3BK1A

Crystal structure analysis of rnase j
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
551
structure length
551
Chain Sequence
GPQDHVEIIPLGGMGEIGKNITVFRFRDEIFVLDGGLAFPEEGMPGVDLLIPRVDYLIEHRHKIKAWVLTHGHEDHIGGLPFLLPMIFGKESPVPIYGARLTLGLLRGKLEEFGLRPGAFNLKEISPDDRIQVGRYFTLDLFRMTHSIPDNSGVVIRTPIGTIVHTGDFKLDPTPIDGKVSHLAKVAQAGAEGVLLLIADATNAERPGYTPSEMEIAKELDRVIGRAPGRVFVTTFASHIHRIQSVIWAAEKYGRKVAMEGRSMLKFSRIALELGYLKVKDRLYTLEEVKDLPDHQVLILATGSQGQPMSVLHRLAFEGHAKMAIKPGDTVILSSSPIPGNEEAVNRVINRLYALGAYVLYPPTYKVHASGHASQEELKLILNLTTPRFFLPWHGEVRHQMNFKWLAESMSRPPEKTLIGENGAVYRLTRETFEKVGEVPHGVLYVDGLGVGDITEEILADRRHMAEEGLVVITALAGEDPVVEVVSRGFVKAGERLLGEVRRMALEALKNGVREKKPLERIRDDIYYPVKKFLKKATGRDPMILPVVIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Metal dependent hydrolase
publication title Structural insights into the dual activity of RNase J
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 167
structure length 551
sequence length 551
ec nomenclature ec 3.-.-.-:
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bk1A03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 3bk1A02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3bk1A01
4AWYB 2BG6A 5EWAA 3FAIA 4Z7RA 4ZNBA 3G1PA 5LLDA 2WYMC 4D1WA 2BC2A 4H0DA 4WD6A 1X8GA 1A7TA 2GMNA 3X2YA 3I0VA 1SMLA 4ZO2A 1BMCA 4UA4A 4EFZA 2QINA 2I7TA 4EXYA 5A0TA 5EH9A 5KIKA 3RKKA 3ZNBA 4DIKA 2BG2A 4NQ6A 4UWSB 2YNVA 4TZBA 5ACVA 5B1UA 3SW3A 4DILA 4NQ2A 3KNSA 5LCAA 5HIQA 3PY5A 4U4LA 4XWTA 2DKFA 4KEPA 4FR7A 2ZO4A 1VGNA 4GYQA 3I13A 4YSBA 1M2XA 2BTNA 2GKLA 3MD7A 5HH5A 5AEBA 5EV6A 4TYTA 5ACQA 3DHCA 2P4ZA 2OHIA 2R2DA 1HLKA 3IELA 2BFKA 3IEKA 2A7MA 5ACRA 2BG8B 4J5FA 2FHXB 4AD9A 3VPEA 1DDKA 2BR6A 3IE0A 5HISA 1KO3A 3KL7A 4TZ9A 4C1EA 4BP0A 1JJEA 3R2UA 2FU6A 1WRAA 4GYUA 3X30A 1ZKPA 2AIOA 3I15A 5FQBA 2BFZB 3DHBA 4C1DA 4FSBA 3PY6A 3BC2A 5HIPA 5EW0A 3ZWFA 5K0WA 4BZ3A 5ACSA 1MQOA 4UWOB 5EVBA 2YNWA 1L9YA 5LS3A 4YSLA 2DOOA 3RKJA 2BIBA 2GFKA 4RBSA 4NQ5A 4B87A 4EYBA 2YZ3A 4RAMA 3X2ZA 4RM5A 4TZEA 4XUKA 5EVKA 4GCWA 4YSKA 2H6AA 2YCBA 4KEQA 3H3EA 4Z5YA 5A87A 3TP9A 3SD9A 4F6HA 5LCFA 2XR1A 1VJNA 2Q42A 5ACPA 5HH6A 5ACUA 2BG8A 3IE1A 2FHXA 3WXCA 2BGAA 2BG7A 3ZR9A 1ZNBA 4FEKA 2WYMA 3RPCA 3AF5A 4PVTA 4PVOA 2QJSA 5ACWA 2Y87A 4AX1B 2GFJA 3AF6A 2VW8A 1BC2A 4UAMA 4V0HA 2FM6A 3JXPA 2FK6A 3BK2A 5B15A 2BFZA 4AX0B 2BMIA 3S0ZA 2WYLA 5HH4A 3P2UA 3ZQ4A 4LE6A 5ACXA 3T3OA 5AXRA 2P1EA 4Z5ZA 5AXOA 1KO2A 2Q0IA 2QDTA 4TYFA 1A8TA 2M5CA 4Z6XA 3ADRA 4C1FA 4D1VA 4O98A 3SBLA 5IQKA 4D02A 2NXAA 2OHJA 1BVTA 1QH5A 2P97A 2CBNA 4Z67A 5K4KA 2Q9UA 4AWZA 2GCUA 4C09A 2WRSA 4TZFA 1WUOA 1KR3A 5FQCA 1YCFA 5EHTA 3FCZA 1VMEA 1Y44A 4RL2A 3IOGA 4JO0A 1JJTA 2Q0JA 5ACTA 5LCHA 2P18A 2ZZIA 5EV8A 1K07A 4HKYA 4NQ4A 3IDZA 1ZTCA 4C1HA 1X8IA 3DH8A 4C1CA 2ZNBA 4UWPB 1P9EA 4UWRB 2WHGA 1WW1A 2NZFA 2QEDA 4D1TA 5LMCA 2Y8AA 2YNTB 3Q6VA 1YCGA 3VQZA 3SFPA 2FU7A 2Y8BA 2I7VA 2NZEA 3BV6A 3QH8A 3SRXA 4Z60A 5FQAA 4EXSA 3ESHA 3PG4A 3DHAA 4RAWA 1DXKA 2BFLA 2FU9A 4UBQA 2E7YA 5LM6A 3F9OA 1YCHA 3T3NA 2YNUA 2ZWRA 3I11A 2XF4A 3X2XA 5A5ZA 3IEMA 5K4MA 3SPUA 5K4NA 4ZO3A 2QDSA 3KNRA 1DD6A 4HL2A 2FU8A 3AJ3A 4HL1A 5LSCA 3BK1A 5KILA 3T9MA 3LVZA 1XM8A 4RL0A 5LE1A 5HIOA 2I7XA 2AZ4A 1X8HA 2YNVB 4D1UA 1JT1A 4ZEJA 4EY2A 1E5DA 5A0VA 3A4YA 4EYLA 5DPXA 4P62A 5B3RA 4F6ZA 5EVDA 5AHOA 2NYPA 4EYFA 2OHHA 4CHLA 4J5HA 2M5DA 5AHRA 2YNTA 3L6NA 3IOFA 4XWWA 2UYXA 1WUPA 4C1GA 5AYAA 3I14A 2HB9A 1XTOA 3IE2A 1QH3A
chains in the Genus database with same CATH superfamily
4JDUA 1T91A 2DWCA 1RYJA 1EX7A 1WRIA 4DIOA 5CYPA 4NBUA 3AY6A 5FEUA 1N0UA 2W9XA 5CXUA 1AUPA 3I52A 3QEBZ 5LQAA 1BZYA 4ZEOA 2WHEA 3BB1A 4GXTA 2RGRA 2LZ6A 1T0IA 5BWNA 5ALJA 1M0EA 2YV3A 4EG3A 5FR3A 1QH1A 4NONA 4D7AA 3HHPA 1ZOPA 4U4LA 1O5OA 1O96B 2QJWA 4UNPA 1AOXA 5HNKA 3CKKA 1V8OA 1EESA 2HRBA 3GGGA 4MH0R 3H97A 4XJXA 4KQJA 2PKQO 2ZRHA 2GDZA 3F3KA 1I4WA 4AKSA 1V8CA 1J00A 3GDWA 2WNSA 3M5DA 1W4RA 3AKEA 1P6QA 3L8GA 4I6PA 3KOWA 1MD9A 2PVGC 1J9ZA 1LPPA 3PG5A 3UCXA 3Q40A 3K4QA 1FCLA 4GP9A 3G6WA 3A31A 4NV1A 4TWIA 3U9TA 3S0JA 1AF4A 3JRWA 1OYWA 3KW5B 3HL0A 5AOCA 3ZCTA 4PZ9A 3NGMA 3JZDA 1RVDA 3ANLA 4BBJA 4MQ5A 4Q9AA 3VDQA 3RK1A 4XD2A 3QHQA 1QANA 4CL2A 2NU8B 2C96A 1SZDA 2PLPA 4KLAA 3NH6A 4GPBA 3NHKA 3OOWA 1YBFA 3AM4A 1KMCA 1HI9A 4F6CA 4LFCB 4DDMA 2RG1A 5EJIA 1Z6ZA 1XRMA 3I09A 1TF7A 5ACUA 3Q2OA 2R6FA 1M0TA 4NY0A 4JB3A 1I51A 2K6GA 1HE3A 1BJTA 2HYIC 2KYWA 1LGYA 1DO8A 4ZT5A 3TSYA 4LVOA 4LVNA 2WUFA 2B8EA 1PLLA 3E8SA 1RYHA 4B8YA 3ER8A 4D0RA 5E4JA 1AHHA 2WB4A 3WA0A 2IYAA 4BNJA 2CD7A 3VZQA 2YX1A 2X13A 1RQ7A 3T95A 4U8GA 2GBIA 4TTSA 4HROA 4ZVLA 1ZH2A 1C7QA 3CLRC 1W87A 4WQOB 3C6QA 2HA2A 2N1WA 1SN7A 1Z2EA 1ZKDA 4WERA 1UZXB 3AE3B 4CQMB 2F3UA 1BCRB 1EWYC 2VYNA 3H11A 1ETUA 4YDRA 5DI3B 4UJ5A 1LBSA 4AZ3B 2XA9A 1EGAA 1CBUA 5LLTA 4P7BA 4F8JA 4TRNA 5DLYA 2QL9A 1UP4A 1OJ7A 2DBQA 2P5UA 4GVXA 1UMBB 2FE8A 1U2GC 3EH2A 4W82A 3HJRA 3WYBA 1ND6A 3C14C 3R7AA 3H1TA 3P42A 5GIOE 1DXYA 2I4RA 3PJRA 3CPSA 3MQFA 3RUEA 3CTPA 5DASA 3UG6A 4KN8A 1F14A 1XXHE 3MJEA 2P2NA 3F5QA 2Z2YA 1SY7A 1SVKA 3TL3A 4QFMA 1PTKA 4EZJA 3PPXA 1V8FA 2AJTA 2BYEA 4PYJA 2Q27A 1WPXA 1CVLA 1X1QA 3A33B 2XK5A 2IVZA 4YI5A 3T1YB 2SBTA 3UMRA 1VDMA 1C77A 2IPKD 1XZHA 2Y05A 4JJ6A 3ZV3A 1G8YA 2HD5B 2FLWA 3JYHA 4WKPA 2G5PA 3QA3E 4IOJA 1Q50A 4Y9RA 3MGBA 5JHGB 4ALKA 3AKZA 1X86B 2NXCA 1K6MA 3VZSA 4C0LA 1NMSA 3KVOA 3ETRA 2BGKA 4IOIE 5AIJA 4ZQGA 5DNYB 2G6BA 1CPYA 3TFQA 2ZE7A 2H1HA 1L1QA 1ZEJA 2QTBA 2AMVA 1ZCJA 2V6GA 3PYXA 2QTNA 2YWBA 3VZCA 2AL6A 3N8KA 2CB0A 2M4NA 4P22A 4HDMA 1EFVA 1BMQA 2QAIA 3U0VA 3PZBA 4ZZ2A 4PX5A 4Q21A 4UUAA 2C4HA 4G4SO 1V9LA 3LBHA 5TQJA 5LXTA 2YV4A 3OOEA 2QAJA 2BS3B 1S2MA 2B8NA 3EVFA 2BBTA 1W93A 5BN4A 1CRQA 1U3CA 3PCXA 3LLCA 4C4VB 2WS3B 2J5XA 4YMTA 4YCSA 4HEA1 4W9IA 1GB4A 1PS8A 3H2ZA 4RM8A 1SQFA 4LQDA 1ZJJA 4Z4GA 4EY4A 4ALNA 4PLZA 1T2VA 3KOXA 3G68A 2VBGA 3UH0A 3L0IB 3THXA 4CFSA 5AK4A 4J5FA 1VL0A 2HA5A 4ARBA 4OIFA 2W2QA 2BJHA 3HFSA 2Q7DA 1NWHA 2EZ8A 3PQFA 2VTVA 4BVGA 1CR6A 4A8JC 3X30A 3CVWA 2WYIA 2ZXUA 3PE6A 1ZA2A 4G9EA 1ZC3A 1VI2A 4TL6A 5EP2A 3NHFA 1Z5PA 3BXFA 1USWA 5DTIA 2JGAA 5B2ZA 5EQJB 4F4CA 4CQLA 5KDOA 4LYJA 2XN9C 4PFJA 3ZNHB 5CGZA 2OD2A 2A0XA 1L4FA 3N3BC 3JX9A 2AMLA 3LSTA 4XUKA 3HDYA 3TI7A 3HXMA 4D41A 2AE1A 1IMOA 1SEBD 1QV9A 4DDVA 4DY4A 3JS5A 3N05A 1VKRA 5CHEA 3T3MB 3WSVA 3T12A 3WKEA 4D43A 3RWOA 1WM2A 5BPHA 3EXEA 1CG6A 3IP3A 1ULSA 1NW8A 2BFEA 3TNYA 3ZC3A 2BWES 2L0FA 4LX0A 5DK6A 5EZYF 2WJ4A 5EP4A 2PM8A 5TPZD 4MPTA 1JIJA 1P62B 1Y63A 3PKZA 1J7JA 3ZQUA 1YRBA 3OO1A 2QILA 3B52X 5ALQA 2ECFA 2HBYA 1XTBA 3H2HA 3IURA 1OXTA 1TUIA 1TCAA 3QXJA 5JASA 1UQRA 5IN5A 4ERNA 2GLUA 3CZMA 4EG5A 4A8XC 4G0VA 1CJCA 2V7QD 4EY3A 2IHKA 5IEJA 1PWHA 1WHSB 1KA9H 1DPGA 1K53A 2KOXA 3DOJA 2QZPA 2G0TA 1NVID 2XGOA 3A9KA 2EKZA 3GLTA 4EK9A 4M60A 1LI7A 2Z1DA 3VPCA 1OFGA 3OEEA 2HCJB 5TPWA 4ZVKA 5A4AA 3QXSA 2IGHA 3TQQA 5ACTA 4PZPA 1SVWA 2AEEA 3A1QA 3GMSA 3QHTA 4UFNA 4HLNA 1VE1A 3DP9A 3PF9A 1XN4A 3AN1A 2WU8A 1W59A 3HWRA 4KRFA 4MB2A 3WLIA 3ZVKA 5E4YA 4BX0A 4QXRA 3QJZA 2EG5A 2GAIA 2Q1TA 3I9FA 1D6MA 2H00A 2YNMC 3ZBUA 5K0ZA 1H5NA 5C2JB 4IX9A 3OH8A 2R11A 1JFFB 2XMRA 3VFKA 2KYRA 1N6HA 4YRLA 5INTA 2JLXA 2KTRA 1MQSA 3OEYA 3L4KA 1QZXA 4F12A 5LSCA 2IYEA 5T4HA 4Q66C 3RVDA 4CKXA 4FP9A 1VE6A 4FSDA 3LVZA 1XM8A 1NMEA 3K9NA 5HIOA 2OGSA 3WA7A 2MHCA 4M7RA 4LKOA 3C5CA 4CHKA 2R47A 3KBOA 1UOPA 3IA7A 3Q98A 1GPYA 3DEKA 1YQQA 3JSAA 1CZHA 3PXCX 4J07A 2Y1OA 4OATA 5A6VA 3N07A 1WXDA 2BM1A 4OFWA 1UMCB 5E9AA 4GDKA 1TZMA 1VRWA 3DMGA 1SCUB 4AZ0B 4R9SA 2H0QA 2PKCA 2O6LA 4NJEB 5GVSA 3NJ4A 2B7CA 3EQ2A 3T1QA 5LWQA 1R9JA 2V8OA 3Q8CA 1PVDA 4UOZA 4CTNA 3FLMA 5ALXA 5JS1A 3KVNA 3SX2A 2NTSA 4JUDX 1MKYA 3P26A 4EYQA 2IYWA 4ZVMA 4LPKA 1R8QA 1I4DD 4H7JA 3PNKA 4LA4A 3WHPA 2ZTVA 2BHTA 1HA5A 3ZNID 3TTSA 5IYZF 4X61A 3A58B 1JBEA 4OQQA 4FR2A 4IDHA 3WV5A 4KLZA 4A0GA 1OWMA 2CZCA 1EHIA 1GNSA 4YRSA 1UMDA 3ZGLA 5EWLB 1IXZA 1Y1KE 3REQA 3GBSA 3ANMA 1X6VA 3JYQA 4I5DA 1TT7A 3P4XA 4LW8A 3E7DA 4YT0B 2BTNA 2O8CA 3P2IA 4XASA 3UQAA 3ZV4A 4FGUA 5BMHA 1NUQA 1U9JA 3ZXUB 3QFFA 4HY3A 5EUQB 3LWZA 1JMLA 1STOA 4GYKA 1Q11A 1Z25A 3NNNA 4MW5A 1V39A 1P2UA 3IEIA 4ZOBA 4M0WB 3AVXA 4LJAA 3M3PA 3O8NA 4DR4B 5DT9A 4EKYA 1U3WA 1PJRA 1N6PA 3N0XA 2H9YA 3AXSA 3EAQA 2OO7A 5DGDA 2PG3A 4E1AA 3DT8A 4FFMA 4UHDA 2NACA 1H9CA 1EYZA 1EVQA 3ILYA 2PE9A 1OPXA 1UBUS 1QP0A 1JB1A 4EUFA 3TP9A 2RGEA 1WW2A 2VYCA 1U3DA 1AZSC 2E4XA 3WFJA 3U44B 4EZKA 3GWGA 2NSLA 2NUPA 2GYWA 3SSAA 2C03A 1HFKA 3TBLD 2NUTA 4M0PA 1SHUX 4PVTA 1VG0B 5KYTA 3VHLB 1FTQA 3ICCA 4LCBA 4M0CA 2QW8A 3B5JA 4V0HA 3LHDA 3B12A 1JE0A 4KOAA 4M8SA 1OLXA 2P41A 4PR0A 1C9YA 5LDDC 3PFCA 3ZZ1A 4ENPA 5AXRA 5TE9A 1P1HA 2SKDA 1DAGA 2VJNA 5J18A 1Q91A 2AUMA 4C06A 4I9NA 3GE3C 2H6EA 5KU1A 1MO4A 4HVBA 2ZT8A 4R84A 5J23A 3EUB2 5IVHA 4K2HA 1G3IA 5LXTF 3RSHA 2G9UA 4KGSA 2XCTB 4KDLB 3V55A 1EUDB 4OYHA 4PG4A 1WOMA 1S1MA 3SQDA 3DLIA 3RYCA 2VZ0A 1YCFA 1YOVA 5EHTA 2DAFA 2IITA 1NJSA 4IH4A 5JFGA 5TS2A 4KP7A 4GYYA 1CF2O 4MUGA 4X63A 3KL2A 3QVUA 5FPSA 4RAQA 5U9CA 3I92A 1UXIA 4NQ4A 4DE5A 1X8IA 3AEFB 1T10A 2LXAA 4DMRA 2I3AA 3ECIA 1ZUHA 2YC4C 4DXGA 3P4RB 2QGZA 4IXNA 2QTRA 1J24A 5EJ9A 4Q0MA 5ERGB 4EJSB 3ONSA 5JMOA 5KDDA 5MFZA 1ORWA 2X3UA 4Q9HA 2CLOB 2HADA 2Q1WA 4L4RA 4K9PA 5J4VA 2C54A 2WXPA 1KZHA 1T4GA 2HRCA 1WE6A 1QIDA 4L5JA 3H3FA 4MPDA 4KXYA 3UJHA 3WP0A 4FCCA 3MWEA 1XQ6A 2ZIXB 3W3AD 2I3GA 1U9IA 4IWNA 4L7VA 1I2MA 4ND4A 3BL6A 2IEDA 1IXSB 4DRZA 4ND3A 5AD1A 4UUBA 2GH1A 4REOA 5IAEA 2ZIUB 4IICA 2RKOA 1A4IA 1TFUA 5I7FA 5BPFA 2ZKIA 1GPAA 2UUOA 2WTBA 4EYFA 4IWPA 3IPXA 4CF4A 4OFZA 1XTTA 1JVSA 3ZRCA 1NURA 2XNJA 1DC7A 3FJ1A 1ZXBA 2PANA 4MKHA 1D6NA 5FK9C 3KCNA 4NV0A 4DR3B 2HRDA 1DAEA 5K3AA 3KJZA 3QE3A 3NAMA 4MQLA 1UPUA 3R5SA 2OP0A 2VAWA 1A95A 3QZUA 3TIVA 5EVJA 3V2GA 4RU1A 3P9SA 4J3OD 3CH4B 2XB2A 5G55A 3AGPA 3PL5A 3GROA 2O0JA 4IV0A 5DP1A 2RK3A 9MHTA 3O93A 1NRWA 1DKUA 4FJ0A 3MTGA 1KFEB 4IWQA 4UU1A 4DWJA 4L6IA 2FE4A 1VXOA 3TPCA 4J1QA 2QRGA 3VYRB 4YAKA 1TYAE 3HCFA 5AVQA 4R05A 2X9VA 2R6GA 1XCJA 1YJCA 4IIGA 2V0GA 3DMTA 5DHQA 2VQFB 4JI5B 3BQMB 2MSWA 3SEFA 3ODPA 2E2WA 1TO6A 4JWUC 3A6PC 4KXWA 3QTBA 3TL6A 2Q4TA 4DLXA 4Y6SA 1XTUA 2Y1DA 1PG5A 1RLOA 1ILWA 1XN1A 1SBZA 3S2ZA 1DBRA 1PHRA 1XNJA 3EPKA 1PI3A 1ZHHA 2O2IA 1A76A 2GZAA 3ZY5A 1PT7A 5BUQA 5GGXA 4DLBA 4MYRA 1K6JA 1YGYA 3E9CA 3NPMA 2MINB 4IIYA 1Y4ZA 1HZZC 1MAAA 4TV8B 2MH7A 1TD1A 4S05A 1KEEB 4D9JA 4EJ2A 3C8DA 3GYGA 4W9KA 4Z5YA 3A3NA 1QF7A 3A0RB 1XWWA 3EWIA 3BZUA 1H8ED 1FUKA 3BSFA 4BMVA 1RU3A 1RC1A 1XRJA 1LX6A 3DZFA 3ZNGC 3F7MA 5GINE 4X91A 1PR2A 2WNMA 3VYUB 2X23A 2W93A 2O8DA 5B53A 3N6VA 3EFCA 4QTYA 3OQPA 4IHAA 3VR4D 1DBVO 3GGSA 1PDOA 1P7FA 4MDFA 4G09A 1DC5A 4DLZA 4KO4S 1H0RA 3MGGA 4C30A 2ZKLA 4NURA 1IWPB 4NABA 4RVNA 2E4YA 3WA6A 1M2WA 2B8JA 3IOCA 3KV3O 4BZWA 2EJCA 4M21A 5ESXA 2NZWA 1T8YA 3QTTA 3U3ZA 2D1QA 3R7WA 3QIVA 4YN3A 4HGPA 1O6ZA 1M8GA 3I9KA 4FILA 4GOJA 4LCJA 4KYVA 1UFRA 1RAGA 2ZWOA 2UXDB 3ANTA 2KFKB 4P3NA 1ODLA 3G23A 4R1NA 2YN2A 3FYTA 2F55A 4D8YA 1CQWA 2OJWA 4FE3A 4CLOA 5J40A 3DDZX 1V1MA 2XYPA 4KPGA 1BDHA 3AILA 4ZEXA 4OA8A 1GGKA 4L76A 5H5JA 5IYZB 4Q4LA 1NULA 3H11B 4CETA 1JR3E 1E1RA 5C80A 4U7WA 4RFBA 1FFHA 5K3SA 3HEMA 4BVHA 1YVUA 2QRVB 1H2BA 2Q2OA 4QD3A 4BFVA 3ENVA 2QX8A 4OM8A 5JWRA 2MSCB 3KQYA 1R5JA 2GNAA 4MROA 4NDAA 1B0UA 3DPDA 4GIBA 4JB0A 1L6UA 1JG7A 2PD3A 3KQVA 2D0DA 3O8QB 1KVUA 2NZEA 3LL4A 1KS9A 1VZ7A 3DHAA 3FNRA 2KO3A 1JTEA 2FMTA 3EVTA 3NHUA 1Z68A 5CLQA 1CUJA 3WJ7A 4AWAA 1Z13A 3RVKA 4QEKA 3SQOA 3QHPA 2JIZA 1JXOA 1AKVA 5KYYA 1GQRA 3ER6A 2Z1MA 3CEMA 3BWVA 5ALNA 2I3ZA 1KMMA 3SC2A 3U13A 4GPEA 4OYRA 4B6EA 1J9EA 5CCDA 4FPXA 1EVIA 1SUDA 5B3RA 1M66A 4GM4A 1RMYA 3VC3A 5IRCD 2IBSA 3H1FA 2HWUA 1MX1A 1EDEA 3L49A 3G7SA 5EIHA 1QUEA 1EFPA 1NJ8A 2J0UA 4HMQA 2L2QA 1S4QA 1NMXA 1UF0A 5C5CA 4RMJA 2AG6A 3K53A 4KQMA 2P1DA 4BGEA 4OKSA 4Q24A 3ZCUA 4IIFA 2Z4TA 4B35A 4YBRA 4WIPA 2PWAA 1U0HC 4MCJA 3KLOA 4UU8A 2E4ZA 1ZXIA 2WA1A 2EOAA 3E5NA 1TLTA 1T8WA 1F8XA 4ZANA 2NU6A 3IUEA 2FQQA 2PT9A 2Q4DA 5JHHB 5EDSA 2P79A 4KPUA 5BNZA 4U7FA 4UUPA 1SKMA 5G3YA 1EFVB 10MHA 4OH1A 1IHUA 5CT5A 5DW3A 3QKWA 1GAQB 1M9NA 4QYWA 3W6ZA 1XEWY 1M2XA 3HDJA 1RI1A 2FJUA 3LD9A 4BRWA 2WKWA 3RWBA 5LXTB 2CLCX 4YUXA 1Z35A 3VKVA 1SO8A 1QFZA 4NKRA 1VGQA 3TQHA 5EXTA 5FA5A 4B3IA 4QPZA 3E9MA 3GCZA 2XJ9A 4MMXB 3H6HA 3TKLA 4HNQA 3PY6A 3I2HA 4KVZA 4RD4A 1G8FA 4EVIA 2VRNA 4Y3UA 3WGMA 2OQIA 3U52E 3GLRA 2JCYA 5SYNA 3GGJA 3OICA 3HP1A 1AQUA 3B85A 1HR0B 4U9IS 4KEAA 4D9KA 1USUA 3RMKC 4YK7A 2XD9A 3UHJA 2IPAB 4LTNA 5LP6C 4M98A 2KHWB 3UWDA 1ECJA 3AHJA 3C48A 3H3EA 1Y56A 4DVGA 2IKSA 1RLUA 2A5FA 4XX0A 3ZDFA 3ZH2A 1OFFA 3EFEA 1XDGA 3HA3A 5AW3A 3CF4G 1KWKA 1PT6A 1B0AA 2INNE 3GLVA 2ZR7A 4MI3A 2ILVA 4W7IA 4DDHA 3MJRA 4MINA 4YCMA 3QQ5A 1YACA 2GEUA 2XSZA 3TF5A 4EUKA 1WXQA 3VO2A 4XM0A 2DFLA 3TVYA 1UBOS 4GGQA 3ESXA 4L08A 3BTSA 1C9MA 5EHNA 1RHJA 1OXVA 4OP2A 4WZAE 5DK4A 4MW1A 2FSHA 2HK7A 3ZXIA 3C6BA 3JAWA 1DFHA 1JP7A 2ALJA 1JEEA 4NJ6A 5PGMA 2AFIA 3B7GA 1UJ2A 9ABPA 3B9BA 4IVPA 3CH7A 1IUNA 3HV2A 3B82A 1I94B 1L0BA 5AXOA 5KHLB 2N7DA 1S3GA 2AWNA 2ZBPA 1YR6A 2D74A 1QZTA 3LW7A 3SBLA 4IDBA 3NBFA 3OJXA 4EUEA 3B6JA 4EO9A 2EARA 1UIMA 3X44A 4IQ8A 4NCXA 1ID8A 5TSSA 5BOSB 4RDCA 1RNLA 4F5WA 4G41A 2PUWA 3STXA 4DJAA 1KO4A 2FGJA 4YP0A 1EBBA 3AIOA 2ZAGA 4UAVA 5ALYA 1DC4A 4OHBA 1RAFA 3QVLA 1NOIA 2RKBA 4N5IX 2IBTA 2I4OA 2IYPA 2NADA 3Q88A 5KQLA 2XCSB 3U5ZB 5JW6A 3U3XA 1C0IA 3C3PA 3SZMA 2G9RA 2A86A 3UMGA 3V8BA 5CJJA 3B48A 4QJ5A 3JAKB 4ZCPA 4NESA 5CXSA 1ZXHA 4NENB 3SRXA 2HR1A 2COUA 1RS0A 4FZ5A 5IKEA 3DR5A 5KNCH 2Z58A 3MJDA 5F9MA 5K4MA 1MRNA 4KR7A 5B4UA 3HVJA 4XLLA 2FV8A 1SD5A 4OQLA 1WCXA 4ZO9A 1DOAA 1QORA 3LCUA 3RVLA 3GRRA 2C42A 1YC5A 1U63A 1GILA 2TECE 2PR7A 3FPCA 4HAYA 1RYFA 2FSIA 3EIQA 4AULA 3ZXSA 4E31A 4KKIA 5D7BA 2PX0A 1EF1A 4URWR 1E9CA 2C2OA 4H7HA 2QRHA 2XRMA 4KDCA 1CUAA 3HB9A 2XT9A 3LE8A 1Z33A 1W25A 4R2IA 4M9RA 3W5IA 4F46A 1WVGA 2Q2VA 4JOBA 4C1GA 1G21B 4WZBA 3EEIA 3GZTB 4OK5A 3NWJA 4GM0A 2WUDA 4NWIA 3RG2A 4DNOA 1DJOA 3EDQA 2BYVE 2LCIA 2Q1YA 4IYJA 2GXUA 4WOJA 2VDOB 4PSDA 4P38A 4L3OA 4Q7QA 1E2IA 4L1KA 4PV7A 4UHFA 4Q4HA 1DU4A 3JQAB 1GEEA 2DFNA 4J0JA 1CERA 3LUJA 2WQ7A 4QQRA 3OQ1A 3WRVA 3EZ9A 4ZU6X 1XZBA 5COBA 2CLIB 2ERYA 2OLEA 2ZO4A 1WJ4A 2EZTA 1WB4A 4EUNA 3BB4A 4YCNA 3KYBA 1H3EA 1ZH4A 1SUBA 1SNYA 3WQBA 1YFZA 1VIAA 5EKDA 4FFWA 1I6LA 2JZNA 4UQLA 4QLOA 4NU8X 3B2EA 4Z51A 2PS3A 3TFOA 1KZGB 3REQB 1EP9A 4ETMA 3PC7A 2JD1A 3KD3A 3QPVA 2BUBA 3THRA 3U48A 3CZPA 4HQLA 1NIJA 2R61A 1AGYA 1VL8A 2VL7A 2EJVA 1BEEA 2HV9A 3CPHA 4YJGB 1LU9A 5AJZA 2J4DA 4D9CA 1C4OA 2XUQA 1Q0ZA 3IFWB 5JUWA 2AHOA 1ZUIA 3FVVA 1OIXA 5C5IA 4DIUA 1SKAA 1QO0D 3PKIA 5F1YA 4FONA 3EXHC 3MTQA 1L4DB 2ZI5A 4CTMA 1R6XA 3C87A 2HO4A 3TCAA 2J6HA 1Y0BA 2OGUA 3UUGA 2YIMA 1EX9A 4P7JA 4OL0A 4GCWA 2LASA 2HB6A 5BSUA 1U1GA 2QAGC 4KEQA 2MP2B 1GVNB 3R0QA 2ECOA 1NU6A 2DPHA 1QQBA 2B2XA 3TR6A 1C1DA 2IOFA 2ZPAA 3CCCA 4TLDA 3NKVA 3KZ1E 1OVMA 1GAXA 3COPA 1NC1A 2REQB 4BAUA 2DBRA 5LUAA 5AK3A 5FLKA 5U4XA 4B9AA 3G82C 4OREX 5I01A 1ORIA 1H6DA 4URXR 5MHTA 1WZIA 3RPCA 2BGLA 2BE9A 3MMZA 4J4TA 1FP4A 3GLFA 2ZUEA 2XOXA 1SJHD 2ILTA 2J0EA 4P32A 7REQA 3NM6B 5DCNA 4FHDA 3BWEA 1JLLB 5FWXA 3ZJYA 2G04A 4FFBB 3AUUA 3CSUA 3DMYA 3GR6A 1BHQ1 2Z09A 3AHGA 4H35A 1LPNA 1Z5WA 1IAQA 1E4YA 1TYZA 2WXFA 2RHDA 1GXSA 5G4LA 4DIMA 1ENZA 4QPPA 4HJKA 3TGWA 1WEHA 4AJ4A 4RTQA 3D5EA 4OK6A 2AG0A 4IUBS 4WESA 5BORA 3NTQA 4XC2A 5HR5A 3UINB 1WTCA 4HB3A 4XAQA 2UUPA 1MNAA 2Q9UA 1FTYA 1N6IA 1XTVA 4NQZA 4E08A 3B6KA 2HMSA 2PYDA 5AJWA 1JKXA 2ONQA 2WFLA 1AN8A 4HO1X 1CFZA 5CGQB 4EE2A 3SSOA 2C58A 1EK2A 2W42A 4JMLA 3KYDB 3VTAA 1C4KA 1GARA 1PYWD 5C5EA 1MC8A 3E03A 3GZNB 2GAJA 4HLCA 3DB2A 4F2WA 2ZDQA 3CGWA 3PHHA 1G6KA 3L6DA 3O1HB 4WY2A 3QQ8B 2NP6A 1NI2A 1GAJA 3DVNU 2VP5A 2GPTA 3K0EA 3RYCB 3F5FA 1WFYA 1ZRSA 2OMEA 2Y8AA 3WL3A 1KETA 1M5UA 2WSYB 1U1FA 1FBNA 2HJVA 2P4SA 2ATVA 4QPJC 1QFMA 1ADGA 1LTKA 1VHJA 3F9RA 3IT4B 3ZDEA 4L75A 4QOSA 3BULA 2XEWA 4DA0A 3AVPA 1SCQA 2D5AA 3LQRA 3RYIA 4NZZA 3DTYA 1JBKA 4FT4A 1MPXA 4QT4A 3MNFA 1CS0B 1AQJA 1HE2A 4O8ZA 3W2FA 3X2FA 4WINA 2V65A 3I1JA 1KARA 2MCFA 3OM8A 2GF0A 3FKJA 4F92B 3EK2A 1LSJA 4EYLA 3TEXA 2G4SA 3OG9A 1CZNA 4KITB 2A78A 4Y0VA 4C03A 3JQ6A 3VH4B 1QE3A 3E9YA 3WI7A 4DB4A 2JRLA 3TN7A 1KY5A 4CKWA 4XWWA 4TKUA 1Y3FE 3VUEA 1V45E 2XA1A 3N75A 3C45A 4UTPA 3P2MA 4AJHA 1GA4A 5MN6A 2EQBA 1BD3A 1J8QA 4ZNBA 4JV5B 1Y8RC 1FTSA 2BCJQ 3U4HA 1LRKA 4F1SA 4KR3A 2H4HA 1A7TA 2BONA 3B13B 4IIXA 4MIEA 1WF9A 2GWHA 5DXFA 3ZW7A 3HR8A 3MD0A 4LE2A 4O2AB 3BJEA 1F2UA 1L1EA 4I3GA 2IYTA 4I3HA 1E1MA 1FZQA 4IDQA 2QJTA 4MI6A 4AOFA 1IQUA 3UJ8A 1RCFA 4KNVA 5ENVA 4E1VA 1N7HA 2CGEA 1X7WB 2VP0A 4XCQA 3VR0A 1UC4B 2H88B 2W11A 4XIJA 3KUCA 5HZGA 1PFGA 2F9FA 2Q6LA 1NW5A 1UDRA 1YAHA 1QJ4A 1YRYE 3NVDA 1IG3A 1GEGA 2P4ZA 5C8YA 2CXUA 5GQSA 3NORA 5JMPA 3TZBA 5A4IS 3CX6A 2M9MA 2JJYA 1IPHA 1KDZA 2X4GA 1MVNA 2ISSD 1G8HA 3HEBA 1F8YA 4UATA 3OT5A 3PGLA 3HY3A 2I4LA 4KPFC 3Q3CA 2BGUA 1FXWA 3ZTTA 4ASUD 3WIBA 5EIBC 2BFPA 4N3AA 3AEKA 4CF7A 3IT6B 2P3LA 3HCPA 3P0HA 4NBLA 1EB8A 4D9GA 4HLUC 3IUPA 1FMJA 4DR1B 3LSYA 3ZEIA 1L7YA 2FOLA 4RY0A 3PX7A 1IY8A 5EFZA 1E89A 1QU2A 3VOBA 2NO6A 4QYIB 1R8YA 4NK4A 2YZ3A 3E3LA 4AJ2A 5LB2A 3RUCA 5K8CA 4OLJA 2Q49A 1E6KA 2DB3A 1ULBA 3BA1A 1NBOA 5ALOA 1T9HA 3MCTA 4IUYA 5K3CA 2DSNA 4RPLA 3HJTA 4GFDA 3VPGA 3ZY3A 1V4NA 3EXIA 2ZUUA 1PS0A 2C95A 2RG7A 3ZUGA 2CY0A 5FUWA 2BGTA 2JYTA 2DEUA 3GP5A 1MJHA 2VSFA 2MW5A 4EGJA 3KQSA 4DMLA 1C7JA 2R7MA 4EFDA 2HJGA 2PX6A 1IDN1 2Z5FA 2QM7A 3ABZA 2QRUA 2GFJA 1J8FA 2H9IA 5CG1A 1UOOA 4MWBA 1BS1A 3ZQ6A 3VDNB 1RJWA 3AOEA 2AN1A 2W3SA 3NV9A 1FS4A 2FZ5A 5F3RA 2ZJAA 3P2UA 4MGYE 3CRMA 1VJ0A 1GKUB 4HZUB 2P4HX 3GUVA 3CLSD 1HT2E 4XQEA 3AE6B 3K1ZA 2LI5A 1F8FA 4BP3A 4GS5A 1R50A 2QW1A 3IG3A 1O03A 3S44A 4EEZA 4B3HA 1EVLA 2B4RO 2MR5A 2MSED 2H07A 1DEAA 2IYVA 5ICFA 5FQCA 2VPWA 1VA4A 1E0JA 2A33A 9LDBA 4L4YA 2QE6A 2GJ4A 1A7JA 3WGKA 3ICEA 4EA8A 1U5CA 1I6KA 2NGRA 4CMCA 1W36B 2GM3A 2ZSBA 2PBZA 5E3JA 4YSXB 4TVBA 1F2RI 3A4VA 3O13A 4XZ3A 5AI4A 2CS4A 2WWTA 4FQ7A 5CDFE 1OQQA 1TUEA 1UAGA 1YRWA 4B0PA 5CBKA 3OZVA 2X4LA 1Z38A 3PZRA 2GBMA 3EIUA 2WWHA 1FXAA 5H3LA 4DC9A 3WX0A 1ESDA 2C0CA 4CG1A 1TU4A 4TMTA 4YTMB 3RJTA 3G17A 4ZRNA 1MCZA 4QQNA 2VDRB 3K3PA 1AGPA 5DTRA 1AXRA 3P2EA 1GPDG 4E6PA 3QV2A 4K1RB 1F0KA 2OCPA 4Q3KA 1Z0JA 3HVIA 1FYWA 2IVFA 3IBCA 4M0LA 4K7WA 3K8QA 4RTJA 3JD1A 4QLBA 1E2LA 2F4VB 3TSZA 1JDVA 2F9LA 2H1RA 1PJSA 3D7LA 2VXYA 5HTKA 1WAMA 1G291 2VN8A 3MMSA 4Q47A 3PD0A 2LCFA 4UM9B 4IIJA 2QUBA 2JY6A 3OWHA 2FLKA 4Q1EA 5A2GA 1JQ4A 3AVUA 3CX4A 3DLBA 4DJDC 3KZMA 4CCYB 3FPAA 3MIIA 4EQ6A 2IGGA 2JH8A 1JQKA 4Q9JA 2BWJA 1OV4A 4IZOA 5DN6D 1Q20A 1Z28A 5KTNA 4EZIA 4XEHA 4DBLE 3FW1A 2XB8A 3F49S 3X3HA 4KIJA 1JNXX 1L9XA 4JBWA 3ROZA 5FLXA 2GO1A 3SBDA 3PVLA 3KSBC 3A05A 1ZJWA 4WFKA 5G2OA 3KOMA 3W8DA 1UH5A 4DHZE 3R6LA 4XM1A 5IBQA 1SZCA 1QYXA 3H1GA 3LH5A 4DV4B 1VYVA 1XSEA 5GPBA 3HCNA 4IDIA 1SE2A 1ZONA 4K6KA 5EV6A 4YALA 3AU4A 1LX7A 2VHEA 2J7PA 2VNSA 2R4TA 3TLGB 3PIRA 1I1NA 1I1QB 1RWOA 1TC1A 3MQ2A 3IPCA 4OMUA 4MKZA 1X1AA 2K3UA 1D1PA 2P3OA 3DEYX 5GJWC 2E7ZA 3EA6A 4OXYA 1JLMA 4EWLA 5A05A 2LUMA 4O33A 5KO2A 1EU3A 3WADA 3I15A 2XNDA 3QEAZ 3D6HA 1HETA 5AKJA 4S0RA 4JR1A 4LBVA 1S3IA 4I19A 1VDVA 1XZIA 3MTBA 2NZXA 1QIKA 1RPAA 2FRDA 1VHTA 3MQ4A 3LDAA 1WX1A 4B4KA 1N33B 1DFGA 4AJIA 3MIZA 2VXOA 3ZKAA 1QC5B 2HWXA 5HPYB 1N9GA 4TXMA 4UCFA 1GNQA 1OX4B 3OZBA 3O0DA 1L5WA 4NYMQ 4FB5A 2I2BA 3ESDA 2EGGA 1CUSA 4PY2A 2R9VA 4EJFA 3QVXA 3TD2A 2RGUA 3V8VA 4MDEA 2F1HA 1GAWA 1E7UA 5ITZA 2ZRLA 1ODKA 4X85A 5DGXA 2ZIAA 1MPTA 1H2HA 5FUBA 2RGGA 4HH1A 2G06A 2J85A 3E3MA 2BGFA 3BRWA 4EFOA 4QPNA 3TIFA 5F77A 3IIEA 3PP8A 4REMA 3TDMA 2YVUA 3RADC 3QK0A 4ITRC 5REQA 2FW0A 4EKGA 1OT5A 2DENB 2PSHA 1SG0A 2POQX 1U90A 2B69A 3DDCB 3K30A 3C6XA 2ORWA 2FBWB 3NOVA 3IMGA 5JXGA 1E8ZA 2A3RA 2RI1A 4MT5A 3T35A 2GZSA 3FSRA 5JJ5A 3R5JA 2AFIB 5B37A 4P3OA 2DKOA 3O8OB 3P63A 3IJ5A 2O1XA 1SOWA 1L7MA 1NVTA 1MQ8B 3L5OA 3IR6A 2ZJ3A 4F84A 1B14A 3E3AA 3FKQA 2NZJA 4YONB 1XKLA 1Z4OA 2C3OA 1WSBA 3QF7A 4UXHA 4MWSA 3SC4A 5CJPA 5YASA 2D54A 3ZGVA 1JJBA 3U60B 2WDVB 4UWRB 3W9CB 2X4IA 4DC1A 4JLPA 4CU2A 1C80A 3AIIA 2GXQA 3NNSA 4Q37A 1A3CA 1K88A 2R4QA 4J0EA 2B4AA 5EP1A 3B6IA 2H63A 4HXYA 2W6PA 1E5WA 3GVHA 3RN9C 2B9VA 3C3JA 2YV5A 4GE3A 5TT0A 3AP1A 2FMUA 1J5XA 2ZUVA 1WXVA 2JG3A 2ZEJA 1XZEA 3B60A 1SJED 1ATZA 1GPH1 5FBHA 4HH3C 4KH0A 5EWJA 1ADBA 1PT5A 2Y1GA 4FA6A 3SDBA 3TGPA 1WZ0A 1SUPA 2HLDD 3JQPA 4RA9A 2DFPA 2QN1A 4S1TA 5L9AA 5LQNA 5JAOA 2K8BA 2JFPA 4MULA 5DPXA 2FPOA 3NWOA 4BOSC 2RAFA 1G41A 3JW0X 1N3YA 1HE1C 3GGOA 1V6AA 2B21A 4Z54A 1AK1A 2H2IA 5AHRA 4FD2A 4XJTA 5LBIA 4RX1A 4AI6A 3GOEA 2PAAA 2F2TA 2Y3AA 1KNQA 1L7XA 4ER7A 1GUAA 3GDOA 5KTMA 4OAPA 4OM7A 4K1LA 5TEWA 2OSBA 1X39A 3L7YA 2PN1A 2WT4A 4IY1A 2AQ3B 1HFWA 2YWGA 4AN4A 2XY4A 5AHKA 3SEAA 2E6XA 1QTQA 2NNLD 2SAKA 2CJOA 1X38A 2DYKA 3GGDA 3O3MB 5BWMA 1V1RA 1AKTA 2VTBA 1NQVA 2NQ2C 1JR6A 1Z7BA 1LSOA 4XOIA 2FUEA 4X8HA 1CYDA 1IEWA 1QG0A 3PXAA 4NS4A 1JALA 2A7MA 4H2DA 4HDAA 3S2UA 3AW8A 1E8WA 4NHOA 4GHWA 3VUFA 3IT1A 3U61B 4TZ9A 1LVHA 3S4YA 4OI2A 4GLJA 4D0GA 3L17A 2CEAA 5HKKA 1X8LA 1T1GA 5CX1A 5FJJA 3V9PA 4BFRA 3RPFC 4U0KA 4TZ6A 2CNKA 3WLPA 3SQLA 5H81A 1WZ3A 2OQRA 3KQQA 4EHKA 2BGMA 2R0QC 1TBEA 3UFXA 1H5QA 2HCRA 1Z83A 3AVVA 4QHTA 4QFDA 1VBNA 1B8UA 1YR7A 5D3ZA 3W5VB 3GNQA 5J1SB 2OOBB 1OOEA 3MFGA 4FFOA 2LHDA 4K8OA 1QMPA 1RAAA 1G6HA 4J16C 1IB0A 1NUHA 1FX0A 4F6HA 3AUFA 3PNLA 5DW0A 3N2KB 1BH6A 3R77A 1SWVA 2XKJE 5KWEA 1NP7A 4ACFA 1FYXA 4MVJG 3C8HA 2Z95A 2M56B 2ZRBA 3OLXA 5HMMA 4GLFA 2CHXA 3U4QB 4UQOA 1MG4A 4LDRA 2M32A 4GOCA 4GOKA 4WVFA 3RTDA 4C2UA 3LXUX 4G2NA 1E79D 5KOYA 3V61A 4WK6A 2YJ6A 1NMQA 1SUCA 1KI1A 1ZUNB 3VNVA 1W2HA 4W6QA 2DH6A 3BD7A 4BKSA 2HDWA 4R83A 1UBEA 2C88A 2BC9A 1K5HA 3ND8A 5KKNB 3S1SA 5KCMA 1CUYA 5AJUA 4R6XA 2YZ7A 1R9GA 3ZI4A 2ZJ4A 1PQSA 1IYFA 4L15A 1JWMD 3TLYA 7REQB 5FWXB 4MRNA 3ZHRA 2Z2XA 3ANXA 4UD2A 1NVAA 1UZUA 2Z6AA 2QMTA 2N9UA 2IW3A 2HQRA 3CF2A 3G1WA 1GXSB 5JNRA 2BELA 1OBVA 1U6JA 2LD9A 3VAAA 3Q2IA 4ISBA 4WESB 3KYCD 3ETDA 1YDMA 3Q6NA 1YQ3B 4WECA 3APFA 4P3XA 1IN7A 4Q05A 5M2QA 1UH6A 4Y8VA 2O7SA 2JIRA 4MQEB 2WU4A 1U8CB 3I2IA 3HCDA 3I63C 4GXQA 5IDYA 2X14A 1HDZA 4A3OA 2RJOA 2X8BA 1UR5A 4J0CA 3C0RB 2INGX 4KR9A 2QTLA 2FU9A 1P2FA 2NO4A 3GPBA 4LXQA 1Q0QA 2O8EA 4CGYA 2PU7A 1HRKA 5AI5A 3RIYA 4CDRA 4PN7A 2ZI4A 1EZ1A 5M3BA 4D4IA 2YZNA 3VTKA 1NI5A 1PG0A 4MV3A 2GR9A 2WVHA 4UHHA 1ZVKA 1ACCA 4JENA 5DBIA 4OGLA 4L6CA 1J33A 3D8HA 3K2EA 5IVIA 1DXQA 2DHDA 4A5SA 4CODB 2BBCA 2JLYA 3MYRA 5AHOA 1JHUA 1WY8A 3O8CA 4E1BA 2V6BA 1IGDA 5TQ2B 2PLRA 2E82A 4IRXA 2A5JA 2OR3A 5EKSA 1RZRA 4ITUA 5FQOA 1MU0A 3R0ZA 3Q2KA 2NTNA 3APCA 5ECYA 3ESAA 1MR3F 4Y2SA 3C8UA 5EN4A 3EIFA 4E2YA 1JHZA 1P18A 4XIGS 4OVZA 3RSOA 1FK8A 2QY6A 2QYOA 1TGZB 1G0OA 1SXIA 4KL8S 3EPJA 3SKYA 4KN6A 3JVUA 5CX4A 4UA4A 2JASA 4PGGA 2ODBA 3L1JA 4OFXA 4OJMX 2RD0A 1V1OA 1T8PA 3K9LA 4HN4B 3W5BA 3KTOA 1OQRA 1IIBA 1KL7A 4C0BA 4FCWA 2GASA 4CKYA 4RVFA 4MJSB 2PEZA 1JSLA 5JZVA 3ZD9A 1GV0A 2CHVA 1ZJYA 1UOQA 2Q3FA 2GEDA 1TAGA 1OGIA 5K1ZA 2JGMA 1VI6A 2OHFA 4BNDB 5AJTA 1IXYA 4GX0A 2I1WA 5F23A 1ZK3A 4HPMB 3CF4A 4WY5A 3PLUA 1HOTA 1MABA 3I0NA 1XVUA 1QSGA 2QTWB 4DA6A 1DV1A 1EFTA 2ZJYA 2KFJA 221PA 4G25A 1EGQA 4XD7D 3P2BA 1YIOA 2HPVA 5JDCC 1NVGA 3OMLA 3DAPA 1B6RA 2L18A 1O7JA 4O2RA 1NG1A 3TL5A 1ORTA 3OKCA 5HF6A 4C89A 5I45A 4GRDA 1M54A 3LCVB 2IS2A 1RQ2A 2CKHB 3UKDA 1OLSB 1UBKS 4KQEA 4PYZA 3FKSA 2IUYA 2JZOA 3VH2A 4RJ2A 4QUIA 1NKTA 2GUGA 4TKLA 3OKFA 4EMSA 4DDID 4EGAA 3ABRB 3QG1A 4ETWA 2XMCA 2AS0A 1P9NA 4K88A 1HLGA 3GJTA 1KDYA 4BQOA 3C39A 2O5VA 2XF8A 1PFWA 3PR3A 3FOBA 5BV2P 4BNNA 5IOIA 1B43A 1JIVA 4KC0A 3LXRA 3DMNA 5J1TB 5I7VA 1WPQA 2WB2A 3JXPA 4QDZA 1QRUA 2LRHA 1KEKA 4PC1A 2FXVA 1KBQA 3BWXA 4ENQA 4N40A 2Q07A 2WQZA 1Q17A 1GSHA 5K4GA 3AMVA 3L7LA 1DTWB 1XP5A 2X42A 3B0AA 3SS8A 4YLGA 4D1VA 4FEEA 4MUNA 1QOBA 4KZKA 1P0PA 2B1GA 1MNQA 5K7SA 3KDAA 4LN1A 1F1BA 1M6WA 1UPCA 3O2NA 5FL3A 4BFSA 1EM7A 2F43B 2Q5IA 3VI4B 2QI9F 3AR3A 2VRBA 3GVXA 2VPPA 3FMPB 3RAGA 1HNZB 2VJCA 1WPGA 1ZGGA 4BDTA 3I23A 1PSWA 4W9RA 5BN1A 2R8PA 2RGDA 4LDQA 2NM0A 4MJ3A 2MX2A 2VQSA 3NKLA 4PYMA 4YXWD 1GU1A 4PZLA 3TZCA 1N4DA 1RBQA 3X1JA 4FGKA 1WMAA 4Z6KA 5EZYB 1CJKC 4OHXA 2N9LA 3KJIA 1FNVA 1JGTA 5K3BA 3DBHA 3HSSA 3F9IA 1EXDA 1G8AA 4FNMA 1PF7E 3RQSA 3Q85A 4WK4B 4BBAA 4WAAA 3O1IC 5DLQC 1FS6A 3RM3A 4RZXA 3W6OA 3AE7B 5G4KA 2R7LA 1WGRA 1WMSA 2CCKA 3QXXA 1F2RC 1IPFA 4ZMBA 1JN0A 4LMBA 2F1JA 2CSXA 1BRTA 1YB6A 3W5SA 1OAOA 4JEUA 5JLAA 3HU1A 4FM9A 3T4EA 1GRCA 1LVGA 3A9SA 1RXUA 3A6GA 2JIBA 4C4AA 1JLHA 1KJNA 3AEQA 4HDOA 1YDGA 2AQ8A 3KX2A 1M6VA 4ZEWA 1QH1B 4K0RA 3T6KA 5HM8A 2IHNA 2XZPA 1P7WA 3EUWA 4F96A 4L3WA 4BPRA 4BO1A 1GZ4A 1WCV1 2V0CA 1O6FA 2ZS7A 2PR2A 2ZJ8A 1GR0A 1F7VA 4TSSA 2DC1A 1E3WA 3CE6A 1ZN8A 1D0IA 4RD2A 3H4TA 4TQ9A 1NU8A 1LQ2A 4BBZA 2GCIA 1E2QA 2WYMC 5T4EA 3OIUA 1RIIA 4X66B 3DOWA 2BW0A 1FFAA 1XXLA 1OWPA 4RS3A 4PLVA 3WB2A 4UEKA 4H7DA 1Q3HA 5HUQA 1OCEA 2BS4B 4JKOA 4RW0A 5KHOA 2ATEA 5TNXA 3SW3A 3TQFA 3VRBB 4DV2B 1X0XA 4QPCA 1DJLA 4Q3BA 3SQMA 3K9WA 4NQ2A 3ON5A 2Q5OA 3LOUA 4BOYA 4RNCA 1U2QA 5IT5A 2WXLA 5K5EA 3T8YA 4NOKA 2NV2B 4KIUA 4ZRJA 1DAFA 2J67A 1P39A 2P0AA 3KR2A 4MM3A 2J33A 2R2DA 2PA0A 4R8SA 3WRYA 1WZCA 4DYDA 5CK5A 2ENUA 3CX8A 1EIZA 5KWSA 5AOBA 1NW3A 2DLBA 4XGQA 3TOZA 4A8PA 2H8KA 3UK2A 1J0DA 2NUBA 4LUCA 1SXTA 2OFWA 1BH2A 3AB3A 1TQ4A 5ECWA 4WKBA 1NXSA 4NH4A 3LC2O 1WZUA 3HL4A 3II6X 2BFBA 2X41A 3WYAA 4ZDJA 2A88A 2B4YA 4PO9A 4CIAA 1XTRA 1XMOB 4YSLA 3A6KA 4CTKA 1G6Q1 1QONA 3NXKA 3CNLA 2PUFA 1AS3A 2HF8A 4X6YA 4DMCA 4TSKA 3X1ZA 1X9GA 2EEPA 1IJFA 2IT1A 4YRCA 2NXNA 721PA 1N9GB 3TSCA 1E6EA 2R00C 3GEBA 2RPVA 2BGAA 4F06A 2YQ4A 5DTMA 2YBDA 3ZWCA 3HU2A 1KFCB 2QIEB 1P1BA 4HGNA 3L41A 1EXMA 1O77A 2WSIA 5HGJA 3UWPA 3RT9A 3U7HB 3CSDA 5F2EA 4O1HA 3IP1A 4W7HA 3GUCA 3IT0A 3H3XA 1FFVA 1TUGA 5DJ5A 4GMXA 4PHTA 3T0FA 2VUSA 2JAXA 6YASA 2XK5B 1CR0A 4RETA 3ETGA 4O98A 1S2NA 5HKLA 1SEVA 1IUOA 3SXUA 4QGFA 1DG9A 4EEWA 4NJMA 3TPZA 5T8IA 3UB4A 3UICA 4WAUA 2BM8A 4Q5IA 2VHVA 3T99A 2ARKA 2WABA 2W3RA 2REXA 2OESA 4OXQA 5JE8A 1E3MA 5C53B 1KYXA 3HGQA 5FTMA 5DWVA 5FL7A 4GMFA 1GZUA 1WW1A 1YHNA 4L50A 2HQSA 3H75A 4ZT2A 1EDOA 3QVVA 3KFVA 4BO5A 4AICA 3HKBA 4PDXA 4NPAA 4RM9A 1EHYA 1D9XA 2EX4A 4QDJA 3N9YC 5ITWA 2FW1A 2WF6A 4L23A 2WDTB 4PSCA 5ILOA 3JYNA 2QTTA 2OFFA 3A4TA 3UM9A 1U5AA 4HDMB 4IC7B 2VWQA 2A3NA 1XDBA 3L7AA 4ZU1X 1VGVA 1GB1A 5AW6A 1GCUA 3RVNA 2I67A 1B2LA 3SSNA 3O4GA 2AOTA 4HWGA 1VSTA 4MWGA 4WJZA 5AKIA 5BN4B 3LPAA 2H57A 4HI0E 3K0FA 3IMFA 4UU7A 4GXBA 5BR7A 1E2BA 4F3CA 5DLDA 1SG9A 1UFOA 3GW8A 4GR4A 4MUFA 3GN2A 2XKBA 1U2DC 3OHMA 4OO3A 1W44A 1USGA 3L0WB 2BGNA 4RSGA 1CRWG 3THXB 3WRXA 1PQPA 4I9GA 4N5DA 2V96A 2HIMA 2C9WB 4G4GA 4QNRA 4GQIA 4OOFA 3IE2A 3F7OA 5TMDA 5E95A 1CEYA 5BSVA 2HK8A 3GA0A 3T9BA 5JSZA 3U8ZA 3PC6A 4GZMA 3O4RA 3L8MA 1U2ZA 3EX7C 4QVIA 1VJRA 3MVEA 2X8WA 1IOWA 4IDAA 4UMFA 3W77A 3RBAA 2ZIFA 3HNPA 3DWGA 3TQOA 2X5XA 1DCMA 3H9CA 4JVMA 4CQLB 1BEUB 1KVRA 3W79A 1NZFA 5BSTA 5E8RA 3QYPA 2IX9A 2IOFK 3LZDA 5HSGA 2ZB2A 1SB9A 5IC4A 4FINA 4IVQA 4K3UA 1B0PA 2FDXA 3F8WA 4MITA 4V3CA 2BBWA 1FDWA 4HNTA 4EHDA 3FYHA 1ZCBA 5CPFA 1BRMA 3WE7A 3EXEB 1SVLA 2BFEB 5IANA 2FZCA 2WXOA 2VBFA 1OASA 1JYFA 4MS3A 1GPKA 2KNBA 3CUWA 5A5FA 4CR8A 4IJ5A 4DGSA 4EEKA 4RH6A 3GCWA 3S68A 4QM6A 4JC4A 4A23A 2Z8ZA 3EVEA 2MBOA 4RL4A 2C5FA 4V0ME 3BIFA 4BV3A 3RNFC 4GC5A 1FTWA 4ASWC 5JTTA 5ALMA 2B4QA 2RDMA 3H5TA 3M62B 3DDNA 5EINA 5LZ5A 3V32A 3HY4A 3ZE1B 4ZARA 2WZDA 1CT9A 1QE5A 3ENKA 3A9KB 1AB6A 3IXLA 5IVPA 1Z7EA 3M6AA 4F2DA 4TLAA 3W8EA 3TKAA 3VRAB 5TPWB 3D0RA 3IE1A 3ENZA 2HCFA 2PNJA 3A1QB 1PV1A 1GQYA 1U99A 2GHQA 2OSVA 2HXSA 2YV2A 3F71A 4AX1B 4LRWA 5AO9A 2D1FA 3GHHA 4YRAA 2AUTA 2X6RA 4CV1A 5DT2A 4CHTA 2FPKA 1BKYA 2XNHA 2HTME 1CK1A 5KYKA 1WZEA 1Z74A 2RGWA 2RK6A 5CR9A 4LXHA 5DN9A 2WM9B 4WL0A 4DEYA 4NOMA 5DHRA 3SYNA 5HEKA 3PRPB 3CB2A 1HM5A 4CM4A 1VHWA 2A0WA 2HN9A 3TEMA 3H99A 5B6IA 1K9VF 3AK4A 4TLCA 4E94A 2PZ8A 1BXGA 2KTRB 4FSHA 5JPIA 3LX5A 2C5AA 1NP6A 2WU0A 2AI1A 3T1TA 2V1UA 3VVCA 2J3MA 1E92A 3O82A 2P9CA 5AW2A 4MKRA 1SCIA 2Y92A 4RK1A 4GSKA 3J7AC 1UDWA 2VATA 4D6PA 3IBFA 4EI8A 5KTKA 4GDKB 1KY2A 4EB0A 3PUIA 3O47A 2IQ5A 2FHSA 4S0ZA 2HSZA 2V6MA 2WV7A 4L5YA 4V0KA 4B2YA 1XQXA 4EF6A 4EG1A 4AIRA 3ZIDA 2WHPA 5IF3A 1QPZA 3KPUA 3BJIC 4PRLA 3FOWA 4ZQEA 1BMLC 4EMTA 3NVYA 3G2QA 3N20C 2HTFA 3FLAA 4WMLA 2AL7A 2KWVB 4P1CC 4RBNA 1P1CA 1T6BX 4GAEA 4F8YA 2HRZA 4M83A 3H86A 2FW6A 5IUNC 1U4AA 2ZG6A 4FULA 1DRWA 5J4KA 2UUBB 1UMDB 4LDTB 1LPBB 4MTCA 4AJOA 4MGKE 3TRJA 4GLSC 3C43A 1STEA 3M4XA 2GAAA 2ZR0A 2HCBA 1CUHA 2OHHA 2O8CB 2WOOA 3DE6X 1DC6A 4LYDA 1VKNA 2ZRDA 4LHXA 2FAXA 1TIFA 4BNFA 2QM3A 1U4OA 3C6ZA 3GAAA 4TMKA 3L7BA 4LHYA 1ECCA 2PMFA 3K4HA 4YMVA 1UK9A 2G4DB 4YAOA 1XELA 3S2YA 1EWYA 1K8ZB 2B4KA 3CEHA 1CX9B 2F59A 1U9CA 4O1IA 1GTG1 5EMJA 4WD6A 4P83A 1SCDA 4IDGA 1A5AB 1SC3A 2Z5VA 1MB4A 1VLVA 3D54D 4RZUA 1U2GA 1CULC 5BV7A 3W1EA 3CUYA 1Y33E 3N6RA 3MT8A 4CLDA 2LPMA 3PHCA 3VX3A 3I32A 4KI0A 4ZU3A 4IZ6A 3FPSA 3GAFA 3U17A 2OG1A 3WMGA 1U2EA 1KJWA 2L7RA 5DE3A 3PUJA 2JKVA 4XVRA 5CD9A 2I2CA 2ZIWB 2J7KA 4OHVA 5FKJA 1OHHA 3GEHA 1JYSA 3U3RA 4EOYA 4AUKA 1V71A 2NUPB 4JLWA 4BTVA 4QDOA 1VIYA 3KB8A 1KK3A 4M89A 2NYRA 1YKFA 2NUTB 3O3CA 1VKOA 2PMWB 2NG1A 5KOJA 2GNPA 5EWMA 1MQ9A 1TUBA 3MWJA 4V24A 2UDPA 3ONFA 1B3BA 2Y1EA 4GZ5A 2OUKA 4UHJA 4YP1A 2C3MA 1QK3A 4G0QA 1W9HA 1OLXB 3NUZA 3PDIA 2X0JA 4X1KA 521PA 4B17A 1HLPA 5LS3A 5ELLA 3UJBA 4LNHA 2C4TA 4P16A 1M94A 1X80A 5C8ZA 4HYYA 3I57A 3HCBA 3PICA 4PQGA 4ENWA 5C31A 1ZGUB 5C4GB 3G9XA 3ZHQA 4KLRA 1UKAA 2ZXEA 2WSSA 1YOVB 4YB8A 4S1NA 2WE7A 3WNQA 1NW7A 2FHXA 3MJ5A 1R6AA 3UWMA 4WXPA 5HCIA 3VPAA 3GZJA 3ED5A 3VU3A 2Y87A 4NCIA 4HAIA 4TMXA 5FFNA 1G5RA 5H9VA 1BC2A 3LQFA 4IR7A 2XUDA 4EW6A 4NMWA 5CFPA 1OZHA 4JLDA 3HBLA 3RB8A 4RA6A 3BSWA 1CY6A 5EJ5A 3ZE0B 4GX5A 4DUZB 1B3RA 4R8VA 4I5EA 1E2FA 1JIQA 3ICVA 1K3TA 3JQQA 3RYFA 4BFLA 4OL9A 4XYEA 4HF7A 3K70C 4NCBA 2JZ3B 1C3EA 3OFJA 2YN4A 3MWEB 4D25A 3KT8A 5AWFC 1U7HA 4N7RA 2XQKA 2ORVA 4GBJA 3EW9A 3RVJA 4IUCS 4C87A 1GZ3A 3HABA 4R6WA 2IJ0A 4NR0A 4RFLA 1D8AA 2W58A 5GY7A 4IILA 2HTEA 2A1TR 3FG9A 1HT3A 3IAM6 1LLFA 3CVXA 1XA4A 2Q41A 3LKBA 4DY6A 2FNAA 4NCKA 2GXAA 4WZ6A 2O1EA 4CMHA 5AICA 2GS9A 1YJ8A 2O07A 3RJ5A 1Q0RA 4WBSA 5I51A 4ZHOA 2WXQA 3E61A 2QDKA 4KJZA 1CE8A 3I42A 2OXCA 2YWJA 2H16A 3WBKA 3LYLA 1VRCA 3NTVA 3QE2A 1EE1A 1QRAA 5ALKA 4E51A 1KVSA 1T3GA 1WJUA 1E9DA 5G4KB 4U7DA 3WNBA 2BZ1A 2C3UA 5DYTA 5HS4A 3ONVA 4LSMA 1UPFA 3U16A 5FULA 2WXIA 5T8KA 2EJUA 4IO0A 2V97A 2AD5A 1Y5RA 4U9HS 4H1WA 4B0OA 1B8NA 3OTOB 4KQFA 3ZWMA 3RNLA 2RJNA 1YQUA 4LYAA 2A30A 5CITA 3FR8A 5BYKA 3QJGA 2Y3IA 2R2QA 2ZJ2A 4IDNA 1U0FA 4WJPA 4BIIA 4IXTA 3IRUA 3ADKA 3FHCB 4TPKA 4K7JA 3C19A 1ZO8A 5EY5B 4B8WA 3TEZA 4FADA 3HYNA 5JDIC 2Z5GA 1IOLA 2VKTA 5T4BA 1RJ9A 5KPDA 2DULA 2OG2A 1EH5A 5SZHB 5CUQA 5C23A 3WGUA 1FDIA 3A4RA 3MGKA 3EG9A 3O3NB 3GI1A 1NLFA 3IIJA 3ZHBA 1TYGB 3IQHX 1T8SA 2XWBF 1T2CA 1V8PA 3ZGZA 2FZEA 2EDAA 2ZWPA 4XDYA 3OCUA 3JYUA 3BORA 2IWRA 3GJSA 5AK6A 5DULA 8OHMA 5EGNA 3RGGA 2GD1O 1WMDA 1Q21A 1AGXA 1MZVA 2YNMA 3LVBA 3O4JA 4K5QA 1V6SA 1POWA 2RBKA 1E98A 1KC3A 4JI3B 3NBQA 2O8DB 3H6KA 5DMXA 3MUEA 3OZWA 3ZYCA 1YMUA 4MUAA 1IAVA 1NJ6A 1D4OA 3CYFA 1DBQA 4MVJA 1DNPA 1OKKA 4OLHA 2YWEA 4IQ4A 4HKQA 1RWSA 5JJIA 3U7DA 3N8IA 5TR9A 1K2WA 3BINA 4ZT3A 2TMKA 4EA7A 3P9ZA 3CRW1 4DSNA 4K9KA 1XZLA 3NFYA 2WUEA 3R7WB 3GD5A 4HQRA 2V7XA 1OX6A 2V7UA 1N77A 5EXEA 3MRSA 1QZUA 1VPLA 4M1TA 3NJRA 2FNJB 3ZI7A 1UUPA 1KMNA 2GKSA 4Q4CA 4FJYA 1DQYA 3KQOA 3D6FA 3LKDA 3WB0A 1PHPA 3FWPA 1JXQA 4CLOB 1V1MB 4MR8A 1V47A 1U7UA 2P6NA 4LFAB 2YZMA 1T43A 4D4MA 1WDTA 1KIFA 1T1RA 1EAMA 3Q7RA 4TZKA 1JB9A 2ATIA 2KHZA 5ALGA 4BTEA 1RRGA 3L4SO 1YL7A 1E8DA 1Z5SB 3BYTB 2GBLA 4PLWA 3L92A 4G01B 5EJ6A 1Z4PX 2M1ZA 2WMDA 1QTRA 3PCTA 4QUDA 4LHSA 3GLSA 3TD9A 4L1BA 1Z73A 2Y99A 4DIFA 1PR6A 4BUJA 2XRYA 4WK0B 3DHHC 1VI5A 2IDMA 2V4MA 1JRLA 5FO0A 1JVNA 1HWYA 4EZLA 3ORFA 3KTDA 3RIEA 1SXJC 3RKRA 3KJEA 5KYYB 2HJ8A 3E1SA 6ADHA 1YD7A 1BHO1 3SC2B 4QUHA 4Z1MA 3PQ6A 3H1UA 3WMXA 4RGYA 4CYMA 5IM4A 3JQBC 1CY7A 1VCOA 4AQ7A 1I3NA 1WRDB 3U81A 3G9QA 3BGVA 4UWPB 3AONB 1KE2A 3UY4A 1GM5A 4K2AA 1IIRA 3UG7A 1FIQA 3GEMA 2B9EA 5TDHA 1UBRS 2FX3A 4TWRA 1EFPB 2HHHB 1FRFS 2J0UB 1ESMA 1W96A 1QGUA 4RGTA 4FBLA 4Z4CA 2RMKA 5IT4A 4Z7QB 4J94A 4ZPJA 2KSQA 2UZIR 3WOVA 3DZHA 4U7HA 2XBBC 1WKCA 5CHWA 1XIVA 3RRJA 4RH0A 5AMXA 1KTKA 1DAPA 4C2BA 3QITA 5B64A 3EFBA 1NVXQ 3WSWA 3HZHA 1F17A 1NW4A 1U0NA 2NU6B 3H18A 1P5ZB 4KPUB 4MR7A 4D99A 2KJQA 4LRUA 3RTEA 3VDZA 2XOKD 3DBLA 4KSCA 4AX8A 2WLBA 3BWUD 1YJJA 5HFAA 5FTKA 3CA8A 4C5BA 2UYQA 4Q1DA 3ZE2B 3IAUA 4KGVA 3ZCPA 4PSVA 4OGGA 5E6NA 1NNEA 1GPXA 2O8FA 1U98A 4H3VA 1XTOA 3HHMA 5TF0A 3OF2A 3BWYA 1XU4A 1T36A 3KXDA 3HJAA 4H0NA 2VPIA 3R7DA 4CIDA 4FNOA 3NBKA 4YAGA 4OOEA 4JLUA 1PJ4A 1XROA 2FCNA 1BMCA 1DRJA 1Q3KA 3WLTA 5KIKA 4S35A 1DT3A 2Q99A 1R5OA 3AG6A 2AN9A 3Q1LA 3RAFC 1GZVA 2GX6A 3T4PA 4OJTA 2VPZA 2KX0A 3QX7A 4H7KA 4DREA 4D2IA 4XX0B 3L01A 5H4GA 1Z26A 3ZJUA 1ZRNA 3BFJA 5JQGA 2AEJA 3R9KA 4IGAA 2HIGA 2IZZA 3DM5A 1YTUA 3PR2B 2G9ZA 5BW8A 1I9CA 1VJDA 2GERA 3DEIA 2X1VA 3VUXA 3L13A 3UHPA 1KQOA 1UELA 2CFRA 4OX9B 4DDWA 2J9XB 1SA0A 5BYJA 1EK6A 3UV7A 2JT4B 4BMZA 5JQWA 3H7AA 1FCCC 1IN1A 1N2ZA 4KSBA 1BVYF 1FL9A 5A2QA 4IG7B 3BAZA 5ALHA 2GEFA 3QBVA 4UJ3A 5FI5A 1C9EA 4U00A 3TSAA 1I2AA 3JAWB 1NF3A 4JDPA 3G1TA 3I28A 4PO8A 2OCDA 4GU2A 2QXYA 3HVUA 4BN4A 2QG9A 3Q0EA 4CNQA 3ZE9A 4PN3A 1KSJA 1IYZA 1ZINA 4CRWB 4NQ5A 3HLKA 5AVSA 1PVOA 2SECE 4RE6A 8MHTA 2VDVE 2WLSA 5AVJA 1DSSG 4FBMA 1Z6XA 5C8YF 3B3AA 2FUG6 4N8EA 2DPMA 2ZZPB 1GU0A 1XLPA 1MAUA 1MHTA 4KGDA 3M70A 2QZSA 4P4LA 3N74A 1FXWF 2HU8A 3AB8A 4NZYA 1HG1A 3D2CA 4A1OA 1SZJG 3KIPA 5EMNA 2JAWA 1BWRA 1TTPB 2UVPA 4TWBA 5F3WB 1JAXA 3L1VA 2PGAA 2PH7A 2WHXA 2PSSA 2X22A 4YROA 3DKVA 3IKMB 3R7QA 4I2VA 3B2FA 1P5RA 4JLNA 5LP1A 2XAAA 4OHKA 1A9YA 3MMXA 4OTZA 3KSUA 3TLXA 4D5EA 2GA9A 2G1JA 4JIOU 1W4AA 3AI5A 3I39X 4JI2B 4BO7A 3OCZA 4N0EA 3PWZA 3U3OA 2NTYC 4JC8A 4TVKA 1F1HA 4YV7A 1O95A 2ZSHA 5G1NA 2W6OA 4B3RB 5JBIA 3EEBA 2OORA 2AN4A 3F3MA 3CUKA 1OJLA 5FIUA 3OM0A 1H2YA 4EL0A 3ND6A 1R4NI 4PHHA 1FIUA 2WXGA 4OGKA 1QWOA 3FOCA 3MTDA 2ZSAA 4JL5A 2JBAA 1P1IA 1KBZA 1CUDA 1VL1A 1J23A 1E10A 2CXTA 3L1IA 1Y9DA 3MMNA 1E64A 3IQXA 3MM4A 2ZNBA 2C61A 1EBUA 4KPYA 2X0FA 4UMDA 2PL5A 4YQFA 5FHQA 1HNNA 1RXWA 1T0HB 2VUHB 4LNOA 2EVWX 3H7SA 3GNLA 1NY5A 3U9LA 4WZBB 1HZZA 4ZCSA 1X1SA 4B6WA 4Y1RA 1DINA 3W1YA 1JILA 2ZE8A 4PX9A 4RLFA 4WWMA 2GBPA 5DNAA 3ADCA 1KNXA 1P1KA 3BDIA 4K9MA 1DT5A 4RMGA 5KSPA 5TRTA 4L73A 4DJTA 1PNTA 1L7DA 5CT9A 4Q4HB 1ZGJA 3V46A 1BAPA 5JBNA 1AKWA 1F48A 5DCYA 4YA6A 2QSZA 4LBWA 5I7AA 1LV7A 4NFLA 3C8ZA 3CJTA 5HM6A 4K6MA 3LUDA 3G49A 1P4RA 3CJQA 2GM9A 2C7NB 3ZLTA 2X15A 3BGWA 1L4LA 1OX5A 1GPJA 3AR8A 2NVUA 2FMXA 1R3DA 1E9FA 1YI8A 3PBKA 3A9UA 2ZATA 3QLVC 3A3PA 2C2MA 2CJWA 1KZ1A 2J9GA 4CWAA 2GZHA 3R0JA 1ELOA 4B3JA 4KRGA 4HGYA 3A4MA 3NS1A 1KKUA 3K9FC 1L2NA 1DJQA 3MCAA 2KBEA 5AVWA 3NVMB 2AQKA 2WWZA 3V8MA 2O6VA 4L4ZA 4CMGA 3QMPA 2DUMA 4Q1VA 1RHKA 3AM3A 5DEOA 2RHCA 2NTTA 3OIDA 3D2LA 4X92A 1NN1A 3G8BA 3IAS6 3DULA 1P2TA 3RQIA 5C1IA 2WU5B 2VJPA 4X8MA 2XWPA 3UTDA 2JQRB 2BSAA 4IIJF 2BHSA 1C1DB 4Z8XA 4B47A 4EOGA 1EK5A 4HWSA 4U7TB 4Z0PA 2HLNA 1I24A 2G76A 5FTLA 2FR8A 1LQTA 3FM9A 3IAHA 5IW8A 2EP5A 1KZ7B 2EELA 4I6GA 2WMOB 1VMKA 4B71A 4WJKB 3MEQA 4GUAA 1APBA 2HZ7A 3NNDA 1EF5A 1F7UA 2KLGA 1FP4B 1AHNA 3I1IA 3RR2A 3GLFB 3CSTA 4WCDA 4ANXA 1SGHA 1RAXA 3RYTC 1W4CA 3NWEA 4W1QA 1EG2A 2F8TA 5K8UA 5D86A 2MJ3A 3MS7A 5EZ5A 3N86A 2G4CA 2OKCA 2ZW1A 1H2FA 1MTZA 1Q5WB 2R1UA 2JK1A 4TQAA 4V2UA 1HLDA 1Y5MA 3RC7A 3KQUA 3RKJA 4RAMA 1A04A 3NRZA 1N7GA 2YRFA 4H08A 5EXPA 1IK6A 5D5HA 2G9QA 2J30A 4KV9A 2XCQA 3FYCA 2RB4A 3HUTA 5JSQA 2P3SA 3ZE6A 1ZA1A 3AI7A 1THMA 2WFLB 1SUWA 3H5VA 4E7OA 2YIJA 5CVVA 821PA 1YMQA 2WKSA 1U8ZA 3QUAA 3KOYA 2X19A 3PHIA 3U7RA 4AX4A 3OJFA 3MXOA 1JKJA 2DLNA 4AO6A 4P1BC 3ZV7A 2ZZKA 4E11A 5BRNA 3M5WA 1C30A 1D4ZA 1R0XA 3AF6A 3CUEF 4KG7A 1EDDA 5ETJA 2OYCA 2A2ZA 2Z6VA 2AQIA 2YFKA 1THTA 2QMEA 2P5SA 4HNHA 1XLOA 3DVSX 4CLHA 1D0SA 1NKVA 1YIDA 4HSEA 5DNDA 4B3CA 2DBYA 4NLLA 3BWBA 5JJCA 3UV3A 1V48A 3E9ZA 2A14A 3CKLA 2GBNA 1HL3A 3CEAA 1P1FA 1I6WA 4V1CI 5IDXA 3SZLA 2YVKA 3GUUA 4ZAYA 3PEVA 3RYIB 1M34E 4RA6B 2WRSA 4BXOA 1RM3A 1NNLA 2IUTA 3UATA 3URMA 1YA4A 2PSDA 3UXEA 3QSGA 1WB6A 2B5OA 1JW9D 1P9RA 2CNWD 4N0PA 3GG2A 3ZIAD 2QP4A 3B53X 1A4RA 4GGMX 2QYTA 2CLFB 1OWOA 1AKRA 2ZCCA 4US8A 5JZSA 1J0EA 4E4RA 3NTRA 2Y8EA 3WAPA 4FN5A 2IO1B 4MP6A 1PLJA 3QI2A 4CKWB 1BMFA 4I50A 4TKUB 2UU9B 3VO1A 4LJKA 2QLNA 2M2IA 2C84A 3KCQA 1RABA 1E7SA 1I0IA 1Y6ZA 5LP6A 3JQEA 4EJMA 1JR3D 3SS7X 5KEIA 3VQIA 1TPZA 3WWDA 3LYYA 1EIWA 1MA3A 4F97A 5DCWA 4B6QA 3FWYA 4KCGA 2P4EA 1DADA 3KD2A 3SD7A 4V39A 2AA3A 4E07A 5J5VA 1SCBA 1XUOA 3PJFA 4PYLA 1FLVA 1F2UB 2CHUA 4F4HA 3W5DA 2RHBA 1X8HA 4FXOA 2IHJA 2JW5A 2C5BA 6NULA 2G7ZA 4EGQA 3R3YA 4CCSA 1L5RA 1BIFA 3PHLA 5B3JC 5K8TA 2AJBA 4RKEA 3KUCB 2B0JA 1RPTA 1Q92A 1Z08A 1T2EA 2EGHA 2IOYA 1EUZA 3D5TA 5JFTA 3QW4B 2QP3A 3L07A 5C8YB 4D80A 2Z57A 3P27A 2JFBA 3B1JA 2QROA 4GBGA 3SHTA 5FH9A 3VSEA 4B48A 2L0TA 2YVQA 2ZJ5A 5TIIA 5G2NA 4K3VA 3WLOA 2K6QA 2LXNA 3ETCA 3AEKB 1C41A 4BE7B 3RD2A 3FSJX 1QGED 4G24A 4NZLB 1NMYA 4AN0A 2HYDA 3S29A 3Q8XB 1G66A 2G77B 4XW2A 1NDDA 3VNBA 2A9RA 2JHGA 3WNCA 2UYGA 2G17A 5ESRA 5E7IA 3JPYA 2IH2A 1QZZA 1N9KA 1SU4A 5JWHA 5C1BA 3MWKA 5EESA 3EXIB 3GXBA 1VLHA 2W48A 2QX6A 4O3FA 2FZKA 3ZWQA 2O2JA 4KFTA 3AI1A 2VF8A 3HC7A 1FNMA 2Y66A 1E7MA 2G28A 3RHFA 1D7OA 4RS4A 2X7XA 5IO9A 4GI3A 4JQYA 2GMWA 2O0HA 4LDPA 3FWKA 4B3BA 4IDEA 1M5TA 1QOZA 2E4UA 3RNBC 1JJVA 2ONYA 4MUKA 4C0QC 3PNQA 3DEJA 1P77A 1X77A 4KDEA 2FWPA 4QBHA 1P9LA 4DEXA 4I46A 5FUXA 4I5IA 4MEAA 1WR6E 2JGNA 2C2KA 3KLMX 4YT5A 4EAAA 4FHJA 4CCAA 1USIA 1LY1A 3F2VA 3DYVA 5HOEA 4CF5A 2WU1A 5AW7A 4Y6OA 2O7NA 3PT2B 2YHIA 3OLZA 5HP4A 3ML8A 1UC9A 4KH1A 1WXMA 2MMGA 5L45A 4JI8B 3FF1A 2QTMA 4J49A 2IPNA 4PTLA 1KSHA 4UBLA 2BH2A 3CNHA 4YIKA 3D8RA 2VDLB 4O4LA 4QOFA 4KV7A 3KQTA 1XF9A 3W2IA 1XD8A 1G9SA 4YREA 2N7JA 1ESZA 3O21A 5AUNB 2XMBA 5AOVA 3TJMA 2AEFA 3OPMA 4HVLA 2IZ7A 4TLLB 2WSMA 2DNFA 2N1VA 1E3LA 4QHYA 1VCBA 5L95C 1FW6A 1QBGA 3VR5A 4NE7A 5TQVA 1ZU5A 2YOFA 4RV9A 3LVFO 3CVOA 3A36A 4MO2A 1D07A 2C78A 3LY8A 5DISB 3G0CA 5E9QA 4BNZA 4PHGA 1X7DA 2BKFA 3ZDDA 2A35A 2GZ3A 4EW1A 4B3MB 3E0QA 4NZOA 1USVA 2B3AA 4JO0A 1GQ2A 4UBNA 1WQ4A 4CV0A 2IYQA 3P96A 4GXRA 4O08A 3O4VA 5CHYA 1SVMA 2HRQA 1QKIA 2L83A 2I71A 4MKGA 1QHHA 2JJQA 2ZR8A 3FRJA 3LIIA 2HPHA 1T0QC 1IHOA 3GH3A 5JCJA 3N7TA 4FYKA 4ZXPA 4JR2A 3DQPA 4YJ2A 1JWBD 5IK2A 1WUKS 2D1TA 3CKMA 2QQ0A 4IIJB 4TRJA 1NDUA 2WVJA 4FBGA 2DUWA 3H16A 3DAYA 4BJ3A 5KWJA 1QZ3A 2XYGA 3WWYA 4EA9A 4EQ6B 1EXWA 2V4LA 1ITZA 3MCZA 2P7HA 3SJ7A 3FMOB 3IFSA 4DCSA 4UEQA 3VZBA 4Y6PA 3GLUA 4M3NA 3RS0A 3N3AC 4KO8A 4Z3KA 5EXSA 2DYOA 1WD5A 3CZ5A 3U4EG 1YUNA 3B51X 2ZRJA 4HLDA 2DR2A 2FEPA 2D3AA 4XCXA 5M04A 3BCRA 5K8VA 2PD4A 4E5PA 5JH5C 2ZBDA 5HIJA 4PG5A 3FFXA 1ZI9A 3MYYA 2YHSA 3OUZA 3WLEA 2XRZA 1J22A 1E3IA 4TT3D 4N41A 2X7HA 4OV6B 4I4TA 1T3HA 2Z4SA 4PYNA 1UPXA 4MARA 4BO0A 3LDUA 1KOLA 2VZKB 1QHIA 2A8YA 3M6MD 3MWDA 2X8LA 4TRMA 1LBQA 4UREA 1FTNA 2C99A 1YJBA 2Q7OE 1GFWA 5IZ4A 1JHRA 4P2GA 3ZZ0A 5CPBA 2GKGA 3TCNA 1U3FA 1HEIA 1TEZA 3EGVA 3QW2A 4R51A 4R8RA 4TSRA 2GETA 2CBZA 2O8FB 2FSGA 1SOAA 3SEBA 2RH4A 4DUGD 1U2PA 2I7TA 4N48A 4E5KA 2PJUA 4DT1A 1E1LA 4GICA 1WV1A 2Z0DB 3UUEA 3FC4A 4MGYR 2JVIA 1KF0A 3SNKA 4JQWC 1TZKA 3I5MA 3ADOA 5IHXA 1P8JA 4BQIA 3G5AA 2DPGA 1QP8A 1C76A 1R1DA 3EECA 1ZZGA 2PO7A 3SM9A 2WTUA 3L0DA 5ITZB 3G13A 3LYHA 1KR2A 2JXTA 3R5TA 2RHMA 1MOSA 3G8YA 3ZDXB 5HW0A 5I8ZA 2CFUA 3GMIA 4G1CA 4JSYA 2BZGA 2WZBA 2MBEA 4AJEA 3R8FA 2IA5A 4AJYB 2OBXA 3QOFA 4I50F 3AERA 3LPDA 5KKAA 1POXA 3KSDO 4BZZA 1RRCA 3CPEA 3CB4A 1E6WA 1A70A 3AUKA 1FB5A 4CCWA 5EUCA 2WXMA 5LD2C 3ONWA 5LLIA 5REQB 2AQ1B 2WD8A 4D45A 3W0LB 3B08A 1YOBA 1U6IA 1EVZA 4HG2A 3HEAA 2JLZA 1FMLA 3ZTWA 3SFZA 4QUJA 4BEBA 4RBSA 3S1AA 4J0KA 1T9CA 5LQJA 3QEMA 4Q18A 1SB3C 4LOHA 4C78A 1YZFA 2EKDA 2OKGA 1W34A 4U0JA 5EMKA 5GZ3A 2W0SA 4CQNA 2DTEA 2VH5R 2YYSA 5SV2A 2ZB3A 4B31A 2GZRA 4FFPA 4DABA 1JSRA 2QPOA 1LNZA 4E6EA 3RU3A 1V8DA 4YT8A 5F9FA 3SHVA 4GYJA 5LQRA 2H8GA 4DMMA 1PDXA 4EG0A 4YQZA 4D82A 3WJ2A 4QOIA 2WTAA 4NYIQ 2HUPA 1FZTA 1IHYA 5B15A 4K8RB 2Q9BA 2N4FA 3F5MA 2ZI7A 3E82A 3ZQ4A 1CIVA 2OZKA 2ECQA 4JOQA 5ALWA 2Z9BA 4Z5ZA 1S4MA 3V2IA 4FKMA 4ZOAA 4UNNA 3R5XA 2V5AA 5KNLA 4B76A 4CM9A 1FPYA 4RYLA 1T9BA 2HDEA 3Q8EA 1DEXA 4OQMA 4LRQA 1M6YA 1HY3A 2OLKA 1LFDA 2P9TA 5FPPA 4FYWA 4B6FA 1UKBA 1ODCA 4PYKA 2ZETA 4OUKX 5CP8A 2AR7A 4MQFA 1JWAD 2XE4A 4B32A 5ICSA 3UKJA 5EWJB 3DSRA 3GDHA 1ST2A 3JVVA 3GOQA 5AJHA 4M1WA 1EEXB 4NMHA 2I6QA 4RA9B 4YAUA 2FN8A 1K07A 2I2YA 1CJEA 1RPJA 3I62A 4DR2B 3UENA 4QO7A 3BKWA 2JEOA 3ZWYA 3OIVA 3W9YA 1TM4E 5JNWA 2JGJA 4IS3A 3H8SA 2O2GA 3LK6A 1GITA 2JBAB 5BVGA 2LWPA 1ARZA 3ZDBA 2FU7A 3G0IA 3TLEA 3IT2A 1GNPA 2W5UA 3JVEA 1NBMA 3PGA1 1JDBB 1Z0IA 1KRWA 1GUAB 5K4HA 1T29A 2FAZA 4Q39A 3ZKWA 1YE5A 4NAWA 4XIFA 4YUWA 2Y0EA 3SE0A 4JI0B 1IOZA 4GNRA 4EQZA 1FXSA 4FEYA 1R0BA 1N5RA 3L04A 1AMNA 2UYHA 4N01A 4RL0A 3GP7A 4QM7A 5LE1A 4W9FA 4Q16A 4ND5A 1SK8A 1SVSA 1V1RB 5A0VA 2VCYA 2DAJA 4RY2A 4QXPA 2AHRA 2VTBB 3P2YA 1UPBA 2QV7A 4MV6A 5HS6A 4DUYB 3ASZA 2HLHA 1N2CA 1ECLA 4WWOA 2D5CA 3WAOA 3FVRA 1WLSA 5KOHA 1E18A 3E7WA 3R2JA 3G02A 2XTZA 2WYVA 3SE7A 3AINA 2KI5A 4P5EA 3DHWC 1KH1A 5CX1B 2GI4A 3F96A 4ZV9A 3ILXA 1RE1A 1UPAA 2JVKA 2O48X 5JEDA 3DO8A 4DQOC 1R4MA 3AW9A 2HIHA 3REGA 4CMKA 3UFXB 2H89B 3Q3NC 1UT5A 3G5UA 1M6HA 4GVLA 2AQHA 3L7NA 3AL3A 3COJA 3JYLA 3PX3A 4V0LA 1RCUA 4S24A 1NG9A 4EZEA 2YY6A 1RACA 4F3NA