 4J5FA 1QH5A 2BG8B 4BP0A 5AXRA 5A0TA 2BG7A 5AEBA 4LE6A 3I15A 3I14A 4UWOB 2ZZIA 3F9OA 3IE2A 2ZO4A 1X8HA 3AF5A 3BV6A 3DHCA 3IEKA 4AX0B 2FU9A 2VW8A 2NZFA 3VPEA 3T9MA 1M2XA 1Y44A 2YNTB 3Q6VA 4UWPB 4RAWA
chains in the Genus database with same CATH superfamily
3JD0A 3FNRA 1W1UA 3RK0A 4RTQA 1O4WA 3NC0C 4HQKA 4P7FA 2ZJAA 2LKDA 3O4IA 1L5SA 1OMOA 4YRGA 4K7UA 4DV0B 4Q1BA 1ZD3A 3QXJA 2C7GA 4B17A 3H4MA 5JZSA 3M81A 1B3BA 1WVMA 3OMXA 3OZFA 4DR2B 1S1QB 3R3VA 2JSVX 5K20A 3AUTA 3NHMA 1N92A 4M55A 4RHFA 2EP8A 4W5OA 1FP7A 1BGXT 1SBHA 2GHRA 2BEUB 2LNDA 2W8BA 4GMHA 2JF5A 2JBAA 2X3UA 2G9VA 4JNKA 4ZO9A 5DB4A 1PJLA 4R9UC 1N8KA 2C07A 4BMCA 4HH4A 1RQGA 3R8XA 5IVIA 3W1SC 2PXXA 4YMSA 5T6BA 2OD9A 4FLMA 4P4TA 5F33A 3PX2A 3RTGA 2PSSA 3DYBA 5HS4A 2W2OA 4QEZA 5F73A 4WESA 1U0SY 4IDEA 2G88A 4P4SA 4BN5A 5J47A 5GONF 3KOZA 4RXMA 4JSTA 1X80A 3B7WA 3WJ7A 1BXGA 2PJZA 4DUGD 4CIDA 1W581 3E3MA 1MC5A 2BSAA 4OA5A 4WJZA 4DNPA 5DYIA 1ZN7A 3WK6A 4ITRC 2W0SA 4B6EA 5KNCH 5LP6A 4FEKA 1LNSA 3AHCA 2BR5A 1VMEA 3ROFA 3ZOZA 4PYKA 1O9HA 2VUSA 1PJQA 1UDCA 1P1AA 3QKTA 3G0CA 5CEFA 4DB4A 1NBHA 1OREA 3FBTA 3LFTA 3UHOA 4CQLB 4HDKA 3D2LA 5HBRA 3SSAA 2VT6A 4RDXA 4F8CB 3MERA 3UK0A 4AKHA 4P38A 2ERYA 4G1EB 4BLTA 2VP4A 1QPBA 1TJ5A 2OV8A 1USGA 3DDZX 1P7WA 2LGSA 3K9LA 3M4NA 1UFOA 3M89A 1T24A 3Q8XB 4NJEB 4D9KA 5KHLB 3MGKA 1UJ5A 2X6TA 4YWGG 4CDMA 2Y2VA 3DXXA 4CQMD 1QVZA 1Z6TA 2QJLA 1Z68A 4N01A 4IY1A 4HDQA 1TKEA 2WSIA 5BSHA 3KUZA 7ABPA 3BDAA 2ILTA 1EQ2A 2Z43A 2KZRA 3EVZA 5CAEB 4DBLC 1N5DA 2O8FB 4G84A 1WP4A 2NV2B 3KYDB 3O8QB 4CGZA 5GONB 1XQ6A 3B7GA 4MRSA 3RG2A 4JKOA 3QFCA 3GZNA 4JX8A 4OSPA 5C0OE 4PYQA 3WNVA 1T1RA 4BUCA 5CDUA 4G0VA 3VR4A 1VHJA 3K0SA 3A1CA 1CERA 1B6RA 5B2ZA 4KIWA 4ARCA 1QC5A 4MWZA 5HQJA 4IIJB 1KM7A 2Q28A 3PPIA 3EQ7A 1KTKA 1T8SA 3PZRA 4WV3A 4DEYA 1EI9A 4EZLA 5I47A 1JKMA 1KYXA 4OGLA 1EX7A 1MENA 3BHIA 3QVJA 2AYYA 1DQZA 3VOSA 4LQCA 2A5FA 1NMQA 2JFBA 5TY0A 3B12A 1YZLA 2XWPA 3OOWA 4JC5A 3LVBA 1DC4A 3R5HA 4EAQA 1PFGA 3LJ3A 1F0PA 1ZL2A 3VTWA 4YMWA 2PH7A 4MP3A 1SCQA 4YRKA 1VZ8A 1E7QA 2CXSA 4C06A 3LQ2A 1ADBA 3OOEA 2X9VA 2XBBC 1J49A 3B36A 4FNOA 1ZHOA 1KQ3A 1PBTA 1KYZA 5KNCA 3JARB 2ZJZA 3MGAA 4BOSC 4IKGA 1EPUA 1GXSB 3R75A 2AG8A 3BH7A 4E21A 1D2HA 2YIMA 4YUAA 1UK7A 2FCQA 1LI4A 1QR6A 2X2FA 2QD5A 3QVGB 5E38A 5IZCC 2WG0A 1OYOA 1YULA 2CLKB 3DYVA 3FHOA 2N3ZA 4G8DA 4R2XA 4XEUA 2SCUB 4KXVA 5B3KA 5BV8A 1ZG3A 2A0UA 4GM0A 1FXIA 3FVQA 1XAJA 4H4EA 5AMXA 2P7HA 5E2BA 2P40A 4NE9A 4RH0A 3U37A 4BMPB 4OZCA 1LJUA 3IBYA 4HWPA 3ZQJA 3U1BA 1KLGD 2ZRMA 3RAFC 2FFAA 3EMDA 2HD5B 4MUXA 3NC4A 4DRYA 1QMGA 4EITA 4BY9E 5LD2C 4EX6A 3HVJA 1K9SA 1P8AA 3K3PA 2J45A 3BJEA 1ECGA 3GDGA 3N2ZB 3NT4A 1RHUA 5ENZA 1L5HB 3ZWNA 1CDEA 3GNSA 2C4MA 1KK3A 4ZDWA 2HJGA 1SVKA 4NONA 1E64A 1OE0A 4ZA2A 3WLFA 2BW0A 2CFIA 2BTEA 4LV5B 1TTTA 4KXWA 1WE6A 1IL0A 1FQWA 1QLHA 1Q0LA 3CO0S 3OY7A 3QKWA 4E74A 3V7WA 4PIMA 1F0YA 1PNTA 5H92C 4NFHA 3WC4A 4BUJA 1OXTA 1C2TA 3KFXA 3H2IA 3C7CB 3SYKA 3P9RA 4C7KA 1N2HA 2I4RA 3IQHX 4RJ2A 4Y9TA 4H4CA 4DE5A 4AN0A 1YFJA 1GV0A 2Y6VA 4ALMA 1RP7A 4FFPA 4MDHA 2E0IA 4MLZA 4TMFA 3KT6A 4DPKA 1R7SA 4UE2A 1U5CA 5EJEA 2D2VA 1WJ4A 1EWRA 3PRYA 2HQOA 3RSHA 2GTHA 4N58A 1NW3A 5CFLA 4E7OA 1HDRA 1H42A 1QYDA 3OLVA 5K3DA 3KVFB 3ZTDA 3Q1LA 1VR9A 1V43A 3DKVA 3NHBA 3N2GB 1V1PB 2BBOA 1IN4A 3R6GA 3L7YA 4TKLA 4LWOA 5EP2A 4B3DA 1E0ZA 1ZJZA 2OMKA 2GVZC 1NSTA 4NQRA 4GI3A 2C29D 1LCIA 1A9QA 1XELA 2C94A 1SE2A 1EFRA 2ORIA 3DWFA 4WZAA 4YA6A 2C2YA 4A0RA 1FNDA 4FFVA 2F4VB 5BSTA 1QP0A 4DLNA 1KVQA 2QC8A 3I52A 4O33A 1OGWA 4D9GA 1QIHA 1OF1A 3TSSA 1RWOA 3EK2A 3MMNA 3TZ6A 2VSYA 4OOFA 1U80A 2RDGA 1R0ZA 1GNTA 2E55A 3VC1A 1R4MI 1S2MA 4PHCA 4HGPA 1MMFB 3UC9A 5B1YA 1FX1A 3RNEC 5H80A 1Y7IA 2GPYA 4D3SA 1ZCJA 4OPMA 3OBBA 4BWYA 4D9FA 3G9UA 4DR7B 4PQFA 2BFZA 4GZ3A 5ICCA 2JGMA 2ODPA 5HG0A 3T9BA 1GQRA 2FRXA 3H11A 5CDTA 2O6LA 2WDVB 3ZEAA 2AJBA 4AP9A 2P5UA 3HWX1 4NZLB 3O4RA 5DPTA 4K6MA 5AVQA 1XTBA 1WI0A 2I91A 1OKKA 2EWMA 1V7CA 4B3MB 2H7VA 1YMQA 1HRKA 1N6LA 4K6KA 1V37A 3VX4A 4P4UA 4GL4A 5LP1A 9GPBA 4CEHA 2ZIAA 2ZRQA 4H7JA 4EYFA 3NTLA 1ZU4A 3VR5A 1FPYA 4RJTA 1ISNA 2O6VB 4NDAA 1T1GA 2CU3A 4PHGA 2Z5GA 1QMPA 3DDCA 5A87A 1SUWA 4K46A 3TSOA 1PEDA 3S8YA 4YB8A 3RNFC 3M4ZA 3BE4A 1WXMA 2Z6VA 1EFPA 3WGUA 2BDEA 4XUDA 4LGYA 2PX2A 4EI2A 4UTXA 4OAOA 5T41A 4DLUA 3GBSA 4ZMBA 1EE9A 3PF9A 1FW6A 3AEXA 1Y9JA 1L5PA 5E0OA 2CDNA 2UYHA 2NYPA 3V1LA 1UBEA 3GPIA 5CTRC 4NNJA 4D46A 2BKLA 2REQB 2HHLA 3F71A 4F6RB 3CNBA 1DIOB 1AKRA 3C5VA 4MVXA 4BVUC 2EJWA 1L4FA 4JP8A 4LMBA 1L5FA 5CLLA 2FP4A 1D5XC 4P3KA 4HG2A 1EWVA 1UBLS 2BKFA 1RHQA 1KEVA 2AC4A 4JMLA 1IPHA 5DGTA 1BKYA 3FUVA 1F2VA 1ZH8A 2HL6A 4NBSA 4FOOA 4QKQA 1UZLA 1N2BA 2NO9A 4QICA 3C6YA 4I50B 3VNAA 2B99A 2II6A 3BL6A 4Y3UA 1ODTC 2NZUG 3UWMA 3ZNOA 1E5DA 1CEEA 3ME5A 3DEAA 4UULA 4L73A 4FDLA 1XMJA 3RM3A 4M46A 5G41A 3LA6A 4DCUA 2EFHB 2V5AA 3KPUA 4EEZA 1UMCA 3P0JA 1YJBA 2OD2A 3ANSA 2HQBA 3GQVA 3JD1A 4LNHA 4MGIR 4P86A 5H1YA 1K86A 3JAKB 3OHSX 3GIWA 1IJEA 1US8B 1TL7C 1GRQA 2OCIA 2OSVA 3F5SA 1PLJA 3FRIA 3S99A 4FZVA 4ZAWA 2ZP1A 5KC9A 2M8SA 3TKLA 1J1IA 3KQNA 3VUYA 1CF4A 1G4UR 1GPMA 3RSLA 3D5QA 1G5RA 4BU1A 1GEGA 1VLHA 1OBVA 2I54A 1XPRA 3L0IB 1XZGA 2QYOA 3TSZA 2JFHA 4NCBA 3HIZA 1NXSA 5KYXB 5G0WA 2ZNVB 1VKNA 3TAXA 1U81A 3WS7A 2H7CA 1NNLA 4HWKA 1VCMA 3KUKA 4AK9A 1YZHA 1XRPA 1JE1A 4GEKA 1AKWA 1GNVA 1QB8A 5F5NA 4X45A 2QN1A 2UUAB 1IJBA 4RA6B 4TKUA 1CR6A 4JBGA 5JQGA 2CLMB 3QPDA 4ND1A 3FLAA 3MJDA 4BO5A 3IDQA 2DYMA 3EIFA 3FPJA 5BVGB 1LDYA 2GR9A 4XGIA 5TQ0B 1FZTA 3UVEA 2J0SA 3HA7A 5ILOA 2XUAA 3P4XA 3PU6A 5EMKA 3THRA 2CHGA 2FSSA 1QGAA 3GRVA 4YBZA 3DG9A 4GDLB 4LC9A 2VP6A 2NVUB 1S7CA 4NBUA 3VHQA 2XUIA 1V8DA 2ZKLA 4JY7A 4E2YA 2QJRA 4II2A 3AINA 4PINA 4KX5A 4X63A 2QRMA 1RXUA 2Q50A 3N3BC 4RLQA 4IQFA 2WHIA 1Y4ZA 1AHIA 2IYZA 3E22B 3G68A 4LGCA 4QUKA 4R7GA 1TGVA 4B6JA 1BVUA 1BMFD 3RZWC 1P5ZB 2D13A 4CMEC 2Q7OE 1NZDA 1IXSB 2O07A 2ZQYA 3GR6A 3ZC3A 3MS2A 4IIXA 2FPRA 2O2EA 3ASYA 3EVFA 3F6BX 4XPIA 3V4VB 1Y6GA 3VYWA 1PTJA 4Q93A 1V1MA 3EVDA 3DEFA 4KZ0A 4D99A 4TKVA 2OE2A 1YNOA 1QTNA 4P83A 2KLBA 2XBUA 1GPLA 1VLLA 4C2AA 1T2VA 3V3KA 1NUTA 1KYTA 1TYDE 2Z1DA 3H65A 4M86A 4E22A 5JDCA 2YXEA 3NY5A 3FSRA 1NQVA 2ZTVA 1TMGE 1T29A 3CLHA 3PVZA 3D6FA 1GFZA 3D8BA 1VL8A 3RVKA 4ERNA 4ETNA 1W6UA 1PV1A 3NI2A 2H85A 3JRNA 5FBWB 1GFIA 2F8MA 2EARA 4DMCA 2WVAA 2NCNA 3QIVA 4B0EA 3HC7A 5FLKA 1HEUA 4NR0A 3BQ9A 3FD8A 3GVXA 3SVZA 2IFTA 4ALKA 2NX2A 1EUCB 4XWYA 1BVYF 3EG5A 1TT7A 5D7BA 1K8XB 1XJWA 2WJZB 1PL6A 1FM0D 1JI0A 1Z06A 1KU6A 4PE5B 2F7SA 2PVPA 3W5SA 4P2BA 4CF3A 4NTZA 5ITVA 2GPTA 3A1FA 1GR1A 1TK3A 1JL3A 1NP3A 2INCC 4XYBA 4TV9B 5JSQA 4L2IA 1JU3A 1RLIA 4D8TA 1L5ZA 4DFDA 2WU1A 1TD1A 3EGXA 3NDBB 5EYPA 2BEWA 4TUYB 1UJNA 2IC5A 3CJRA 2HJ1A 1ONPA 1EUDB 2VJLA 4KE9A 1NI3A 2PPLA 2I7TA 2PXAA 4PSVA 4EKNB 5LNK6 2RKBA 1MVLA 1KEEA 3GAZA 5D84A 1FMFA 4IOKA 4DY6A 4BGIA 5DHFA 3KOUA 5A0FA 3U7EB 5AD1A 1KERA 1WR6E 3VHTC 2W6ZA 4TTTS 5FFFA 5BVGA 3PXCX 4OHXA 2QVZX 2C42A 4TV8B 3AYXB 3D8NA 3UN1A 4WD6A 4WXYB 3PE4A 2WEKA 3RUCA 3EDCA 4D7AA 2PN1A 4ZOLA 2JDIA 2V3PA 1BU8A 4H6XA 2C92A 1QDUA 3E5RA 4I3FA 4QU5A 4TTRA 3RC8A 4WKCA 4DSNA 3I0VA 3L6EA 4FYIA 3GOQA 1OWPA 2DFPA 3GA5A 3AEZA 1UFRA 2PXCA 2IOYA 1XZCA 2RGEA 3JVDA 4Q6BA 4ALIA 1AC5A 1JG3A 1RCFA 2I4OA 3PKZA 2ZBUA 3H3FA 2HLNA 1AUQA 2FZ4A 4B6OA 2FJ0A 1BGWA 3LPNA 1JMVA 4GP6A 4TQ9A 1R3UA 1MNAA 2EKZA 2CFZA 4UTOA 3FPAA 1ZM4A 1D1SA 2FQWA 2XWQA 1SIBE 2I22A 2X9LA 4M9RA 3TNLA 1DX9A 1UZNA 1VPWA 4G01B 2DUMA 2Y93A 3B5IA 1ZRNA 2ZB2A 3A1UA 5EV6A 1Q3HA 5E1DA 3D0OA 2ZE6A 2ZCCA 3JASA 3L43A 4M0LA 4TRMA 5F77A 2L8JA 2CC2A 5B7NA 5TT1A 4L23A 5FNVF 1QZEA 4AG3A 4G4IA 4L28A 3HI6A 4B5LA 4C29A 1J2EA 2FBWB 3R3UA 5TDHA 4UBLA 1ORHA 4YIKA 1T26A 2DBYA 5BSEA 4HXDA 2NO1A 4U7DA 2KK8A 4BUZA 3H4IA 1DV1A 4HZUA 4J0FA 1GU0A 2W6JA 3QVSA 4R6XA 4X41A 4E4TA 3X30A 1JWBD 1A9ZA 2MIIA 3UXEA 1Z74A 3WL5A 2Q5LA 4M60A 4RHCA 5JDIA 1DOHA 2QNIA 1AUPA 1HSZA 1P1JA 3G2JA 2V65A 1UBIA 1FTYA 2OHIA 4I99A 2YN2A 3K5WA 3DAPA 4FT4A 4I0WB 4Y6GB 3P4UA 3VU3A 4EZJA 4YMIA 2FQ1A 3QI7A 5AVTA 4P62A 4KMOA 4W8HA 1OT5A 5HGJA 2KACA 1CETA 2GESA 1FNUA 1OEYA 2IW1A 1R5BA 3C7TA 3ZLVA 4AKEA 4ROSA 4C07A 5KREA 4LXQA 4YP5A 1ZVVA 3IO5A 4J1QA 4CMJA 4CVNA 1QLBB 2LXCA 4ZQCB 4K1XA 2W0MA 2VAVA 3DMTC 3MOSA 5B36A 4J5FA 4NPAA 3H4VA 1F4PA 2X4LA 5C8DA 3QV2A 4BFTA 2MBHA 2W2XA 4BLSA 2GEDA 1S3FA 3BEOA 3R7LA 2C0PA 4DSOA 4LMAA 4N7MA 4JBLA 4MQFB 1ISHA 1S1MA 3OIGA 5EC8A 5EOVA 4Z0PA 4DGSA 3J81A 2FPIB 4ENRA 4NAWA 1NFFA 4OCZA 3IRVA 3TMYA 4IINA 2XD9A 3I64A 1GB1A 4OB6A 5ANRB 1JEEA 3ZQ6A 3TUOA 5JH5C 3ZDFA 4RV9A 5A3QA 2R2GA 1H69A 2NPTB 1YBAA 1URPA 2QQGA 3IE2A 3K7EA 3F9OA 1CQJB 1KO1A 1E0DA 1KZ7B 2J5BA 2P1DA 3P2EA 1RT9A 3I6MA 4KQ9A 4UAVA 2VDLB 5EP3A 5JMPA 4ZDJA 3BV6A 1OAKA 4J0HA 1NF8A 3SWWA 3IA2A 1KMQA 3B48A 2R7MA 5IH3A 4BPBA 4BNZA 3DMDA 1VCIA 1JHYA 1ZVQA 4V03A 2FVXA 1SM4A 3PR1A 2QYSA 2HCFA 1XQWA 1Z8HA 1TJPB 4WOBA 3OFNA 5CDFA 1B1ZA 3NZ3A 3H7PA 1WDLA 2NO4A 1DELA 2R4UA 2WTBA 4OXQA 4EGQA 4GL2A 4KB5A 2Z5LA 1PR4A 3H1PA 4FQ5A 4ARIA 2BOVA 3INTA 2REXB 2W6JD 4Y2YA 4RF3A 1VGNA 3R66C 3DBRA 2G1EA 3CVJA 2V9PA 1WB5A 1SB3C 1LBTA 4WK0B 2ZZNA 1W52X 4Y1FA 4DLYA 2OENG 1Q14A 3NRZA 1XZKA 4ARAA 1XVUA 3LA8A 3MTQA 3IHKA 1OVGA 3GJYA 2ZG6A 4O63O 3ZXYA 3SN6A 4M0DA 2OFPA 5B3JA 3U9LA 4EQZA 4F3RA 1WUYA 5KNBA 2WYUA 1JEJA 3QWZB 5EEHA 5GY7A 1C3XA 1A88A 2ES4A 3IKMB 3GLIA 4RM2A 1MNQA 3RD5A 5JXJA 3X2SA 1HXHA 2XWBF 4EZEA 3NANA 3ZDAA 1D4OA 4BVGA 5C80A 4JI7B 3FKJA 3DDCB 3MSCA 2I6QA 3PQ7A 3Q5GA 4DT1B 2QZJA 4DHWA 3NBAA 3B2EA 2WWZA 4HBZA 5DCWA 2O5CA 5KCMA 3ZE6A 2ZRDA 1ZJYA 1YFZA 1ZHFA 2O1WA 5JHHB 3LHSA 2AIOA 1LTKA 1GUDA 1PT7A 3MUNA 3VFDA 2ZSEA 4C4AA 3H5NA 4YVFA 2XVMA 1T1SA 5LXTB 5KDOA 1WXDA 2EWVA 3GT7A 3IT1A 3PHLA 4Z1MD 4ZANA 3U6KA 5IC6A 3ONNA 1PEKE 4OJTA 4K9OA 4EOYA 1MIOB 2TECE 4FVTA 2X0RA 3OOHA 5G1NA 4A2WA 1WZEA 4V2IA 3WLNA 4CF6A 3MTBA 1GPWB 1XROA 1SB9A 3I6IA 3H99A 2GB1A 1U28C 4QPPA 1WX9A 4L0QA 3TPCA 3J7AC 1EVZA 3UMMA 4H6WA 1L8LA 5BYBA 5FULA 1JWUD 4LNIA 3L7DA 4LJOB 2C2MA 4WKNA 5J9FA 4A2CA 4EF6A 2PV0A 1X94A 2V58A 2VHCA 2QTVB 4F38A 3BHJA 1P44A 2JANA 2CHFA 2CBXA 1ISIA 2X41A 3I6YA 1X1AA 5ARBA 2HRBA 4IIEA 5DCLA 3A04A 3BGVA 1ZDMA 4U3JB 1F6BA 5J4KA 5K0FA 3HUDA 2IXGA 3K20A 1E7PB 2L0FA 1NNI1 5FB3A 2KKCA 1T5SA 2OAEA 5HIIA 2QL6A 3V33A 4NBWA 1IHUA 3GJZA 3ND6A 3WSVA 3A9WA 4BS9A 1YZNA 2QY9A 3Q7RA 1HL7A 2WDRB 2Y3IA 5CXQA 4UBKA 4YCLA 3V1YA 1MPEA 3ZVNA 2DLCX 3AHDA 1SKQA 2LVPA 4MH0E 1N3YA 1YHZA 3CJTA 3DB1A 1E6LA 5AI5A 1NJSA 2H4JA 3LDHA 4HYQA 3RROA 3RVRA 1IOZA 3U19A 3U44A 2MJEA 1FUUA 5CK4A 5B55A 4S24A 3ITKA 4W9LA 1DIAA 1JHOA 2RI1A 3E3AA 3JQQA 4TMXA 5JYBA 3U61B 3SZMA 2G5CA 2QTTA 3KVVA 3WGLA 1C79A 1ST2A 2VAXA 4BWGA 1U9CA 3QF4A 3ZV5A 1SBIA 1EH5A 5HMMA 1PZXA 1T0SC 4BRWA 5KYGA 2OZLB 4M0KA 4B6FA 2EW2A 5HHTA 5LMNB 1N6IA 2C4NA 1LF5A 1I2BA 1YQ3B 3BTUA 5IH7A 5CFQA 2JQRB 1RHRA 3ZWAA 4IDNA 2B98A 5AI0A 4QAJA 1E61A 1DAHA 3P52A 2C8KA 3Q3GE 2O57A 4G23A 3VBEA 6Q21A 2IH5A 1R0LA 3HNOA 1LBEA 1S4QA 2BTOA 3DT9A 1UBGA 1CD5A 4RW0A 3VZSA 1OLXA 1T0UA 2X14A 4AULA 3LQRA 5CVEA 3NKFA 4NG5A 1Z0JA 4YASA 1UBQA 1YKFA 3A6HA 4Z9YA 4A8TA 3ZWCA 2VKTA 5I7OA 3REQB 1XPUA 2BKUA 4XQEA 1X8LA 2HT6A 3KJIA 1JWMD 3A1NA 1ZN2A 4Y6OA 3TSCA 5K51A 5C31A 3T7TA 4BGUA 1PP4A 1V2GA 1Y5NA 4H4DA 1C4WA 2J08A 4QXRA 4QWMA 5IG2A 2Y4NA 4QATA 3U7FB 5IYZA 4DVGA 3JALB 3UWSA 4FHGA 4F6HA 2KDBA 1DX4A 2HQRA 1N7JA 4A36A 1XZLA 2AOWA 2OBYA 3N2KA 1KAOA 2B4YA 1RHJA 1H8ED 1QOPB 1XTQA 3G0IA 5FFNA 4F85A 4EA7A 5LQKA 1BEUB 1F12A 3V7UA 3ZXUB 4XDHA 5LQNA 2XMPA 4DDGD 2QM3A 2QRQA 4JT4A 1B26A 5HJ7A 1RC8A 2HK7A 1KJTA 2VYQA 5LCFA 2CXTA 4OLHA 3IAS1 1FYWA 1FFYA 1CC1S 4Q5IA 2OECA 4CODB 4ZHSA 2UXBB 1ULAA 1WCIB 2GZMA 4IZHA 3ZPXA 4DSUA 2VJMB 4H7PA 1HA5A 3ROZA 4C4OA 1CY7A 3IQXA 3E53A 4UBMA 5CB4A 4HDRB 5KWSA 4JITA 5T64A 4IO0A 4EHHA 2XH8A 5FOWA 2V6GA 1JZTA 3TLXA 3H1FA 4O98A 3W5UB 4ZT3A 5IMBA 2V1XA 1DT3A 2R11A 5B3JC 1I4LD 1Y33E 2Y27A 1AX9A 5LB4A 3QV1A 3N2YA 4RHEA 4JVLA 1EFVA 1XTKA 2VXCA 2YWRA 4OYLA 4TYQA 4EW6A 5CVJA 1WGHA 1RE0A 1NHWA 2ZR0A 3P0EA 1MRNA 4MUGA 1DCFA 3MEQA 4QNNA 2Q0XA 4BOYA 3TG2A 3I53A 5LD2B 2QZPA 1ET9A 2VTBA 1MHHE 2HSZA 2ATIA 3GLHE 4I4NA 4HPMB 4AZTA 3AUXA 1A7JA 3FFBA 1W34A 2ASVA 1D5WA 4XEHA 2A1TR 2RK6A 3PNVA 4UD6A 2XYRA 4CCSA 4IHJB 4ZMSA 2JHCA 3LY5A 4HMOA 4I4LA 4Z9XA 5I7RA 1QRDA 3T3HA 3HJFA 5IA7A 1I2CA 1CVRA 2VATA 3KSZO 3O4JA 5AHWA 3RVBA 3IEVA 1E2UA 1GTJ1 3PHXB 5B12A 4GMGA 4JJ8A 1AHNA 1PDXA 1WCIA 4U9UA 3QKRA 3B1LX 3HFJA 4GZMA 2N1BA 4ZO6A 5T57A 5HK9A 3C2QA 4C20A 3LWNA 5JNUA 3X1WA 2QEJC 2UV8A 4HQOA 5LA6B 1KZ9A 4MVJF 4WI1A 1FF9A 4M49A 4LHXA 2WMNB 1WRAA 2M9MA 3Q98A 4EDFA 1U7WA 2AMYA 2I6UA 5KOIA 4O4HA 2D8MA 1J2YA 3FOAA 1C7QA 2CUZA 1X7DA 4L95C 3KPWA 5LBIA 3TEZA 6CHYA 2GK7A 3AU5A 4LX8A 1KSGA 1PR9A 5CT6A 7REQA 2XTAA 5IYZB 1SU4A 1S96A 1Z8NA 2BFWA 3LDGA 3U62A 5LL6P 2IHZA 2QN7A 3LHIA 3P19A 4ONEA 4L8VA 1T9GS 3AFMA 1NMYA 3L04A 4BU0A 2BFOA 3ZZMA 3VR5D 2RC5A 2WYWA 2OV2A 4YXFA 4LDNA 3NHSA 4PZCA 1XRQA 3AF1A 1SIFA 2D6FA 5JY6A 3PXUA 2GH1A 1YDGA 2BCGY 3EGVA 4HQLA 3FKQA 1GAJA 4IJKA 5FIUA 3P2UA 3HU2A 4IQ0A 2GN1A 4C21A 4BKSD 4AYXA 2C5AA 3QVVA 5AVZA 1G21E 4PTYA 4WLVA 2JHPA 4FYPA 3G23A 1JJIA 2E9SA 4CN9A 1ZPSA 2ZRPA 3C3KA 1VD2A 3WNZA 3BIID 1M0TA 4FR7A 4JEUA 2QRZA 1YR7A 1XXGA 2HCRA 4YS6A 3TD9A 3VSAA 1ENYA 2J9FB 4IH1A 4QXPA 4X1KA 3GUZA 5DTEA 3GX1A 4NOJA 1KJJA 5U4XA 1UZXB 1G42A 5B58C 4J3OD 2HHCA 3RPFC 2VF8A 4BQIA 5JS7A 4ZK2A 2OCGA 4Q48A 4P82A 4B7UA 2QRGA 2G7ZA 3OLWA 4O4LF 4CV1A 2A1UB 1JMKC 2DT8A 2O6VA 1XALA 4Q9AA 4XI9A 3G88A 4ECEA 4XVCA 4AJ2A 1FBTA 1PYWD 3DVGX 1AKQA 2A0YA 2ZT7A 4KQEA 5DWVA 4C1NA 1BE1A 4PBRA 5BOSA 1FVOA 5LVAA 3UY4A 1F8XA 4OHZA 5IC4A 4IJ5A 4A20A 5EFZA 3HVHA 5TARA 3TLGA 1VG8A 3NO4A 1XLWA 2H8KA 4E07A 4JXXA 3HDTA 4O2AF 4OH1A 4I4TA 5HW0A 3DNPA 4CTKA 2HJVA 1SC6A 3DE6X 3AONB 3JQAB 2HPAA 3FUXA 3TSAA 4QHTA 5EZYA 4AYWA 2ETVA 5DJ5A 3L7MA 3LJKA 4Z8YA 5DNDA 3SJZA 2G28A 4L1BA 5TF4A 2OBLA 2P67A 3O8OA 2CEAA 1GTZA 5NLLA 1BVRA 1C50A 4KSYA 4G0UA 2GD6A 3AVWA 1JDSA 4US0R 4EFKA 1C8BA 1YK1A 4AV7A 2QRUA 1K6EA 3EDMA 4UFPA 5SYNA 1XTJA 1EA7A 2H00A 1IZYA 4G4JA 5JAHA 4HATA 2PQ0A 1Z0IA 2WS3B 4XD7D 5L3SA 1SC1A 3MAJA 5A5GA 2X2OA 2ZS8A 4DLZA 4K81A 5KC8A 4MI6A 4Y1GA 2WK1A 1MTZA 1Z88A 2NO5A 5D2MB 4RA6A 2PR7A 5AQ1A 4CNBA 1K53A 3LQKA 2GLUA 1R4NA 3BSFA 5HHDG 1B2RA 3E9QA 4RBSA 4PXSA 2VPWA 3MFGA 3AT1A 1A8TA 1UWLA 3FAIA 3HM9A 2NU8B 1V11A 4PHTA 1ZUD2 5A4IS 4I1VA 1EHIA 2M56B 3OICA 5E8RA 5LZ9A 4O3FA 1YK0A 1SGHA 1MHPA 4YJDA 4ARBA 2WWYA 1QOZA 2G82A 2GLSA 1NBIA 1PFYA 2WI8A 2YWCA 4FNAA 4BFYA 1RWSA 3NM5A 4O2BB 1CRPA 2IYLD 4FN4A 1KAGA 1HR0B 3PRZA 1DIGA 2YRFA 3OZRA 3A4VA 4Q4HB 3IALA 3FTFA 4KKJA 5GMVA 4EDHA 4HMQA 1Q1AA 4K86A 4QHSA 1Q17A 2QD4A 4ZK6A 3U7GA 2D7CA 3A9JA 4ZT2A 5KOHA 2OSBA 4XPZA 3KW5B 1DKMA 3EBLA 1AQ6A 1DRWA 1VLJA 3LIIA 4HXYA 4HWTA 4IHKA 1IBLB 4C0LA 4ZDIA 3QEAZ 3THSA 1PNQA 4DDTA 4EZIA 1Y37A 2HREA 2BMJA 3CLTD 1YOBA 3DZ8A 3G3EA 3Q3MC 3MK31 4AMVA 5HQ3B 5IAKA 1U2EA 3NJRA 1ZDXA 3V4PB 2HDOA 1SF0A 1A71A 4OGWA 1DAOA 1CPYA 3K9NA 2GLTA 3E5MA 1QQBA 5EVDA 2XZOA 1DXQA 4B83A 4YYEA 5JFGA 2WYQA 2PRIA 5E4YA 3ZCSA 1K5PA 1L4KA 1MQSA 4F60A 2XQGA 1KK2A 3E05A 8OHMA 2AG1A 3THWB 3KLOA 3KO8A 5KYTA 1J8DA 1LLCA 3CQ9A 2JDID 4EP1A 3ONSA 1JFTA 5J5AA 4P80A 4I5FA 4IZOA 2FF5A 2QXTA 2C2BA 2WQZA 4PRZA 4R1MA 3TTUA 4F4FA 3THYA 2YNVA 2V5VA 5BNZA 4DHJD 4Z3OA 2ZBPA 4HH3C 3RVMA 1L2TA 1TS2A 3EBPA 1V5FA 4HLDA 2ZUTA 2IYVA 2A9VA 2AOXA 2CKMA 3DHWC 3NEAA 4RQUA 3TGPA 3WANA 3EQ6A 4G86A 4C08A 1I35A 4BJHB 5HDBB 1XTVA 1ZUNB 3MJVA 1WX7A 3NTXA 3V8BA 3H84A 1Y5LA 2KYRA 3OLYA 2IYTA 3BRWA 2I2AA 4QOSA 1U2TA 1E32A 1JDBC 4YSZB 4K6FA 2YXNA 1OH6A 4BB0A 3DVNU 1MH1A 3URYA 1UT8A 3BORA 5EJAA 4HLCA 1DRJA 5HF8A 4DWJA 5K6TA 1P1IA 1L3BA 1TAQA 1P0RA 2XUGA 2BLLA 2Y0CA 4Z60A 2EIXA 2O2DA 3K9BA 2O23A 3AM9A 1G20B 4LDZA 3VO1A 2Z6QA 5L7TA 3L08A 5DVZA 4R8MA 2I34A 4LNKA 2I7XA 3C1TA 3NDPA 1NOJA 3FAKA 4S1VA 5K99A 3Q2AC 3TIVA 3ZG6A 4B43A 4Q7LA 1DO0A 1VE9A 4J6EA 2WOOA 5D6OA 4GDFA 4F96A 4AXHA 3AE2B 4TZTA 1A1SA 5GV8A 1QPGA 2NSJA 4LZAA 3ETGA 3TSYA 3FOCA 4CTMA 3MRXA 2VEDA 1B93A 3CF4A 3WL7A 4AJ4A 2NP7A 1X1RA 5JNSA 5DX0A 5BSKA 5HA5A 1GT91 1GA4A 4TLCA 3SIPA 1YS7A 3PNQA 4PCAA 2O3UA 1JDJA 2GSWA 3A9RA 3RU2A 1RI5A 1PT9A 3KTOA 5F76A 3RYHB 1A9PA 4ZVUA 1P2SA 1KGDA 4F8JA 1X7HA 5EIEA 4B3TB 4GYQA 1R4NI 3DTVB 2CJWA 4CUJA 1W1WA 5FQOA 2KANA 2P79A 3U4QA 5DYNA 1YJIA 5FXMA 5BQ3A 2AXEA 2JIMA 3UT5B 4QTYA 7YASA 2P3SA 3PNKA 3UIPB 2JLBA 4ZI7A 5K0TA 1UBJS 1EK0A 2XE7A 4TLDA 3GNQA 5DISB 5FI3A 4E5DA 4K81B 1DDIA 2YH2A 4CIYA 3ZDZB 1LNQA 3ED5A 4X92A 2XAUA 3HBFA 3MJ4A 1CJKC 4U0KA 2CLCX 4PQEA 5TMPA 1DV2A 3WNCA 4TS3A 1S2NA 4NE2A 1DRKA 4L2YA 1KY2A 2G07A 1MV8A 1T9ZA 5E9JA 5A71A 1SCUA 3TRFA 1V5TA 4ATNA 1KDZA 5GJBA 3IPAA 5ALLA 1WYWB 2WLSA 2P9FA 1O9GA 3HYCA 1OT3A 2HXYA 3L0ZA 4O4IB 4JBIA 1NVVR 2Y0DA 2DY1A 4EAAA 5GTDA 1DKPA 1QKIA 2P2GA 4BP0A 2GZ2A 1K51A 2W82A 2VZ9A 2PS9A 5I7EA 3IBEA 4ESEA 2FUG1 1NATA 2CJWB 2DCMA 3GROA 1T2EA 3ORSA 3P2KA 2MSKA 3LK7A 3NG1A 2PZJA 2SCUA 4WFKA 4D44A 1R0WA 3A05A 2PPVA 2BN4A 1Y1LA 2PX0A 2Y66A 3LLUA 1QOAA 4HLQB 1AXRA 2DPHA 2RI6A 2X9NA 1SKYB 4KX3A 3VAZA 1W46A 2A5LA 2H4HA 2UZAA 1VYTA 2G8LA 3F8SA 1HDOA 4G5FA 4WINA 1DHRA 4YJ3F 4LYEA 2MSNA 4XH9B 5IDXA 1Y6RA 2Z1NA 3SJUA 2FSIA 5A9SA 1ZBQA 2Q6TA 5FLYA 4BNKA 1ZK1A 3AF5A 3EPHA 1NX9A 1MVNA 2G45B 1JYEA 2E3TA 2QMEA 1YI1A 1XTRA 3KAJA 3KVNA 1QWSA 3O74A 4LMPA 2R2QA 3NKVA 2YZ2A 4KCGA 4HDSA 1F2RC 1HQKA 4DM3A 3T9MA 4YRAA 1X8XA 5ISMA 3UAOA 3K30A 5CX3A 3OAAD 4CFSA 5JQGF 4MTCA 4DIBA 3ENZA 4GPZA 2VPIA 4KOAA 5C18A 1Y4DE 3BGOS 2QMYA 5FKAC 3CNOA 4IVRA 3V8PA 4E0BA 5JD4A 5AXOA 3FCZA 4FDTA 3ZU3A 3RIYA 1A4RA 1UT6A 2WKWA 1LX6A 1HI9A 1R6DA 1CEQA 2NYRA 2Q5QA 4R3WA 4RQTA 4XQ9A 3RW9A 1ONBA 3ZLUA 1Z6PA 1V47A 1VJDA 1LNZA 2LASA 1NRJB 3UYKA 1ODFA 1L6VA 1MP0A 4OKSA 4BQPA 3H3EA 2FRDA 1EYZA 4FUTA 4MACA 2QV7A 1EVIA 4NMMA 1XDSA 3JQPA 1PNVA 2ZJBA 3BYTB 4KR9A 1C1XA 3WMEA 3I92A 4YFYA 4ZVLA 3BWUD 1BMFA 4GCWA 4JJZA 4IFBA 3DKRA 2IYEA 5CG2A 1RZVA 2H6EA 4F4UA 2ZYWX 1ECLA 1XCPA 2J09A 2ZJFA 5TQ0A 4ND7A 4YCBA 5GZ6A 5DGDA 1YQ9A 5EWMA 1EE1A 4DMMA 1E59A 4WNCA 1SXJC 2KPOA 1C3OA 3ND5A 4H3HB 4MMYB 1MZVA 3QFHA 1FNMA 1CZRA 2MYTA 2DE0X 2Y1DA 2ZIEA 1NZJA 3C16C 4O2AA 4CGYA 1ZGCA 2H07A 3EA5A 5A3JA 1NE2A 2VHQA 2O2VB 2Q3EA 2I71A 1UEIA 4KQ6A 3SC2A 4C0JA 4E15A 1OH5A 3PGJA 4KSCA 3GP7A 1JF8A 1LPMA 1NU6A 2OK7A 5IEBA 5CB6A 5IK2D 3LDUA 1FL9A 4N7JA 1LTHR 1OFVA 4N5NA 4WSOA 3ROPA 2Q4TA 4RSHA 3K8YA 3ADCA 3ZNHB 1X8GA 3WRWA 1ZH0A 4DHZE 3ZNID 1B6GA 1ND5A 3JQGA 3QX7A 1V5OA 4TL6A 1KA9H 2DYKA 3TJRA 4D5EA 2OO5C 1NN5A 1I7LA 3TUJC 1MOZA 1QAMA 4PLGA 3QSYA 1M4VA 1V86A 4M0WA 2VPTA 1C2YA 1QHHA 2WDPA 1TOAA 1G5FA 1VBFA 1B0AA 2Q8QA 4G1BA 2ZWIA 4ZT4A 4JENA 3FVTA 2R2OA 3PLVA 5FPTA 2HDEA 1SVNA 2O0MA 2H1IA 3JZDA 1ZJJA 4GOCA 3MHPA 4TYMA 3HLYA 2M5DA 1E4OA 1Y7HA 3GLVA 3L06A 2VDOB 2AFIB 5DP1A 4FCVA 5K2MA 3QE0A 1BEEA 2RBGA 4EX7A 5LZ2A 1DEOA 5FPQA 4I6LB 4RK6A 3A6EA 4FNMA 1GPYA 2IVFA 3LOQA 5D3IB 4ZYUA 2LUOA 4NY0A 3LGSA 3SX0A 3HSYA 3H5VA 3IPCA 4MA4A 4EF5A 4NYJQ 1JMYA 2KLCA 3P9KA 2DMRA 3UMJA 1LDMA 2AQ8A 5AOVA 1YU9A 3I63C 2ANBA 2G9UA 2W48A 3C6ZA 2JPHA 3IDSA 3VNUA 3K1AB 5JRJA 3ECSA 3H6GA 2RHWA 4EGCB 3HR4A 4MPRA 2QTGA 4WDQA 2HRCA 2YXDA 3GRZA 1EBBA 2JGRA 1Y5RA 2G5TA 4G0PA 2J0QA 1J0AA 3ABOB 4HAZA 1TF5A 3PSAA 2ZCBA 1B43A 3IBFA 4ACAA 4D4KA 1ORDA 1SBYA 2R44A 3TJPA 4ZQBA 5IVHA 2YS6A 4I6EA 4ZQIA 4C78A 3VC3A 4YRNA 3UAWA 4JYMA 3WB9A 2CXNA 1Z28A 2NO7A 2TRSB 3IKTA 3HKCA 3R9XA 3V6CB 2Q45A 5AOBA 4R1OA 4GRDA 4GX0A 3PZ7A 1Z83A 1N57A 2OV4A 5A0VA 2CB0A 2LDXA 2BM0A 2GB4A 1APBA 2I9KA 3GEDA 2FDXA 1QO0D 2O4CA 3AOEA 3JVIA 3K92A 3VSEA 3L84A 4C89A 2HA0A 4QUIA 1SELA 1VZ3A 2BISA 4WASA 1F2UA 1Z5WA 2RJ3A 2WM8A 1AMOA 2H4XA 2XD4A 3AJ8A 1C7RA 1T36A 2W6PA 2PR2A 2H1WA 3C48A 4ZCQA 1NW8A 2GBGA 5TQVA 1YQQA 4GR9A 4I2VA 2HF2A 3QK0A 2J0UB 3W9CB 1VA5A 1AS0A 2OT3B 1L5OA 3BF8A 4BVLA 2BJVA 5CPBA 4II3A 1UKCA 4TVOA 1OX4A 3W1YA 1D2AA 2RSLA 3FNFA 1NKTA 3NHWA 2FW0A 2HRZA 3OFKA 3PC8C 5GV7A 3RODA 2WF8A 5AK6A 5L3VA 3N20C 1HV8A 2PZBA 3A70A 3AEKA 3CY6A 4IQ4A 2MCNB 1ZCBA 5CD9A 5AVKA 2JFOA 4RYLA 1WMHB 4UM5A 2O5RA 1E4EA 1A77A 3O3CA 4PSCA 4GB9A 2MSWA 3PCRB 4PGAA 4QDJA 1VXRA 1KJIA 3V4LA 4O3MA 4W5NA 3VDZA 1E6CA 1RRFA 5ER6A 1Z6GA 3VR3A 1EGQA 1QSGA 4ML3A 4C14A 3DE3X 4FIDA 3RYIA 2DYBA 1TYZA 4X7PA 5C1PA 5K0EA 1M0EA 4AIRA 4WGFA 4JI0B 4PC7A 2J46A 2VDWB 1E1CA 1TW3A 3HVUA 1TF7A 3WBJA 2UZ3A 4MQMA 2QRPA 4BO1A 3DDHA 4D0LB 1OHHA 4J0QA 2ASEA 4NCNA 2GN8A 1UH6A 3I12A 3CBGA 2CNNA 5IJ0A 3KQSA 4KYIB 2GMWA 1YQBA 3G2MA 3H04A 2GJ4A 1P4SA 2FX5A 3RSQA 3HXMA 3QHPA 4MQBA 4DABA 4RTPA 4QDTA 5A4FS 2XQKA 1H2RS 5E7QA 3ECIA 1GCGA 5HIKA 2FVYA 5DM1A 3LT4A 2FPSA 3DWEX 5BNFA 4GRAA 4F72A 2JASA 4U7WA 3SIXA 3PPAA 4YTPB 2DQSA 3KWMA 2WXLA 621PA 2YUIA 2IUFA 1JEQA 4F7DA 5JNVA 3TF5A 3P0HA 5CLQA 4QLOA 2GQ0A 2UVQA 1IB0A 2OG2A 2YC4C 3N0RA 3QPAA 1XWFA 3E9SA 3PFGA 4FWIB 4AMYA 3KB1A 5CFPA 3QVGA 2EZ9A 3ILVA 4W7IA 4AJ1A 3AEUA 5KDDA 3L02A 3IBSA 3AFNA 2DVMA 5HDQA 4BNFA 4ZCIA 3NEJA 2BIFA 1RLMA 2HK9A 3Q4GA 1WF9A 2C20A 3GJQA 1ADCA 4QG7A 1N63A 4Q18A 4HDOA 3BZWA 3ORYA 2IITA 1H5QA 2QL7A 1PJ8A 2QVLA 4GU5A 4JYAB 2HMSA 3Q10A 4PZDA 4US8A 1SVUA 3UICA 1RI3A 1A9RA 1NDDA 4A26A 1K8ZB 2XCRB 3HR8A 5E6OA 1MJHA 4GLOA 4U39A 4XJXA 4F4DA 3P9QA 1PJBA 1MCZA 5K03A 4K7WA 2IPKD 5LNK1 1V4NA 3TLMA 2LWPA 3R3MA 4HX9A 4ZCMA 2QWXA 3FMVA 1RWBA 3ITDA 1Q91A 2YQ5A 4KXQA 5EWJA 3TQCA 1BZYA 3CEJA 1HZ5A 2BSXA 4KUGA 2RR9A 1Z2AA 1N9GA 2VKQA 3BMNA 4TPKA 3T5BA 5IPFA 2V1UA 3DZFA 3TUIC 5JHAA 3HJUA 2LP4Y 4UMFA 3RKSA 1SMKA 3FNIA 4HHEA 4MR7B 4L08A 3ZE2B 2RGNC 2BEWB 1SBBB 4PF1A 4TUYA 3RULA 2H1SA 2AK2A 3PB3A 3WMXA 1KOGA 2BZ1A 4P4LA 2PNJA 4CF7A 1H9AA 2C5GA 4Z4FA 2XEXA 3RIMA 1NM5A 3HBMA 3R5SA 2B3AA 5U4QA 3WVNA 4RVHA 4YMGA 1XCGB 3ANTA 2IDYA 4G07A 4MQEB 2LRHA 1RAFA 4E2FA 1H4QA 1R8QA 2QLBA 3SZ3A 4F4HA 1HNZB 4MV5A 3GB9A 5EAIA 3A1SA 3CR7A 4Q7MB 4RL4A 5TR9A 3OCCA 4TMAB 4XQGA 2GJ8A 4XLTA 1BE0A 3RFXA 1CS0A 1SEPA 3OPYB 1XNQB 2ON6A 3U81A 2Y8AA 4QHYA 2Q5EA 1XR3A 2Y6UA 2G9ZA 4DL9A 1GXSA 4A4DA 1NM5C 3L8FA 1U3GA 4R8RA 2Q3FA 2HQSA 3ADOA 1XMPA 2DRIA 2HMUA 2JAXA 5H81A 3ZWMA 4WLOA 2RGNA 1AO3A 5IN5A 1RAGA 1ZD8A 1GILA 2ZYVX 3ITNA 5E9WA 5TMBA 4UOZA 1ZGGA 4LY9A 3BBPA 3AHFA 3EZ6A 3QTBA 2QTLA 2GD1O 2J41A 4IWQA 2FW8A 2Q0JA 1Y34E 3UAXA 1EE2A 4FOLA 4AJPA 4J1TA 1PSDA 4OVZA 1NBME 3E27A 3EVBA 2I76A 2D1FA 2X8JB 3CSUA 2B36A 3W2TA 4EYKA 4BAZA 1U4NA 2E21A 2IEGA 5GVRA 2IY0B 1B6TA 3DH8A 2EERA 1HOTA 4UCFA 3V1MA 3FHLA 1XGKA 3AHJA 3K6RA 2IGTA 5REQA 1H1LB 2Q27A 1L4LA 1ZO8A 2IYYA 3CWQA 1LVUA 4B3SB 1VG9B 4E71A 1YZQA 4F4CA 4MPPA 1NVVQ 3F3YA 3INNA 1J8MF 2H2GA 1RJGA 4JODA 4RTRA 2I66A 4HB4A 2PLPA 3C5EA 2ZSJA 4RKEA 1ODIA 2D1QA 2DLNA 1BKDR 3OUTA 2NTSA 4LTNA 4WESB 4CV2A 1IH8A 4JLVA 1ZDVA 2XZLA 4J8PA 1K5GA 1Y89A 3PDIB 3PL1A 4NZNA 1QGUB 3W3AA 3NOOA 4JLMA 5FBHA 4L9SA 4PT5A 3W05A 2PUAA 5AVVA 1W36B 3B13B 1DG9A 1NVWQ 1XD2A 3KZVA 4Y2JA 1YZGA 4HVAA 1X8KA 4FR0A 1GR0A 5FP0A 3LFUA 4GF5A 2ZYUX 4GE0A 4ID9A 5LU9A 2I7VA 4R1LA 4XCVA 2P0EA 2WFLB 3V3TA 1YC5A 3JWHA 4CXMA 2ZI4A 3PRHA 3WK5A 3WV4A 1PZFA 1EJ6A 4XZ3A 3DFMA 2P6PA 4HFJA 2C82A 3ZY4A 2C7QA 2OUKA 4RPKA 1GOZA 1HDXA 1ZVMA 4JUAA 3F8WA 3PKIA 1QTRA 3MXTA 4M1OA 3RRBA 4DQLA 3FJ1A 1RBMA 3PNOA 4B79A 1SOVA 4KVGB 4YY3B 5LWHA 1SKBA 3JW0X 1JHVA 3T99A 4H1VA 4UWSB 4DCVA 5AUOB 5HJEA 2OJRA 3O4HA 3VI4B 4ZDKA 4KBGA 1IBRA 2ZJ3A 4MS4B 4CKEB 2GKLA 2Q41A 2XEDA 2YIDA 3CVUA 4Q1FA 3BA1A 1VL0A 4TV8A 5TR5A 2CFSA 2JUOA 3D0KA 5E9AA 4AJIA 4EF4A 4QYTA 5LYJF 1M1UA 1H66A 1NV9A 5JJBA 2XBMA 2QVBA 1P1CA 3NIGB 5BMVF 3LX6A 2WHYA 1MJ5A 4KSLC 1B15A 4FILA 4L7QA 1Z6ZA 4AWXA 3ZCUA 4U8HA 1G8MA 2ZSIA 3BYZA 3FAZA 4M7WA 3RB8A 1MPXA 2LIVA 3N70A 1P9LA 4ZDVA 2PX6A 2ZAIA 4ZOLF 4X94A 5DF1A 5LDGA 5L40A 2JAOA 3VH2A 5CA0A 5G4LA 1REQB 2DWCA 2QMQA 4P98A 1P5FA 2IY7A 5ECWA 1K52A 2L42A 5KMGB 2PE9A 5CMLA 3ZYZA 3VISA 2MH7A 2BCEA 2O3TA 3OLCX 3T5CA 4G5YA 4M53A 3PLAE 3FUTA 1RXVA 3FLMA 1RVDA 3R9XB 1QO7A 5SICE 4AYTA 3AL0C 3O5AA 5DU2A 1G5PA 2J4FA 2NZEA 1DDGA 1E5VA 1U3DA 2A14A 3VPDA 1G0NA 3QE3A 4GPD1 1KI6B 4JQCA 1KZYC 1JXMA 5LZ8A 6REQA 4OHMA 3EZXA 4DQUA 4HVCA 3GGCA 4YFVA 4CKWB 4WOPA 2E5LB 4JZYA 1GUAB 1KJZA 2FHPA 3K15A 4BFSA 1G6Q1 1SKMA 1BVHA 4MA5A 3BCRA 3A32A 5AQEA 2BYTA 1JB9A 3HPQA 3K0BA 2MSDB 3MWFA 4X5OA 4P08A 2YNUA 5MGBA 3KDAA 2BGGA 4PO8A 1V7PC 3I4CA 4Q82A 4BE4A 4QD3A 1FLAA 1Z56C 4NCJA 3P9YA 1FS5A 1SZJG 4M6WB 3V4FA 3REOA 3SQMA 2Q3MA 5D8DA 2BBTA 1ZW7A 1XZ8A 2Q6IA 4PVTA 1N1MA 1FS6A 3WB1A 2VRNA 4LBYA 5AUIA 1I42A 1PV2A 2WC1A 3COWA 3NEPX 3PFWO 3PI6A 4LJLA 3OG5A 3NDRA 1TCUA 3TQOA 1VDZA 1R4MA 4YAOA 5IARA 3Q8CA 4LOJA 1E9RA 2HSGA 2QW1A 4BLRA 4LDQA 4F2HA 5AW2A 3ZW8A 1YE8A 3AW9A 4L72A 4GXTA 2QSZA 1A3CA 2YYYA 5DNWA 3V8NA 4BOZB 1YDEA 4AECA 1RXWA 3M1LA 2IY1B 3MHTA 2XNSA 1SVOA 3UV6A 4LZWA 1RJDA 3FLEA 4YXWA 2C78A 5K3FA 1VMIA 2IIVA 4D3ZA 4RD4A 1HM5A 2FMIA 4C7XA 1UZUA 1NLMA 4B87A 2A8YA 4M1WA 1FFUA 4A6QA 2ZK7A 2WXPA 4NZMA 4FSXA 1I4WA 2OO5A 5BORA 1W5SA 1D3ZA 3PGMA 5TS2A 4F93B 1WXVA 1T4CA 1M2JA 3G79A 5DEOA 3CURA 3VKWA 1LS6A 3UGJA 4RAMA 1BFKA 4XUGB 1OX6A 1O94A 4PS0A 1S7GA 2E7YA 1JFFB 5I9IA 1WDTA 1HNWB 2GPAA 2QT9A 2R62A 4RV4A 1OLUA 3BMCA 1ZKDA 1RYFA 3DFIA 1V45E 4L02A 1AMUA 2L52A 5AM2A 1JKXA 1ZEJA 1IQ0A 2I2CA 2J67A 3PENA 1EFAA 2XXAA 2EELA 4MROA 4TMKA 1VIYA 2DFVA 3V60A 1EZ1A 2PZ8A 3E15A 4QC2A 2VRWA 2ZAYA 2ZWPA 4ZRMA 4D9JA 4EJ6A 4N82A 2UUOA 1Z4JA 3HG7A 2O2GA 4H0FA 2HR1A 3PHCA 5HXAA 4RK7A 3A3KA 4UHFA 3DFKA 4YV2A 2WYIA 3QGMA 1LA2A 4OHPA 3UJBA 1U8YA 3WTCA 1WGYA 1TY2A 3FC4A 3O13A 3UF8A 2I3GA 3EIWA 3OOYA 2HA6A 4HH0A 4Z2AA 3GLGB 1Z13A 4P1ZA 2B92A 5LYJA 3ZDMC 2PWBA 1A96A 1EHCA 2I1QA 1Q1BA 2J5KA 3P9XA 4FPXA 1VCNA 3F73A 2DKNA 1QO9A 1WXFA 1Z17A 3GJ3A 1U7ZA 1N0IA 2M17A 3JV7A 4UXIA 2QSUA 1PLKA 2OGZA 2P9JA 1CG6A 4I08A 3HO6A 1E2BA 1CCWA 4TOIA 2GVDC 2ODQA 2QR5A 2HBQA 2VWPA 4QGGA 3EXIB 4EUTA 1QQRA 2XADA 4PVDA 1PG5A 2G9NA 3VV2A 1MVKA 1TA4A 2UVDA 4GKJB 3IEKA 3NIFB 5GOTA 3M4XA 3T9CA 1FEZA 4RX1A 3TL5A 2EC5A 4R5HA 3I2IA 3REFA 2I2BA 5JJKA 3EFBA 3UMYA 3FYUB 4OQ4A 5EJ7A 2Z8YA 2ZAGA 3DBLB 3KKEA 1I3KA 1QIGA 4C0HA 1ZHHA 2D7DA 1V1JA 4ZYZA 1X80B 3DTTA 1ISPA 2W2NA 1W4BA 3GRAA 3GLIE 1HYQA 4JC0A 3Q7IA 3JW8A 3AEUB 2QX8A 4AD8A 4MW9A 1U6KA 1LBHA 2BFFB 2Y2UA 4CZ2A 4CDNA 1BXZA 2QEDA 4L51A 3K32A 1EAYA 2W6MA 1LSSA 1C78A 1CSEE 4FXOA 5BMOA 5JSZA 1CZLA 1RFGE 2BEUA 4B9KA 1EXWA 1NXQA 2YWHA 4CKCB 5IWAB 4OQPA 1Y8ZA 2HLDD 2D4AA 3WQRA 3D59A 1U9YA 4P7JA 2O5EA 3QNUA 4QTXA 2FFJA 4RY8A 3DVAA 4N4AA 1T13A 4WZBB 2BS2B 2A35A 1VPTA 2IV3A 4D02A 4IUDS 5JFOA 2QE6A 3S2YA 2PUWA 5KVSA 4BCBA 3M6UA 4M36A 3FILA 3KXIA 3VDRA 2PV7A 3LLCA 1XEWX 3EXHA 4P4GA 3FZNA 4W8OA 3UW3A 1XZBA 1S4MA 5L3SB 5G5GA 3COJA 1CFZA 3CKMA 5DM60 3V80A 1X7YB 4UBQA 4S0ZA 1FXWA 3EVAA 3JD3A 4DCOA 1E6MA 1PTJC 2QMTA 3ZKWA 5CAEA 1MT0A 2B5OA 4YJKA 2IKQA 3R7NA 4JO0A 3MCAA 1TEXA 1AE1A 3TBKA 4GKAA 1ICIA 1IDN1 2M1ZA 4X24A 4PLFA 1Y3HA 4FINA 1A5TA 2O2ZA 2PD4A 5EKTA 3ZN2A 2Q2WA 1LZKA 4GMVA 4IS3A 4BASA 2B1JA 2PCJA 1I4PA 4II7A 4GU2A 4MM3B 4YJGA 2MINB 4X7MA 3WL4A 4LJ8A 5KHQA 1XRJA 4B76A 1DC8A 2C1EA 1WO8A 1WBDA 4CR6A 2QIOA 3H1EA 2AXPA 2OG1A 4IYRA 1SQ0A 5KYNA 2A4ZA 2GBNA 1DQYA 1WCV1 1ZK4A 2B69A 1EU1A 2F48A 2GZDA 1KEUA 2IQIA 3F7OA 3GJ4A 2X4IA 4U4AA 2WZCA 4FM9A 4IIGA 5H8WA 4E88A 2WWIA 2RCNA 1FMJA 4KR2A 5BW8A 2CLLB 3OO0A 4UEKA 2M6SA 3A4TA 2HIHA 1U02A 1THZA 3MINA 2OLJA 1LLDA 3RFUA 3DF7A 1Y4UA 1SXJB 5JH7F 3QK7A 2QDFA 4IXNA 3CJQA 4K0RA 3OX4A 3SKXA 1QZTA 2W90A 1GN9A 3S44A 4F86A 1NHGA 3JAKA 1TTNA 4Q9JA 2YWGA 1WNTA 1T0JB 3YASA 3JWPA 1IXYA 1N1DA 2UAGA 2FJUA 3N74A 4C1DA 3ABZA 3IILA 4MKFA 3DEIA 3GCZA 1EXDA 4NBNA 1O97D 1QT9A 1KDTA 4D97A 3VTAA 1GITA 3OT5A 4RQAA 4ZI7F 5JPDA 2VAPA 4IS2A 2N9EB 3SEFA 2XT6A 1JYSA 3PIRA 2FEMA 1MX3A 4L50A 2JGAA 2YJZA 1LFDA 5EJ6A 4HL2A 3DOWA 1MORA 2CVFA 3HZRA 4WHMA 4UTRA 1IFXA 1DAGA 4JLWA 1HQDA 3EGDA 1OBOA 2AMFA 1Z5SB 5HM6A 3LDZE 4CEJB 5AKIA 1RFAA 3I5UA 3CUSA 2Y1WA 3O7MA 5BYSA 2O8FA 2IH4A 4V39A 4HUJA 3UHPA 4RLHA 4WCDA 1D04A 1J8CA 3P5SA 5KSYA 4QG3A 1MW9X 3BCHA 3ZLBA 5D3DA 2NACA 3LNTA 3P0FA 3RPEA 3KQ4A 4WURA 4UXHA 4CM5A 2J3EA 2MP2B 5FNVB 3DV0B 4C09A 4ZAVA 4ZI3A 3UWKA 1D5CA 3P2MA 1IZ8A 1CP2A 4GWKA 3ZVMA 2E82A 2EJVA 1KI9A 2EKBA 3J80A 1L4ZB 2VDJA 1PFKA 2GEUA 1XL0A 2YY5A 3I28A 5AK4A 3NCTA 2VT7A 1EEXB 2XUJA 5C4GB 2BT6A 3RUAA 4Z4QA 1BVTA 2KQ7A 3U4MA 4J2OA 1JLMA 2FUG6 721PA 2K8HA 4BLOA 3PUKA 1DBRA 3HXLA 1JAYA 1Q0QA 4HPLB 1Q2XA 4WXMA 2XCTB 1RXEA 1ZY2A 1RWVA 2JPDA 1Z4OA 2NQ8A 2REBA 3LUKA 3O82A 4J07A 5H8YE 3VH1A 3A1QA 2QOEA 3FW1A 5E1OA 2WABA 5BUZA 4DIUA 1KP3A 2GPBA 2IYFA 2O0LA 3ECAA 5DN6A 1Y1QA 4Q37A 3TW8A 2BY4A 4ZKDA 4F4IA 2KHZA 5LB2A 3T7RA 3S70A 1ZRMA 1UFKA 3GHYA 3O4VA 1Q6ZA 1KI6A 5DSTA 4W5TA 1XTOA 3JSVA 1I6MA 1K8YB 2FWIA 3FUCA 1T35A 4G4SP 3AEQA 3IC5A 3F5FA 4PYIA 3WBFA 3N1XC 1E0SA 2H2AA 3F6SA 4KQCA 4R51A 6ADHA 2AE2A 3O83A 2XUOA 2XYQA 2H6AA 1MLDA 2ZSUA 5J3JA 3ZDBA 2ECQA 3K6SA 5JS8A 1BX3A 4JEHA 5AJZA 4XWKA 4TMYA 3TNYA 1DRUA 1UJ6A 2B5WA 1ZNYA 4JI8B 2GBKA 1OXVA 3ICOA 1ZZEA 3OJFA 4CPDA 4JUCA 3A28A 3ZI4A 1ID8A 4JLCA 1BOFA 4R7TA 2LPMA 2OKGA 1RWQA 3TQFA 4BL5A 4DJ5X 1IONA 1I8TA 4GBMA 2RE8A 2WP9B 3D6HA 4OBEA 3UOAB 2OZEA 4QEDA 1DT5A 3FMPB 5BN5B 1UQRA 3KT3A 2LWIA 3PD7A 3RRJA 1W5FA 2CSXA 2NVBA 2WYVA 1TM2A 2WJWA 2OHVA 2QW8A 3MUFA 1C3VA 2O7RA 3QYAA 1NASA 1FDVA 1X8JA 1XWWA 2YOGA 3I1FA 2QJTA 2XEWA 1G8FA 4B3HA 3EXFA 1E5TA 2HRQA 4URXR 3N2IA 3ZE8A 3RWMB 5JO0A 2CVQA 4BX0A 5HH4A 5ACPA 5JNLA 3VV3A 2GAFA 4XFDA 2WDTB 1WZUA 4LUCA 4AN4A 2XVXA 3C4JA 3FAHA 1I24A 1H1DA 1OI4A 1SG9A 2PT7A 4XWWA 1LW6E 3F2IA 4UFNA 4FS3A 5DDIP 5F5XA 4M98A 3W5VB 1RJ9A 3MGBA 4YMVA 2BJHA 4LTUA 1Q0HA 2BFLA 4JUIA 4Y6LA 3OZSA 1WSWA 3USCS 4Z4HA 1KZ6A 1FTQA 2GCNA 1A7UA 3K1JA 4LZJA 5F51A 4LBZA 4P8RA 5JISA 4B6GA 2JT4B 1OZGA 1UAYA 1Y8QB 3ANYB 1BQ4A 2EKPA 2VUUA 2AX4A 4JB0A 2PKQP 3TQSA 1QNLA 2IUEA 4CHGA 3PIDA 5J2UA 1KDRA 5EUBA 3VYVA 5BQXA 1XLOA 4J3NA 1ID1A 4USAA 3HJHA 3AGQA 3TD2A 3MJHA 4LSMA 2ZDQA 4D3DA 5FEMA 3EQZA 4RA9B 2AZXA 3S5JA 1OV6A 4M1QA 1ZE3D 4W9MC 1UUFA 2BR4A 2ZRCA 2JD1A 5DGHA 3UCEA 3WDSA 5AHOA 4UNSA 5C8XA 3RRFA 1G60A 1AN8A 1YJCA 3HDGA 3L0BA 4TWBA 3NWBA 1KMIY 3AP3A 4RK5A 3JAMA 2YMPA 4MW7A 3ZE9A 5GPBA 3E7WA 4HDCA 3R5JA 4FONA 2XJ9A 3EVEA 4GIBA 2BFEA 1TMKA 4F1SA 2V5UA 3KXKA 5L3ZA 2HUPA 3TVDA 4YLYA 3VR9B 3OA0A 1QBKC 4ASWC 3G9ZA 4EABA 1GUFA 1GGJA 4YN3A 3IP6A 3U0BA 2BR6A 4ETMA 1A4XA 3FSEA 1B0PA 1ARZA 3E2PA 3MJWA 2OXCA 3AQ4A 3RUEA 1O08A 4PYMA 5K8IA 1QIIA 1WGRA 3AI2A 3WAOA 4AJWA 1K06A 2ZUWA 4TLLB 1H2WA 4ANWA 1PQWA 3C41J 1I7PA 3AFOA 4BVBA 4ZZ2A 2WPDA 3NBQA 2BB5A 2I1VB 2QR3A 2WNMA 4WWHA 4N7RA 2MWSB 4LAFA 4KRFA 2ID4A 2O0JA 4HAXA 4X1KB 2R751 3P71T 1BH6A 3DOIA 4M22A 3IEIA 5DSXA 3RJ9A 2LMCA 4Z6KA 2A9FA 1D5MC 4MVJD 1ZI6A 3ZHYA 2HV9A 3PRJA 4IIDA 1T91A 7AT1A 2GXUA 1BFUA 3NHKA 4J6IA 3D7RA 1OVMA 2AN3A 2XSZD 3W0LB 1YXMA 2CJNA 2FZWA 4OI4A 4FSBA 3JY6A 1CIPA 3B1KA 1OFUA 1C0LA 4N5HX 4CM1A 1E4YA 2H65A 3KJEA 1KARA 2QXYA 3BWXA 3KR2A 4C7OA 3OPNA 3D4BA 2XMDA 4D9HA 1CWUA 1C3TA 2WU8A 3AM3A 5K5EA 3ZZUA 2H0RA 1WZ0A 1HXYD 1IG0A 4K28A 3GARA 2E4AA 1RQ2A 4GDLA 3KCNA 2V8OA 4UMDA 4FGKA 1H5UA 4KQKA 3FB4A 1CQVA 3PT5A 1PVVA 4IXMA 2PX8A 3HZHA 4K1RB 1E99A 1RWXA 1TYCA 2FU5C 2PGOA 2W93A 1TZCA 3BB3A 1WJUA 3HU3A 3V8EA 3UA3A 4UTPA 5IT0A 2H08A 3C1UA 3CR3C 5LXTA 1K6XA 3KSRA 2OXIA 4P6VF 5FI5A 2OA0A 4HTFB 4YGYA 1CJMA 3CEAA 4BV2A 4CCYB 1JBQA 4WK6A 2ZGVA 4QJ3A 4W5QA 1TA9A 3B9QA 5EMHA 3Q3CA 5C53B 3L49A 2WTAA 2XOEA 3ZV3A 3ZTYA 5TPWB 3W4JA 3DR5A 4X1YA 2XZDA 1TVKB 1JLLA 1XTTA 1DFHA 1XYVA 2PJDA 1DAKA 4S2EA 4FGWA 2QQ5A 2XE4A 4Y7DA 2DZIA 1KJYA 2NUTA 4C7OB 2Q1WA 1X7XA 4ZJYA 1D03A 3OEWA 4MGZE 2J30A 1WM2A 3Q87B 1LPSA 1NOIA 2AEMA 1ODCA 2FUHB 3W1SA 2YINC 4M1KA 4UW9A 2N1MA 4ENQA 3KIPA 3RR2A 3BPSA 1IY8A 1UP6A 3FF4A 1LEHA 2EDAA 3JD2A 1GNLA 4H3VA 3V4ZA 4XSVA 2IF2A 4A5OA 4EKGA 4CIAA 2Y1OA 3DR3A 4R2HA 1MAVA 1N6OA 1TAGA 1EJBA 3A2LA 4FCWA 1U1DA 3S0JA 2IP4A 3KHKA 4LF5B 3IE0A 4OYYA 4DCGA 4AVYA 1J6UA 4RKWA 1G66A 2GA9A 1FRQA 2JRCA 4ZC8A 1N5XA 2ISSD 3RVPA 1GIAA 1SD5A 4DLVA 2VYVD 1FVFA 4LA4A 4Z9BA 2J0UA 4Q34A 5IJ0B 4LRYA 3AHEA 2WD7B 3KV1A 1OPXA 1BWRA 5HZHA 3S81A 2OVFA 3EZNA 4NX2A 1R0CA 2VZKD 5CA0B 1WD5A 3UOWA 4LDPA 5EYPB 4TZKA 4AJHA 3ZIAA 3ZCPA 4RJIA 1L3CA 1NBOA 1Q11A 3SFPA 5JHBA 1EWYC 3GLQA 4ID3A 5EZYF 2FIDA 2J07A 3O93A 3O73A 2GBCA 2X4DA 2Q4BA 3BWYA 3D7SA 4Q16A 5CUQA 4NATA 5DTRA 3EGEA 1XO3A 2NVUI 1N6NA 1U9IA 2QMOA 1VGVA 3KRTA 3LQYA 3X1DA 4W5HA 4N41A 4MDKE 2M4NA 2IZOA 2I2WA 1X1TA 2HU5A 3PJDA 5AK3A 2BFZB 3PKJA 4U00A 3C98A 1JU4A 1MFZA 2HMTA 2JAPA 3OEHA 4GWLA 4OG2A 1T3GA 3F7TA 1XL1A 1YZYA 1K08A 2QE7A 4JI3B 3SR4A 4OHUA 3QXCA 4WNAB 2JRIB 1I7QB 4WJNA 1PGBA 3IIEA 3P2OA 2AF3C 2PWPA 1DE0A 3MF4A 4QTUB 2A4MA 3WKBA 5DOVA 2ANCA 4TZ9A 5A3SA 1WUKS 3IEUA 2QINA 1P2BA 5IYZF 2KOXA 3PXDA 3V8QA 4NOLA 5AOAA 3BK7A 3F4BA 5FTMA 3OZEA 4PVOA 3G7SA 3RC3A 3ZHBA 3IVFA 3JQFC 2YDXA 4N65A 2Q5CA 3NOXA 4F11A 3BD9A 2B6HA 4I1SA 5K8VA 4EHDA 3JYQA 1KORA 3T9DA 5EZYB 1GRRA 2K0PA 1JQBA 2EFYA 5M29A 1UXJA 1AS2A 1F5NA 2WAXA 2Z3VA 3NHUA 4WXRA 3RDPA 3VMFA 2O9JA 3H11B 1B0UA 1N5MA 1PIWA 2BGJA 3CRNA 4FCTA 4QO7A 4W1PA 4YNBA 4QOFA 5IW8A 5HRCA 3PNPA 3KVOA 4B3JA 1H0SA 1K5HA 2O8EA 4ZXFA 2Q42A 4D5GA 1C4KA 2WJ3A 1R50A 4BVAA 5KYKA 5K4KA 5KAMA 4HB2A 4IIVA 1OQAA 4NZOA 3PY5A 1A2OA 1SQ6A 4GEGA 4IH9A 2X15A 4UKDA 3M6XA 1NXXA 3AP1A 1NWCA 1F9JA 3FDZB 1N6ZA 3IB6A 5AW1A 1IHDA 2WIFA 4HEQA 3ESBA 2K22A 1KFJB 1NF9A 2ZPUA 4H7DA 5G0VA 5BN3A 2HW8A 3HBAA 1U7PA 2OEDA 3M1AA 1XVIA 4MP8A 4MV1A 1Q1NA 1EM8A 3VR8B 3K70C 1G6OA 2X1LA 2KVRA 3ZRCA 5DW0A 3TX6A 3OZCA 1DGJA 1ZEMA 4MVJA 4FE4A 1TZOA 2HLHA 5I7SA 1E9SA 3CT6A 3ANXA 2B8EA 3NFYA 5BWNA 1YZ3A 4WJPA 3UQBA 2FQYA 2GM9A 2SAKA 4UVEA 3O75A 4LJ6A 5P21A 3R20A 1U7UA 1UR5A 3NYQA 1ISJA 4CM8B 4KGRA 3RNBC 2PSFA 3F6YA 3LSYA 1N8NA 4TXLA 2WY2D 3ZD8A 5LYJB 4GOLD 1JTFA 4GXNA 1PF7E 3HNPA 1SG0A 4YK7A 4B46A 4QYIB 1RAIA 2QYTA 2IYAA 4JK3A 1G20A 3HRKA 3GW8A 2V98A 1ZL0A 3DDSA 2O59A 3PJEA 3OT1B 2GRUA 4M1TA 5G4KA 2LGIA 3AEAB 1SQGA 1V5IA 1T6ZA 4WZBE 5HZGA 3ETJA 4MUNA 3P63A 3CWIA 2HA5A 2CKHB 4GFDA 3VKGA 3TMKA 5JG7A 1CQIA 4C4XA 2EMSA 1E9DA 4HX5A 1C0EA 1N5JA 3G2QA 5FFMA 3PREA 4ZO4A 1GB4A 2YHUA 4B31A 1MAAA 2PH1A 1T0BA 2VJYA 3ENWA 5L4NA 1VB3A 2RHLA 5LM3A 2B4RO 1U0RA 2WXHA 2H51A 2X1VA 3ZHQA 2HJ8A 2P9GA 4U2BA 3L5OA 4ECAA 3DUFB 2TSSA 3N2NA 5DCUA 4CI0B 4XX0A 3UUWA 2YNTB 1C9MA 3Q6VA 1QANA 2YS7A 3I9KA 4RCZA 5AM3A 1P74A 3EWSA 1X3SA 1KVSA 2WUWE 4R2JA 1RQRA 2JX5A 3CNEA 3DO8A 2AOTA 3NMUF 2L82A 3GGSA 4WEQA 5DRTA 2YVCA 3B3JA 1G291 3WDLA 1WXAA 3A9CA 2PHZA 1ZUNA 3CLRC 4CLOB 3FCXA 2DAPA 4EYOA 1JLKA 4LJ5A 5F1OA 3LB8C 2MSCB 3CF6R 3K1TA 1ISGA 1VSQA 1KFCB 1XCLA 2GNAA 5EI5A 5JCOA 3OFSA 4F1KA 3Q6NA 3CE6A 3IAEA 1V8BA 2HWUA 4QQRA 1M8JA 2J53A 2VZ0A 5DXAA 5FA5A 4NURA 5JI3E 1OIWA 4M0PA 5T8IA 4OKNA 4KWHA 5J1TB 4RK1A 4O59O 1D6MA 5FPPA 2WTMA 2BWJA 1P0QA 3AFGA 2FWJA 5HFJA 1E8MA 3VVCA 2BGFA 5JWHA 4EMUA 3GLTA 3WAMA 3OEYA 2F3PA 2RARA 3K71B 1NY6A 3NWPA 1RQ7A 2JXTA 2H2DA 2X5NA 3NAMA 4JU9A 1ODSA 5A62A 5FR6A 3S2FA 4BZZA 2ZCUA 3IT4B 1I3LA 2E4WA 4HNSA 3OKAA 1NXWA 4RY0A 2ODBA 3UW1A 3L8MA 4CT4B 3VAYA 4NLLA 1GP2A 2NXWA 4G2TA 5DN6D 1DAMA 1DX6A 1M1ZA 4LNUA 5BMVB 1QF6A 3L4SO 2HWYA 2X5KO 2KWVB 3O8OB 1WKVA 3R0JA 3KWVA 3MTDA 5CIQA 5FTWA 5LYYA 1LK7A 2R00A 3QF4B 3ZGOA 2V1YA 1NT4A 2P9BA 3P9CA 4Q0MA 2QUHA 4K40A 4CT5A 4PN3A 1XCTL 4D41A 3I2JA 4LGMA 4XJVA 2VJBA 3CUTA 2YN0A 1QUEA 3CZRA 2PYIA 4QAQA 2OOSA 4ZOHC 2PRKA 4ZGWA 1J7AA 3VKFA 4AP6A 1U6IA 2YVQA 4CEJA 2WSBA 2M6RA 5FTJA 3DS8A 3SSOA 2GPSA 3W5JA 3OIUA 2KWIA 3BINA 4EHFA 2JCYA 4E70A 1T1EA 1UEXC 2FPKA 2P1RA 2FN7A 4XJSA 1A7AA 2Q0QA 2Y9MB 3OCUA 3SYTA 3BVZA 4TTPA 1FFBA 2AT1A 4DQOC 4UNQA 1AQUA 4WN9B 2RHJA 3RNGC 3AY3A 4P5EA 2OV1A 4F7WA 5F9HA 3HUFA 2JK1A 3JQ8A 3C87A 4URKA 1IVNA 1CUIA 4GI2A 1LDEA 5DP2A 3VC7A 2CL0X 3CX8A 4NJMB 2DM6A 2VNIA 2ZSHA 1PZGA 2CHQA 4CIBA 5TPZD 1C7FA 1USIA 3B9BA 2D5BA 1ADGA 1X7ZB 2LZ6A 1F8UA 2G1KA 3NWOA 4QUBA 3KXLA 4Y1EA 2FE1A 1JLRA 3B3GA 1WF6A 1W0KD 4K1LA 4EI8A 4FJ1A 3WAGA 2FAZA 4WY2A 4Z5YA 5BWOA 2X0NA 3DVQX 2ENWA 3LQ1A 3NGMA 2L18A 1XEXB 1U1IA 4GVLA 3C19A 4KITB 1KS2A 4XE0A 1H9CA 1OBHA 4JL6A 4EFNA 4OM8A 2C7RA 1ROEA 5ALWA 3T3EA 5AUKA 2Z83A 2RB4A 3HUTA 1E98A 1JH8A 2QPOA 4RPHA 5AH0A 3ZV4A 3ESXA 1DI0A 1D2CA 1RYDA 4EHKA 1BYUA 1P80A 2BKAA 2D1SA 3ANMA 2UU7A 3C8DA 2W6ID 3D4PA 1NBMA 4W9NC 3I6ZA 1LQBA 4EGJA 3NOVA 4BKOA 1ZFNA 3GBPA 1IQPA 2GLXA 3MTIA 1BMQA 3UKOA 4Q3NA 4TYFA 3K31A 4H3KB 1KKLA 2VRBA 2M0AA 4YPOA 4WJQA 1TTHA 3LT2A 1R0RE 1ZSNA 1VLVA 1AF4A 1ONSA 5DYWA 4LNUB 4IJUA 3JVVA 1KVRA 2MCFA 1TQHA 3EY4A 2VHUA 1JLLB 1KZ1A 2A3RA 2OC4A 3PV0A 4XM1A 5C5CA 4NESA 4OD0A 5C23A 1KH2A 3ELBA 1IULA 2FAXA 2BW2A 2G67A 3SM9A 4TRJA 4WA8A 2B94A 2W4QA 3QEJA 3U80A 1Z3IX 4B3FX 4ENVA 3G5UA 4X3CA 3SRXA 4EH1A 5BMHA 3I9JA 4MB2A 1J5XA 4EPRA 5JCOC 4XYMA 1NXPA 4NF2A 5FWXB 1U0TA 1SULA 1IVYA 1UBUS 4TN1A 3SCZA 5BSFA 2VXYA 4IICA 1RPZA 1E3MA 4MQEA 3LCVB 2X22A 1P3QU 1U3WA 2X7XA 4D9EA 2BF7A 1E3EA 2BLNA 2ZB8A 4WZ6A 1X87A 3K96A 1V3UA 3QMWA 2RPVA 1AB6A 1U3CA 3DCYA 2ZIUB 2HDNB 3EMKA 4WKGA 1W5EA 4OQMA 3KD3A 3KOMA 5KVCA 2ZUDA 4LI3X 4DUYB 3A36A 2IHUA 4GUDA 3SU8X 2BFPA 2MU1A 1EX6A 4EG3A 4MGIE 2XVYA 2QDSA 4RKYA 2O05A 2JXXA 4JI1B 3NIBA 2YV2A 3ROXA 2BC2A 1WY7A 3WG9A 1J42A 5AEKB 1C7EA 2R68A 4KWTA 1DFIA 4PYLA 2JB9A 4Y8VA 2WUDA 3VO2A 2DKOA 3QSGA 4OSOA 5CX1A 2DHEA 3ZOKA 4AWBA 2CHEA 2JBWA 2YTZA 4D9BA 2HTHA 4XPIB 4PC1A 1LLFA 3U7ZA 1NAHA 2BV3A 1KXZA 1XA4A 4LOIA 4JYPA 1ZK3A 3QJZA 2QUBA 4FSDA 4YPFA 4YACA 5DPSA 1LBSA 1M94A 1MW8X 2FHXB 3GBVA 4OVVA 4HDKB 3L41A 4HN4B 4P34A 3VBCA 2DC1A 1JVBA 1LB1B 5FJIA 2RGGA 1S02A 4FEEA 4PRLA 5ALZA 3U48A 3ZY2A 4YAIA 1SBNE 4GOMD 2Q5HA 3D2CA 5L45A 3ZGYA 4QLBA 3KUDA 4YMTA 2RHRA 3JR7A 2VOEA 3NLLA 5EGNA 3GU3A 1E62A 3DHBA 3HZZA 1AB5A 2CVPA 2K2QB 4QNMA 3H8VA 1NI2A 3KPJA 1Z38A 1XZAA 4WT7A 3DNFA 2R1TB 3OE4A 2Z8ZA 3EFUA 2E6KA 1SC9A 1ZMBA 3QA9A 2XGGA 2XW6A 4OHRA 2KMLA 3VSBA 2DAJA 2HPVA 4NJMA 5IJAA 5C9ZA 1BE8A 1L4DB 3D5TA 2EEPA 4WNYA 1SCIA 3THXB 1L1EA 5I01A 3LUDA 1JIVA 1IEQA 5HM8A 5FK9C 2VHEA 4RF5A 3K94A 3RVJA 1MFPA 2D10A 2D5LA 1M6WA 4OAQA 4OK5A 4RU1A 4RHYA 3ABIA 5J2UB 2FOLA 4JP1A 3OD1A 1Y4SA 1ZOLA 2ATCA 1JBKA 2BZSA 1VCBA 3IXLA 3D1VA 3NV9A 5JLAA 1KZHA 1K3UB 4OIFA 1RSZA 4RC9A 1MFWA 2CLDX 4I6PA 2H92A 4GUAA 4I9UA 3SI7A 1ECPA 4MZDA 5D00A 2J31A 1SHLA 1GM5A 1UBNA 1SQFA 4TV8F 1EB8A 4HRAA 2P69A 4FC6A 2HEIA 3E3OA 3KJNA 3C0KA 2P6NA 3ORFA 5LQJA 3CH6A 5FH9A 5DHQA 1CDOA 4YJ2A 1M6YA 1WHSB 2A1IA 1Y9AA 2D54A 2JGNA 2QENA 4EKIA 1W59A 5F9FA 4DDMA 2VUIB 3H8SA 5DLYA 4ETIA 4NG4A