3BK1A

Crystal structure analysis of rnase j
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
551
structure length
551
Chain Sequence
GPQDHVEIIPLGGMGEIGKNITVFRFRDEIFVLDGGLAFPEEGMPGVDLLIPRVDYLIEHRHKIKAWVLTHGHEDHIGGLPFLLPMIFGKESPVPIYGARLTLGLLRGKLEEFGLRPGAFNLKEISPDDRIQVGRYFTLDLFRMTHSIPDNSGVVIRTPIGTIVHTGDFKLDPTPIDGKVSHLAKVAQAGAEGVLLLIADATNAERPGYTPSEMEIAKELDRVIGRAPGRVFVTTFASHIHRIQSVIWAAEKYGRKVAMEGRSMLKFSRIALELGYLKVKDRLYTLEEVKDLPDHQVLILATGSQGQPMSVLHRLAFEGHAKMAIKPGDTVILSSSPIPGNEEAVNRVINRLYALGAYVLYPPTYKVHASGHASQEELKLILNLTTPRFFLPWHGEVRHQMNFKWLAESMSRPPEKTLIGENGAVYRLTRETFEKVGEVPHGVLYVDGLGVGDITEEILADRRHMAEEGLVVITALAGEDPVVEVVSRGFVKAGERLLGEVRRMALEALKNGVREKKPLERIRDDIYYPVKKFLKKATGRDPMILPVVIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Metal dependent hydrolase
publication title Structural insights into the dual activity of RNase J
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 167
structure length 551
sequence length 551
ec nomenclature ec 3.-.-.-:
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bk1A03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 3bk1A02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3bk1A01
3RKKA 2I7TA 2YNTB 1A7TA 1WRAA 3VPEA 5AXOA 4JO0A 5LS3A 3IE1A 1QH5A 4D1VA 3T3OA 5B15A 4D1WA 2WHGA 4TZBA 5HH4A 1ZTCA 2BTNA 4YSKA 5ACXA 2NYPA 4RL2A 5A0TA 4UA4A 3SPUA 2E7YA 4EYBA 5EVKA 3WXCA 2OHIA 3P2UA 3I15A 5ACUA 5HH6A 5EH9A 2ZWRA 4FSBA 5EWAA 3FCZA 5AYAA 4GYUA 4D1TA 4C1CA 1A8TA 1KO3A 1MQOA 3S0ZA 4BZ3A 3BK2A 4YSLA 4C1DA 2BG2A 2BGAA 3DH8A 4UWRB 3SRXA 2BG7A 4CHLA 3DHCA 3KL7A 5HIPA 3DHBA 2BG8A 5EVDA 4J5HA 2ZZIA 4RBSA 1BVTA 5ACPA 1DD6A 5AHOA 4AX1B 5LMCA 4RM5A 1QH3A 4UWSB 5B3RA 2GMNA 4EXYA 1KO2A 3I0VA 3F9OA 4ZO2A 4NQ5A 4FEKA 1WUOA 2P1EA 5A0VA 3I11A 2DKFA 4F6HA 4V0HA 2FU7A 4YSBA 2P4ZA 4B87A 4EFZA 1JJEA 1YCGA 1ZNBA 2I7VA 2QEDA 2GFKA 5LM6A 4C09A 3SBLA 5K4MA 2YNUA 5ACSA 5FQBA 5ACVA 3T9MA 4D1UA 5LLDA 2BG6A 5B1UA 1BMCA 4EYFA 3SFPA 5KILA 1XTOA 5AHRA 3PY6A 3JXPA 4C1GA 2BFLA 4TZEA 1L9YA 4Z5ZA 1DXKA 2QDTA 2Y87A 3X2XA 1X8HA 2GCUA 2UYXA 1Y44A 5K0WA 3BK1A 3KNRA 3I13A 1KR3A 2AIOA 1ZKPA 4XWTA 4ZEJA 3R2UA 3MD7A 4RAMA 2ZO4A 4O98A 1E5DA 4KEQA 5FQCA 3TP9A 3ZR9A 2YNVA 4J5FA 4Z67A 3IOFA 2GFJA 4HL1A 2YCBA 2QJSA 3RPCA 3BC2A 1X8IA 2Y8BA 3AF6A 2BFKA 3Q6VA 4Z7RA 4FR7A 2FU9A 4Z5YA 4XWWA 5K4KA 4C1HA 1YCHA 5HIQA 2VW8A 2BIBA 2BG8B 5EHTA 2FU8A 4AWYB 2Q0JA 4F6ZA 2BFZA 2WYLA 4RL0A 5IQKA 3ZNBA 4H0DA 1JJTA 2Q42A 3QH8A 2QINA 4GYQA 2NZFA 1VMEA 2BC2A 2A7MA 3RKJA 5K4NA 2Y8AA 1YCFA 4NQ4A 3ZQ4A 2Q9UA 4ZNBA 2I7XA 2XF4A 5LCAA 5EV8A 4LE6A 4AD9A 1VJNA 4AX0B 3SW3A 2CBNA 2DOOA 4EY2A 2Q0IA 3IE0A 5LSCA 1M2XA 1VGNA 4U4LA 4UAMA 4UWPB 4GCWA 2WYMA 2YNTA 2NZEA 3A4YA 4WD6A 5ACWA 3PY5A 5ACTA 4PVTA 4TZ9A 3IDZA 2QDSA 3IEKA 2AZ4A 4C1EA 2YNWA 3PG4A 5AEBA 2P18A 1SMLA 3L6NA 4TZFA 2HB9A 4P62A 1JT1A 3I14A 5LCFA 4BP0A 4TYTA 2YNVB 3BV6A 3T3NA 2H6AA 1BC2A 3LVZA 3X2ZA 4UWOB 5HIOA 4ZO3A 2NXAA 4NQ6A 3IEMA 5HH5A 2FM6A 2M5CA 4HL2A 4RAWA 3G1PA 5KIKA 3H3EA 1K07A 4DIKA 5LE1A 3AF5A 5AXRA 5A5ZA 1P9EA 2WYMC 4KEPA 4EXSA 5EV6A 4AWZA 5HISA 1X8GA 1HLKA 4Z6XA 3IOGA 2BR6A 4Z60A 2OHHA 2YZ3A 3AJ3A 2FHXA 2BFZB 2FK6A 3IE2A 4PVOA 4EYLA 2XR1A 1WUPA 3KNSA 5ACRA 4DILA 4TYFA 4UBQA 2FHXB 3DHAA 2ZNBA 5EW0A 1WW1A 2P97A 5LCHA 4XUKA 3ZWFA 2BMIA 2R2DA 2OHJA 2WRSA 2GKLA 4NQ2A 3SD9A 3X2YA 3X30A 4HKYA 5EVBA 3ADRA 3VQZA 5ACQA 5DPXA 1DDKA 4D02A 2M5DA 3ESHA 5FQAA 1XM8A 3FAIA 2FU6A 4C1FA 3IELA 5A87A
chains in the Genus database with same CATH superfamily
5LB4A 1QK4A 1ADJA 1SUWA 1M1NA 7YASA 3AW9A 2L0FA 1WDKA 3KV1A 2KB0A 4KLNA 1SHLA 1HDIA 4JYCA 2Q2OA 2XMQA 2QMHA 4HZUA 3BMNA 2HJGA 5CLJA 3P5SA 5DCUA 3EJ6A 3B13B 4KQ9A 2FP4A 4QHSA 4ZO4A 3VOAA 5EJ8A 1MG5A 3UYKA 1BDMA 2E82A 5SZHB 4P34A 4TUUA 1DO0A 3FNEA 4X0EA 1FYXA 4N0MA 5EE3A 3L1KA 2Y0EA 1EWCA 3VYUB 2QQEA 4KP7A 1YKFA 4XYMA 1GRQA 1FYWA 4M1YA 1WUJS 4ACAA 5IYZF 3EVTA 3HABA 3Q11A 4LOAA 3C3WA 4MPTA 4DNOA 9ABPA 4C7JA 3MTAA 1F3LA 3OLVA 2H51A 3I1JA 1DBPA 1KK2A 5EXXA 4OV6B 3DO8A 4EMBA 4HRAA 2PYZA 2QGFA 5E6RB 1B2LA 1GSHA 4OQNA 3LOQA 1CQIB 2KHZA 1YL7A 5L3QB 2Z8LA 1KA9H 3EVGA 3HCAA 1I0IA 1KOJA 2EJWA 2V7UA 3ISJA 5T7BA 3QXGA 1WZIA 4KX5A 1VR9A 4HEQA 3LHDA 4BNUA 1AKEA 2BM8A 4L8LA 1DC8A 2W8ZA 1E1KA 3DDNA 4Z4EA 4QBTA 2MJEA 5BV2P 2R2QA 2Y93A 3KBBA 1QNLA 3ANYB 3EF1A 5ER6A 3C14C 4LWOA 4ZAFA 4FHGA 3LWDA 4LRYA 2L18A 2DWUA 2ZRQA 3IFWB 2WBLC 4JY7A 1GU1A 3ET4A 4OXIA 2GA8A 3ZJYA 3I13A 4KHPB 5L45A 1X7GA 4PHGA 5SICE 4NFLA 3SAJA 4F6LA 2A33A 1L3CA 4QG3A 4YMVA 3V5NA 1NIPA 5LNK6 2BBOA 5CTJA 4EI8A 4QM6A 4B3XA 2FMIA 3Q3IA 3ZX5A 2AK2A 4KXFB 1NF9A 1K3UB 1K5HA 3ZI0A 1QQAA 2X6RA 5K0SA 1GG9A 3ESYA 3L1JA 5COBA 2H63A 4UTPA 4P86A 1ZO8A 3U1BA 4PZ9A 1XAJA 1DAGA 2WV9A 2AN4A 4E07A 4XWKA 3SEAA 1YJCA 4TMZA 1NN1A 2XYPA 5GTDA 1W0JD 5G0SA 1E18A 3GNSA 3UW1A 2V9CA 3RK4A 1DQNA 2ZQ5A 2HW8A 2Y8AA 3X23A 4LN1A 4FB4A 4RJLA 4FTWA 2Q4BA 3W2GA 1PFYA 1B8UA 5B58C 5FOUA 4DHZE 1VJNA 3R6WA 3INRA 2BGWA 1XA4A 4YRTA 4RTMA 1XIVA 4AKHA 3JQ7B 1SC4A 4QA9A 4EY6A 4KYIB 4L85A 2JI6A 4B09A 4LXUA 4C6RA 2WHYA 3VZQA 1AWDA 1YK1A 3A4YA 3RG2A 4RV4A 1JBEA 3DZFA 2JKZA 1DIRA 1Y80A 1I7HA 3PSEB 2FWJA 1B41A 1L0VB 1RPAA 1EUVB 4HX2A 4U7DA 3NHZA 1QHGA 5K0EA 4R0VA 3ORSA 4X95A 3P45A 5ENVA 1JKJA 1PNTA 2GESA 1JSRA 1TJPB 3JSXA 3NVZA 3PNVA 5HFAA 4FJYA 4FR2A 5L53A 5FWNA 3PUJA 2Z2XA 2BSQA 3AZQA 1IULA 2VRCA 3AEEB 4B8WA 5KTYA 3NHWA 3ZXXA 2DYOA 5ALVA 1QPGA 4KI0A 4RFBA 2L83A 2ORED 3LBIA 2RDGA 2YDYA 1WSBA 5HBRA 4UEQA 4C43A 1E1QD 3IS3A 2ZSEA 1FFCA 4EYGA 2PCJA 1BYIA 1HZZA 3EF0A 4U7TB 2BFZB 4PS1A 4UAVA 3DEAA 3BOSA 4O0MA 5I5GA 1ZN2A 4DILA 1PQYA 1EWQA 3UC9A 4ZFNA 3TRJA 4HNTA 4U1RA 4OP1A 2FOLA 1QH0A 3BTSA 3TPZA 8AT1A 3CE6A 1FCJA 1FNBA 1QP7A 1YL5A 2YWRA 5DNWA 3WY9A 5A6VA 3IL2A 2EG5A 3INGA 4L07A 1NJ8A 3QHQA 4G11A 1X92A 3TL5A 1DPFA 1E66A 3C98A 2BYVE 4DXFA 3GP7A 3CLTC 1L3IA 1Z47A 4DSNA 3IAAA 4PBSA 2PLFA 4FE7A 5FFMA 1DFHA 4QZVA 1VPWA 1NVID 3BA1A 1R8YA 3HGTA 3MWEA 1CUBA 2WJ4A 1KDOA 3ZWQA 5SZKB 1RWXA 1OE0A 2HTME 4RJIA 5M2QA 3ZHRA 2NM0A 5JC1A 3K70C 3IQFA 3B1ZA 4EMUA 4O33A 5EJ4A 1LVUA 3OZVA 4YCDA 1EF5A 3X1XA 1W0KA 3DMFA 1HDCA 3QITA 1U0OC 4J91A 3AYZB 1JHRA 4HVAA 2I9KA 1JI3A 5JY1A 3KZCA 2GPTA 3TAHA 3HXLA 4ID3A 2P68A 3EPLA 3VDXA 1MG0A 1LWNA 3WBKA 4YXWA 4QHTA 3KNZA 3S1SA 4IIVA 3PTFC 4MVJE 3LBNA 1U6IA 3BILA 1C4XA 3LUBA 1L7BA 3O91A 1MRNA 5EE1A 1G42A 3D43A 2ZZIA 1WUYA 4I36A 1YMUA 2Z6VA 1OWLA 2WT4A 5E95A 2XH8A 2I1KA 2VSYA 2X6QA 1HLFA 4BC1A 1JWMD 1KM7A 1QT9A 5E9WA 1C77A 3RC7A 4L75A 1SR8A 4PW0A 2KFKB 3JQ9C 4R9RA 3HRHA 2YWDA 4R31A 4RZSA 1SAYA 5A0VA 1IZ7A 1PG2A 3SJ7A 3N74A 4AFNA 3IURA 3FNFA 3NDRA 3I76A 2ILTA 1KZHA 2EW8A 2YTZA 4LYHA 4ZRIA 5IG2A 1A8UA 5FLXA 4TKVA 5EWMB 2EGUA 3JQPA 3OJ0A 4AIRA 1X1RA 5I7WA 4WBNB 2QX7A 3OOSA 3RB8A 4NNJA 1T4BA 3I9OA 4PG5A 1UOOA 2KT7A 2ZGVA 3PWZA 3GJ3A 2AOVA 1NMQA 3VPDA 4WEQA 4S04A 3IVMA 2CJXA 3U13A 4FFRA 3P9QA 1K53A 4OPMA 1A71A 3J7TA 1KQNA 3KLNA 4Z1MA 1DJQA 1TKRA 3S1LA 5FF9A 3UK1A 5CXXA 1YACA 5A23A 4K6OA 4Y2UA 1NENB 4J4TA 2OD2A 2WTMA 3D6VA 1TGVA 3RIGA 2C9WB 1RPTA 1N6PA 3WLHA 3SLRA 3SVLA 4KX3A 3WNCA 4WXYB 4MMXB 4QL3A 4Z4QA 1CBUA 2YYAA 4RMNA 4PNHA 3LVRE 1TZKA 1OYOA 2FWRA 3ZWBA 1RKVA 2R6HA 3DBIA 1Y5MA 1YZTA 5EWJA 5KZMB 3PVLA 3N1XC 1Z4IA 4HXGA 3N1YC 3PUYA 3UMJA 2IU0A 3FZNA 5FOTA 5EXEA 1CJVC 1YZVA 4RZXA 4KTTE 2J7QB 1XZ8A 2LVPA 3STUA 1HKHA 3HY4A 3I9NA 1SKMA 1Z0SA 3SN6A 4CI0B 5KQRA 2PTGA 3ZQ6A 1OW3B 1TA4A 1FFBA 4E11A 2BSXA 1BXRA 3T5CA 5B2EA 1U8YA 1ZFNA 4NICA 1MQ9A 2EFDB 5C9ZA 4PANA 3TO5A 4G50A 4W7IA 3BE4A 5JIBA 2JH9A 4NE7A 4PVTA 4QLAA 5AW3A 3TIXA 2WQZA 4FB5A 3DTNA 4XVHA 3RNOA 1ISIA 4ZHSA 2IPNA 4KITB 4JWKA 3OHPA 3MSCA 3HADA 5IJ9B 4DV0B 2SCUB 2TS1A 3R3HA 3O8RA 1B6RA 1E3TA 1ZGJA 1CE8B 3B3AA 3W7VA 2FPRA 3IVRA 4LC9A 1VLLA 3NCHA 5JXJA 1JIQA 4L0QA 3UH1A 1GGEA 1D1QA 5G0VA 4PR0A 2HJVA 4DIKA 1SXJC 5ALRA 1UPUA 1I35A 4GM1A 5IKCM 3VJKA 1S7GA 2P69A 1NLMA 5C2TB 1V71A 2VDOB 2P2LA 1TF5A 2ACVA 1Y1KE 1CEXA 1GGKA 1PYOA 1F2UA 2FFJA 3Q8XB 1CUFA 5ILGA 4HX5A 4DA9A 4G5QA 4PAQA 4FS3A 1XNQB 4O25A 2BGIA 1R5NA 2V7GA 2QTNA 1J09A 2FLKA 5IRCD 3L40A 5SV2A 3ROZA 3OD1A 2YY7A 2JIZA 9LDBA 5A02A 3T95A 1GG3A 3I04A 1AHIA 4CKCB 3KCQA 1RD4A 4IP0A 2QMYA 1CF2O 5L3RA 4B3RB 5KHLB 2NP7A 5CJPA 1MRSA 1ZM7A 3WWEA 1S02A 1JQAA 5FQAA 1X6VA 3HGQA 4XCQA 1ZH0A 2D10A 2AUMA 4L5YA 2AQ3B 2FPGA 4KZPA 4G4SP 3IELA 2GUGA 1C9JA 2Y8EA 2AZDA 4G8JA 4YJFB 1DDOA 5KJ1A 3O13A 1T8SA 1T1SA 4JK3A 3HKBA 4KQMA 3F7NA 2XUOA 4QUDA 1DC7A 1HT2E 2FPPA 3O4JA 1V6AA 4E5VA 2Y1WA 3PRYA 2DPHA 3U7JA 3R3XA 2ZYUX 4Z0PA 2KQSA 2J9YB 5EMHA 1N6RA 4I6EA 4NYIR 3NAMA 4WKBA 4QBIA 3IAM1 1CY7A 4CM8B 1PT5A 2JHPA 2HXYA 1J39A 1ACCA 3H8WA 3S0ZA 1E2HA 5AKHA 1N5XA 2HCTA 1UFQA 2JCVA 1KC1A 3N8DA 4G1EB 4XOIA 2FB9A 2AMJA 1IN8A 4BFWA 1C0EA 3MF4A 3E7FA 4P3NA 1XZLA 4M99A 5IWAB 3FKYA 2C58A 5C46F 5BQ5A 1WHSB 4PC6A 1Y8ZA 2CSXA 3DMYA 1WV1A 2MHCA 4KEAA 1NJ2A 5ADHA 2RJOA 1QE5A 4BZZA 3REQB 5CDTA 4W4TA 4YMGA 2N7JA 1J0EA 3A32A 5HDQA 2CJNA 3PTLA 5AXBA 3I6YA 4YL8A 4HT3B 1UOPA 4JIGA 2K2QB 4RQAA 5AW1A 1AOXA 1GKLA 1RYZA 2JPDA 1ZESA 1G2OA 2QP9X 1DC5A 3NI2A 1XRPA 4DLVA 5KNBH 4R4JA 4Q6BA 1BMQA 1DQSA 1L8AA 5JR3A 3EXIA 2EGGA 3AI5A 3BSSA 2GPYA 4Q93A 2O2GA 1ENOA 1F2RI 2Z4SA 1QMGA 4RAMA 1L1QA 1IY8A 4ZCMA 1Z18A 2F59A 4KEQA 1V96A 1H2XA 1UD7A 3PQ8A 4E30A 3KWVA 2BYTA 1YRHA 4NV1A 1ECGA 2RI0A 4IO0A 3UENA 3WFIA 4B33A 2HBRA 2DFTA 1RI5A 5JV5A 4LDPA 1QHNA 4N5IX 2B30A 2QRJA 4JBWA 2WS3B 2XDWA 2A1TR 4GDLA 2HUNA 4QU5A 1PJLA 1RS0A 1ESNA 1ZP6A 5JHAA 1DZ3A 3CINA 1E5LA 3JRWA 3FPCA 1UEJA 4BE4A 4MUIA 4MLDA 3FPLA 2BP7A 2OORC 2Z5LA 4M0PA 4RXUA 1PV4A 2YZ7A 5EGSA 3VR0A 1C1XB 2XNDD 2W58A 3WR5A 3BXEA 3V46A 3QE9Y 1D6JA 4DMFA 2AXNA 3MILA 4MCAA 3WGGA 1TVMA 3ZLBA 3QEBZ 2ZR7A 4F6RA 4FGKA 4B8YA 1ZAKA 4GH5A 1A9XA 3RRFA 2HT6A 4F6CA 1LB1B 2ZUDA 1LPOA 5LZ7A 3GD5A 3WA0A 1YMVA 1Q16A 3WQQA 3QOYA 5K6AA 2XVMA 5KU1A 4WOCA 1NE2A 4OX9Y 4YP1A 1NUAA 2PKEA 3L82B 3K1YA 3HR4A 3UQBA 2I3DA 4B75A 1THGA 5CA1A 5C1PA 3RFUA 3AOEA 1P1KA 1B0UA 3PXCX 4I8IA 3MERA 4E7OA 1XSEA 1QKZA 4EG7A 1DXYA 3DOJA 4QPNA 2POCA 8ADHA 4QYXA 3KWLA 2Q3HA 4PX9A 3ZWVA 3V48A 3BULA 3CNOA 1F1JA 4DAEA 2BE7A 4TT3A 2PD6A 3BIFA 3OWEB 2F43B 3ZVKA 3RBXA 5T8KC 4EO7A 3WJ7A 2A9QA 4WHMA 3G9QA 5BMVA 4UVIA 3UMGA 1PVVA 1VZ7A 1XZDA 1S6YA 2O8DB 4ZEMA 3R3VA 4ZGWA 1TW2A 2QTLA 4ZU3A 5AXCA 3LP6A 4YRGA 3DQVA 4HNAA 5AXAA 2BWFA 5F1OA 4J49A 1YBVA 4EEWA 5A4AA 3AVQA 4ZVVA 3DBRI 4NL4H 4OHFA 3RN9C 4BFSA 2WF5A 1B7GO 1MOPA 1VCIA 2PE9A 2CFCA 3OPYB 1WIAA 5HFYA 4RVHA 2G9VA 3MM4A 2VN8A 4QASA 1G7SA 1D0IA 2IXFA 4NAVA 3CKLA 4LECA 2DXIA 3L7NA 3HCBA 5H5JA 1I3OA 4YRLA 2P9BA 1XRNA 3RPFC 2WXGA 3LVFO 4E5PA 2GBLC 1IXYA 5D85A 2WR8A 4E3ZA 2HA6A 3LTEA 3TVYA 4DLRA 2VQFB 1ZCAA 4M53A 3NBYC 4J4BA 1V1MA 1T3ZA 3D4BA 1FNVA 1H2FA 4LRXA 1T8TA 3Q2OA 1NA5A 2R7KA 4AWAA 2BM9A 4F1JA 4KNYA 3CZPA 2GEJA 1Q11A 4GOMD 5HJ5A 3K2BA 2OK7A 3EVFA 3WYFA 2F55A 2C9YA 5HIKA 3V8NA 3KK0A 3ZUNA 3TGPA 4ZVTA 4NULA 1V1RB 5A3JA 4JP3A 1NXTA 3ED5A 4TVOA 3OOEA 4CLHA 4G1VA 4XJVA 3V1LA 5F2NA 4BPBA 1PP4A 1ZBDA 4TVSA 3EZ2A 4L7VA 1JDBB 3DLBA 1EXVA 3H1BA 2N7EA 3R7WA 4MM3A 2EELA 4KXXA 5BRNA 2BFDB 4HI0E 3IP5A 4WLFA 3BD6A 3LIIA 4JR1A 4TZ6A 1UM9B 4KXVA 1IN1A 3ZTTA 1Z15A 4EGSA 3NETA 4K0RA 1X1SA 5AUIA 5IMSA 2J31A 3RVOA 5CFLA 1K8RA 2O2HA 1JHYA 4K9DA 3QU4A 1U2EA 1X1CA 4G67A 3EGVA 1F1HA 4S1VA 2GOYA 3KQSA 5DPMA 1W5SA 3B1LX 4G4SO 2Z3WA 4WINA 3C3AA 4J5FA 1A1VA 2KK8A 4ZZ2A 1OTRB 1Q1BA 3AH7A 2ZYVX 4ZVLA 2D2FA 2JCGA 3RHFA 3OICA 3DPDA 1TI7A 5HE9A 1IBSA 2EL9A 2VUTA 1PR2A 2WM2A 1TM4E 3GWGA 4BXOB 1I2BA 5FWDA 1T4DA 3ZXSA 4RIGA 4F38A 4DLKA 2EIXA 2WVJA 2OY0A 1ET9A 2H0RA 2DUWA 3H5WA 3ZZUA 4ROTA 4BRSA 3RT3B 3AUSA 3VTKA 4MWZA 5JNWA 4M7OA 1R4NA 2GHTA 1JKMA 3PLVA 4DQUA 1TVKA 1E60A 1HURA 2V74B 1GQQA 3OSUA 3ZWMA 3JW0X 4OH1A 3HB7A 1FD6A 4XM1A 5ECGC 4BS9A 4XLTA 2JZOA 4E15A 1IXKA 4YAFA 2PZ8A 3AUYA 3N8NA 4BE9A 4QQFA 2HRRA 1H1LA 4F2WA 4CKBB 3G8BA 1M0SA 1E2JA 4RFSA 2W2OA 4B7UA 2X77A 4W99A 1WEKA 1YJBA 3L7AA 4A8JA 3D2LA 3RSZA 3KOOA 2JD0A 6AT1A 4OGWA 3PQ7A 2N75A 1DELA 4M2LA 2MCFA 4JEIA 3HXKA 2D0IA 4E94A 1GFZA 1GUBA 3GRCA 4EUEA 1OFUA 3CY6A 1RYDA 1CYEA 1ZNYA 1GN8A 4IWNA 4G65A 4PYMA 4WZBA 2XDQA 3V7UA 4ODIA 1NW6A 1QJCA 1FW8A 4PZEA 4ZYLA 2FSVC 1KPHA 3TFWA 5AQEA 4P8RA 4LK3A 3VV3A 4TYFA 1P6UA 2HL6A 1RKQA 4Q4AA 1N7JA 1NM5C 4C7ZA 3JQAA 1NNSA 4X6XA 2XF8A 3QBDA 1ZPSA 5B1EA 1JWAB 4M0FA 5BPHA 2NR2A 1WHTA 1NVUQ 4RZ3A 3T0GA 4NI5A 3VAAA 5JMTA 4O2LA 3PE3A 4IIUA 1TK2A 1XWIA 3IDQA 3B12A 3ZC3A 3WDKA 1M2EA 3DXYA 3LCVB 3F7MA 1T8YA 4NBSA 3WRXC 2C00A 1UP6A 2PJUA 2GD1O 3MT9A 1D1PA 2XUZA 5BNIA 4D1VA 4TRJA 1WM3A 1KJZA 1KVUA 3K5WA 3L18A 3LDAA 5K8TA 4LNUB 4N9F4 2EX4A 2O20A 5K05A 3KUDA 4L0DA 4PO8A 1G5FA 2DMRA 5DM2A 3W8NA 2I66A 4OD0A 4EO4A 5LQSA 1HTWA 5HIAA 2XA2A 3TDKA 1J7AA 3TW4A 2RAVA 4DNFA 3FKSA 2D0OB 4QU8A 2PV7A 4YCAA 3O90A 2JVIA 1E7YA 2GZHA 4ZKDA 1CY6A 1YS4A 1H23A 4GXRA 2VTEA 1P3QU 4R8RA 5D3MB 1M3SA 2IYUA 2BWJA 2QX6A 1ZCJA 5KPDA 1OIXA 3WLAA 1QZEA 4YO7A 2SNIE 1V5WA 1YB6A 2EX1A 3WLNA 2Y68A 4PFSA 2XB2A 2VHJA 4A27A 2ZSAA 1AK1A 3AFMA 3B5EA 5HQTA 2HRDA 1PNOA 3SZLA 1GXSA 3KYDA 4WAFA 3RVRA 2IY8A 4ZMSA 2WA1A 1O6GA 2FPIB 5CU7A 2M4NA 3ADKA 3E4DA 2LNDA 2DULA 4KR2A 3RMKC 4LYYA 1P39A 4V0SA 2WDQB 1F2DA 2IUFA 2A0KA 3RTCA 3VRHA 4TV9A 4MNTA 3RQSA 1XD8A 2DHCA 2Q8PA 1A27A 3OMXA 1DLIA 2Q6LA 3D6FA 1EM8B 4R71A 1T4CA 4M89A 3PNYA 5DPTA 3CZRA 5BT9A 1EUCA 2AJBA 1A69A 3OQIA 1MHPA 1YAJA 2IEDA 2GHQA 4DYDA 1GV0A 2C1ZA 3VKUA 1EB9A 2AMVA 1W48A 3BWUD 2VOEA 5EY5B 3B2EA 4Q7JB 4E6EA 3DHHC 2OC4A 4MP8A 5FL7A 2IS6A 4MR8B 3F97A 5C4GB 4GZLA 1Z4KA 2BG8B 4LPSA 4GOJA 4QEZA 1BXGA 3I6MA 2ZRKA 3VV2A 1MTOA 1JNYA 3RT7A 1OXKB 5HOQA 3KTFA 5I7SA 2SICE 3SS7X 1ORRA 3PQCA 1AQUA 1D1SA 3GUYA 1WMAA 4YCNA 3UT0A 1Y8RC 2BFNA 5J2TB 2HYIC 4R7TA 5IXJA 2LGDA 3FTCA 2LGIA 3RH0A 3MBKA 3JD2A 3ZCRA 5ACWA 3KJHA 3R3YA 3LQRA 2PG3A 3QPWA 4EE2A 4GLJA 1H5NA 3DKIA 1P3JA 2R8XA 1PAUA 5ED4A 1NLYA 2YZGA 2HB9A 5BUSA 3NH9A 4DJTA 4WXEA 2WZBA 2HU5A 3BB4A 2P9EA 1Y63A 4DZTA 4WASA 4HG2A 1M73E 1IHUA 2XIJA 2DC1A 2PKOA 1B00A 1VI6A 1NKSA 2LRWA 1Z5PA 2FXIA 3OWXA 3GT0A 1ZDVA 4FBLA 1HDGO 1A9PA 2KZRA 3A7DA 1GLNA 1PFKA 5EV6A 5JUWA 5H02A 3Q8CA 1HXYD 2ZJ1A 3EXHB 4KQKA 3W06A 2PX2A 4LWPA 3JVEA 3AVTA 5BSHA 3EGXB 3K0HA 1A9QA 1KU6A 2EYUA 4RDCA 5FK9C 5DYGA 2IPLA 3FILA 1Y9DA 3VNQA 1KBQA 1E1NA 2QG9A 1OT3A 1PGJA 2AOUB 4MO9A 2X5JO 1XL1A 4M8SA 1R88A 4EY3A 4X1IA 4ALMA 5H7XA 2HLHA 1V8ZA 4Q4LA 5EQTA 4U2CA 3KTAB 3MG9A 4YRPA 4I6GA 4ZXPA 4ZDKA 4IHQA 3QXJA 1KQFA 2B4TO 5C52B 5KNBD 4D5EA 4N5HX 2AT1A 1HQCA 2EW2A 5J2UA 4KPEC 3PXBA 3EA6A 4IDDA 4EJSC 2Y1GA 2KDMA 3TNLA 4QDTA 4P1CC 3T4XA 2CVPA 3OJ3A 2JLBA 3O9MA 3S55A 4C7VA 5C32A 4FFMA 5HM6A 2NGRA 1T0UA 4EWLA 3H7PB 4RA9B 1Q0PA 2CDNA 4NJEA 3DHBA 2P9GA 2H5LA 1XVLA 5K3CA 1COWD 4TGLA 4B2PA 2NV2B 1P44A 4EXYA 2QTVA 3QWBA 4PHCA 4EKYA 3N3BC 1SD2A 3O4HA 3VHXB 2LPMA 3AXTA 2CMDA 3ZXRA 4GYYA 2LCQA 3X44A 1INLA 3IVFA 4GOND 4K81B 5LQMA 3TJRA 4G0OA 4HQNA 2H5JA 1S9DA 4FMCB 3C8DA 3ZTYA 4H3SA 4XW2A 1EAMA 4X00A 3D6TB 1GC7A 3WZLA 2C5SA 3OQOA 1Z5OA 5IAAC 4R9SA 4A10A 5KTNA 2Z4RA 4YR9A 3FYUA 1DRUA 4FJ1A 3M9WA 4OSEA 2BJVA 5FBQB 2PH3A 4FC7A 2WHIA 4LOIA 1QFSA 3K5HA 4RH0A 2W90A 4RQBA 3PI7A 3MD7A 3I5JC 2UDPA 3ORYA 2WXHA 5EZQA 4WJLA 1LCIA 1GZ6A 1EFVB 5EXPA 2UUBB 4G5RA 1B74A 2BB5A 2W82A 2F48A 1L7NA 2IYAA 1RLIA 3JQGB 2A4KA 4C88A 4CHKA 4ENWA 1E2KA 4RKWA 1XN4A 2LKCA 3UJBA 4K1RB 2X0DA 2IDJA 5J63A 2ZPUA 1N2ZA 4MVJD 1XQ6A 1CUGA 4Z49A 4R3NA 1UCFA 2Y1XA 2Z09A 1C78A 4ETWA 1LM8B 4PBTA 4S1PA 3VXWA 4QX6A 1KO5A 4IDGA 4H0DA 3LWNA 1TMKA 1UGMA 3AKYA 4RK1A 3GZNA 4HVCA 2ALJA 5LDHA 1OI3A 4OQFA 4NATA 3GRZA 4DV3B 1Y8CA 2EWMA 2A0YA 1E7MA 4I4LA 2LTAA 4QREA 3GGGA 1O94A 4CT4B 3DE2X 1IJEA 4E12A 1Q83A 3H11B 3G1UA 1R5JA 3CU5A 2GR9A 4EW1A 2MINA 1T8UA 4G5YA 1K06A 4ZZIA 5GZ3A 1QHEA 1RPJA 2FHPA 1UH6A 2O6VA 3B6MA 4FHDA 3VR5A 2Z0DB 2X4IA 1BU8A 1J90A 1UL1X 3PRPB 4C00A 2C7PA 4BP0A 4AY2A 4G26A 3CUSA 1BJRE 3UMBA 3SYMA 2JFOA 2ETXA 3UK7A 3LUAA 1Z88A 3C3DA 2QAGC 4Z8YA 4L8GA 3H2IA 3SY8A 2PGOA 1R0ZA 1Y7HA 1HWYA 1KO4A 4AZ0B 4KUHA 4ABYA 1SJED 1KEUA 5C18A 4OA8A 5TLSA 3AQ4A 2GXSA 4AKIA 3P9PA 3FZYA 4YRNA 4MWBA 1H5UA 2W3SA 1T5SA 3AR6A 3PKJA 4MA0A 1OHHA 3ORHA 3KM0A 4JI7B 3PO0A 3S2FA 3HJAA 3BRSA 1ZH4A 2XE6A 3CSTA 2X5KO 1VHTA 4FCCA 5EJ7A 4TYQA 1V3UA 2ZJZA 4MRMB 1CKEA 2D1QA 1SVMA 2ZWAA 4YWJA 1JHQA 4DRZA 4CNBA 3NYRA 2C94A 4R05A 3FDIA 13PKA 3Q6IA 5A4DA 4P38A 1G6HA 3N87A 1OF1A 1NONA 3HU2A 1YTUA 2BR4A 5HF5A 1E0AA 3TIGA 3ECSA 2WWWA 4Q3BA 1I32A 1QGUA 5FR1A 4RL4A 2E18A 1B2RA 4ZU1X 5IAGA 1V8CA 2BFFA 4A8TA 1W75A 4I1PA 2E6UX 4WFJA 3SC3A 1Z07A 4G9EA 3TQOA 3RHZA 4OI0A 1JEQA 3S1AB 4FXPA 4MUHA 3QNWA 5BWBA 3OOHA 2HCFA 1FNSA 3E35A 5I7UA 2PUHA 3D02A 2EZUA 4OUDA 2HQ1A 3LXXA 4AJNA 1NNLA 1GZDA 4A0GA 1WMFA 5HQJA 5AW7A 1ENPA 1OAKA 4MCHA 4IDBA 3CLRD 4GVXA 1L5YA 1QCDA 5CHVC 4BO8A 4PZZA 3NTXA 1FPMA 3QPDA 2LUMA 1AK9A 1II9A 2W22A 3OP4A 5H80A 4AIIA 2P4ZA 2R7AA 3O7MA 2ATIA 2JD1A 3HYRA 2AXEA 4ZOCA 2FE4A 5LKRA 3IUJA 3Q9SA 1Z2PX 1P5ZB 3VR4A 2J4FA 1QOZA 4XQEA 2GFHA 4US8A 4LYGA 1MABA 2G7MC 2VHZA 2P4QA 4WFIA 3A31A 1RQGA 4QOJA 3NKLA 2RI6A 3RIMA 1AE1A 5AH0A 2ERYA 1SHKA 3DG9A 1JAIA 3PJFA 2AW5A 1RWSA 3BXFA 4ZOLB 3GLTA 5JD3A 3SGLA 2Q46A 1C9YA 3UK2A 4IKEA 4M8IA 2YWEA 1QVAA 4FSHA 3EFHA 2VQSA 3KQWA 1Y3HA 5B1SA 1SIWA 1UBOS 2OCIA 4XX1A 4ZOEA 2G72A 2CXRA 3UT5B 3TKLA 3N2IA 1GPAA 1G8SA 2D0PB 1PT6A 2XT9A 3ETRA 3HBAA 2Y9MB 2GBJA 2EFEB 5ELXA 3OBBA 4Y6RA 1WX1A 5EHIA 4OX9B 2WAYA 2IUYA 3LZDA 1FDTA 3EN0A 3FZGA 1PVDA 3L9XA 3WB2A 5U9CA 3E1SA 2MTBA 4JXKA 4KGZA 4P2GA 4TS9A 4NDZA 3AU5A 9MHTA 2H08A 2GT1A 2KACA 2CF5A 1UBIA 5HQ3A 1LLUA 1Z0FA 1HE1C 3DLCA 3D2CA 2GN6A 2VRBA 2N1MA 2LXNA 4TQAA 1W9HA 3Q41A 4ECEA 5D8DA 2XLCA 3BHJA 5DLEA 2R8EA 4PPQA 4WKOA 1W34A 3ANXA 4RHTA 3RF6A 2V3VA 5DBOA 3CG0A 4WK0B 3VU9B 2VHUA 3EEQA 1Z83A 3SD5A 4PC2A 1YVRA 4MWTA 2BFCB 3LNTA 3K9FC 1JG4A 4EB6A 1Z5WA 2VF2A 4L5BA 1VJRA 4EYOA 3WGOA 3AETA 2WJGA 4QYIA 2PKRA 3ZS9A 2WP0A 4HAIA 2E0IA 3MWLA 2ZTLA 2F3PA 2OFWA 4CM4B 4Z60A 4LZAA 5FTNA 5A4JA 3IE2A 1DVRA 4G0QA 2JRHA 4L0CA 3FRIA 4HBGA 3G2OA 3K7EA 4YJ3F 5DLPA 2QG4A 4Y6SA 2FFAA 2EP5A 3ZVVA 5EZSA 1O6FA 3KD2A 2JZZA 4RF1A 4MLPA 3J80A 2GEFA 3PTAA 5FCDA 2NSHA 1D4ZA 3EIEA 4W9GA 2M5DA 4LY9A 3E2IA 4I9GA 1FC0A 3K1TA 3U81A 1SGHA 3MIIA 3IDAA 4C78A 2I7TA 3RPEA 3TECE 2A9VA 4A26A 2RG7A 3BGSA 5H59A 5KSPA 2E85A 2VUUA 3OUUA 3CLHA 1IWPB 1ISJA 3BZUA 2EIHA 5SYNA 3V8PA 1L4EA 4MJSA 5ALLA 1PD0A 2VNSA 3TLYA 1DGQA 3F0TA 3HLYA 4JOCA 2VDWA 2Z9CA 2L69A 1NVMB 4XJTA 4MYUA 2J5KA 4K3VA 3WGLA 3IIJA 2OCKA 3JARA 1U7ZA 4COOA 1NG9A 1D9XA 3PEVA 3HCOA 3EARA 2I1LA 5G4LA 4MR9A 4JYZA 3HFRA 1NBWB 3D7SA 4ZN6A 2BG2A 3RC9A 1Z6PA 5CP8A 2CV0A 2SBTA 3EC2A 1KI7A 4OXNA 1C3VA 2CJOA 1KDVA 3TNDA 4R0NA 2L17A 2AV6A 1TU3A 2OD9A 1NBHA 2KPOA 1MJDA 2HA3A 4PZLA 3UF8A 1TMOA 4UMEA 3G8AA 2WOJA 1JMYA 4DR7B 5EJEA 5AI0A 1IQUA 1JV2B 3TQRA 2OJRA 3E81A 4WN9A 2GFKA 3FE2A 3GP5A 2LUEA 2VCHA 1KNXA 3T3GA 4HMPA 5H9VA 3PD1A 1SVIA 4JFRA 2HQSA 3OQPA 2PU5A 2GRAA 3AE3B 4N01A 4KPYA 4HEJA 5FBHA 3O1JC 3LCMA 3EDRA 1UC5B 2PBLA 2VSOA 2DWQA 1WBBA 2PE6B 3D3JA 1X7YB 3Q7TA 1F1BA 5LDDC 1YDWA 4XRRA 4HPMB 3WE7A 4US1R 4I4TF 3KJFA 1CR0A 4EKGA 4YAIA 3EVBA 3LYHA 3ZQJA 4P22A 3EUWA 2V6GA 2OGZA 3AIIA 4QPPA 3GUZA 3IPLA 3CRMA 3SZMA 4EITA 1S01A 4QGFA 5B64A 4PLYA 3GA5A 5HMLA 1P0IA 4LQLA 2XBBC 1P80A 2C96A 2W6CX 4LMPA 2A4MA 1O08A 1E89A 1PT8A 4QVIA 1DOXA 1PG0A 4LE1A 4H4CA 3E9RA 1JIVA 1JP7A 3Q7PA 4GRIA 1Z36A 3IV6A 4K7JA 1KJWA 5CM8B 4N59A 5AVVA 2WY2D 1NPDA 3H0KA 1X1MA 5CYPA 5CVTA 4F46A 3SIXA 3SVZA 2AWNA 3PFGA 5D7BA 1RAGA 2WHXA 3L4BA 3AG6A 4GE3A 2AYOB 1MQSA 5H92C 4GW3A 2AL3A 1PBTA 3PPAA 5F9FA 3SIWA 1WGHA 3P20A 2B4KA 4G07A 4IICA 3QVWA 3TPCA 3KUXA 1SE4A 2ID7A 4ZV7A 2BR3A 1NXVA 4HDSB 4OGFA 4N8EA 4TLEA 2CKDA 3VDRA 5EZ6B 4IEEA 3CF4G 2ZSDA 5JD6A 1N5IA 2C5LC 4MR7B 2PGNA 4Q7QA 4OLFA 3CLSC 4NXMB 3I14A 4XYCA 3HL0A 4EA8A 3IP3A 2GCPA 3DWMA 2PR2A 4FGLA 2ON8A 4CMGA 2CK3D 4AY5A 4FDUA 3TL6A 4FX2A 4EHKA 4CHGA 3CNBA 3ZBUA 3HDVA 3HGMA 3ZCPA 1XMXA 5HKAA 1SXTA 2LUOA 1DUVG 4B81A 4D8YA 3C1UA 4L08A 5TJHA 2WB2A 3WK8A 5TSSA 4KAJA 4C5BA 1H4VB 4D9IA 4DLTA 1IIRA 5ALOA 2C7NB 4KYUA 4OIFA 4PK1A 3U40A 1S8OA 1W73A 5IT0A 2EQAA 1Q7RA 3DUWA 5IM4A 1N9ZA 1UKEA 2Y1FA 2GBPA 3AM5A 2ORVA 1WW1A 4D92A 3HNPA 5JARA 2GXAA 1BCRB 3DOEA 1MOSA 2GBGA 2QQ5A 3MWDA 4NTZA 2QV0A 3IUNA 4FGJA 3BWCA 4HFJA 1E61A 3PHWB 1IN4A 5KYVA 2HF2A 1AKMA 3EW7A 1CWUA 3GLUA 2XUJA 4FFNA 5CJJA 4I1YA 4CR8A 3UGQA 5K6RA 4TYYA 5KB3A 3T5AA 4IINA 1YGPA 3KFVA 1W36D 4PN7A 4EI9A 2C77A 5E2BA 3NS1A 3HM9A 4GR4A 3NIDB 2DLDA 1JXQA 2DZDA 1T5DX 3W5DA 2PYIA 3RYTA 5G2OA 1HR0B 2BHTA 3M34A 3OEHA 1UBNA 3WBJA 2Q27A 6NULA 2YYYA 4R51A 4H1HA 1D4OA 3QX9A 2JLQA 4EX6A 3RLFA 3V4SA 2B92A 2Y1LA 1RKXA 1M8KA 1X8XA 2MYPA 1WZCA 4PF1A 1VJ0A 2C9DA 3GJZA 5ALDA 4CI9A 2R5WA 3C4VA 1GPBA 5I9SA 1LDMA 1FMLA 4ALIA 4CG1A 3O8BA 1O54A 2FUG1 5HK8A 4P98A 3AJRA 4RANA 3SZGA 1K7YA 3TXAA 5C2JB 1VM6A 2LDBA 2QMTA 3RTGA 2J46A 4CQMB 3Q6BA 1MOZA 3ADCA 2O0MA 1BW9B 3ZDQA 5TX7A 1BA2A 4IO1A 1JPVA 2C2ZA 2GBFA 2I7VA 2QEDA 3WL7A 4X1YA 3ZCQA 2OZLB 4HGOA 1YNTE 3U52E 2BTOA 2H1RA 1YHZA 4V0RA 2ZI9A 4EUNA 4D1UA 1VBKA 5AK5A 2WZCA 5TPZD 4KWCA 3Q3FA 2B2CA 4PNPA 4ZK2A 4EFLA 2VPWA 3RYFB 1SWVA 4WADA 4U3JA 3ICQB 2WJYA 1Y6GA 2RIRA 3WGMA 3LNCA 4F8JA 1V2GA 1Y56A 2CJYA 3KYCA 4YGYA 2XADA 1N6NA 2X9NA 2AEFA 2NU6A 3X1WA 1EFCA 5GXGB 4Q9JA 2Q0HA 4XA8A 2WHRA 3VNSA 3VH1A 5LZ4A 5KYWB 4MJ3A 4J7UA 5LQUA 2O5EA 3R09A 5CX4A 1NIJA 1QDUA 4R3WA 4AZ3B 1SHTX 5KEIA 1R6AA 2R25B 2F1JA 2DECA 2WSBA 3PLAE 2ADMA 1LO5D 2QG6A 4YK7A 4E5MA 4JKOA 1A9SA 4BLTA 5CDSA 1IN6A 1KKUA 4WLVA 4JX9A 3K8QA 4I6JA 3V6CB 1G6JA 2HJSA 3JPYA 4LE0A 1FZQA 2RDMA 2EKBA 4IDCA 2G6BA 4PAMA 3T8MA 4AJKA 2BT4A 1BAPA 3C41J 2OV2A 3CLUC 2YZNA 3E84A 2BFEB 1VDVA 3T3HA 4ZNBA 1B8PA 2M0AA 3IV7A 2G0NA 4YCBA 3L7OA 4RFLA 3WJAA 5ERXA 2Q6OA 3NBMA 2WYVA 1UMBA 5K1ZA 1QV7A 3F5MA 4QO7A 4RD2A 4BNJA 2YKGA 2NUTB 4JMPA 5JO0A 2YW9A 4CIWA 1HRKA 1F2RC 1C7JA 2WNMA 3OM1A 4MARA 3X3HA 5IJ0A 4D2IA 2VK8A 4J4HA 3WFZA 3N0VA 4YXDB 4B6FA 2IHKA 3RODA 1T3LA 1WMSA 1LTKA 5E6SA 2PL9A 4RYLA 4WLNA 3ZS8A 3HCWA 3AVVA 2D1SA 3ZWWA 1JDTA 4EGQA 1WMHA 4NURA 2Q1TA 2MOKA 3NS8A 1U11A 1SHZA 4QOIA 2VZEA 1JB1A 2X0EA 3IUEA 3GLFA 3LXMA 4MGZR 2PZBA 3DYIA 3LO5A 1NFQA 1G55A 3IT3A 3HN6A 4A0HA 2FN4A 3FI0A 4Z7OB 2LJIA 1Z0ZA 1UKZA 4ZC8A 1X8LA 5IZCA 4LJPB 4EKIA 4IDFA 2NV6A 4GSKA 4MGHA 1FU8A 3QTBA 2P9HA 4QRDA 2OK8A 5DIFA 3CRZA 4R9UC 4R2MA 1OU4A 1NU8A 3GK3A 4LJLA 3ROFA 4CIXA 1IBCA 3PKIA 3WLQA 5CDGA 4QU0A 1K8XB 5J1TB 3NKVA 3A9KB 4HDNB 1C9DB 1QM5A 1LBEA 1KMCA 5KBYA 4Q6WA 1FB5A 4TYPA 4C7BA 4R1SA 3DL7A 3P1JA 4DEXA 4QDUA 1KEPA 1IY9A 1JHDA 2Q3BA 1SB3C 4JI0B 2CNLA 5JCJA 4E2WA 4OJYA 3K6KA 1OH6A 3ZU2A 2VHVA 5KNDA 1N2CB 2Z9DA 2GCNA 2ODPA 2R48A 5H68A 4CLOB 3RUPA 3JCZA 4X6LA 2QENA 2QF7A 1DWUA 1UJ6A 2PW9A 3OPQA 3U2SC 4ZOHC 1I7SB 4WT7A 1DDIA 2Q1WA 3GA7A 4MQ6A 3PT5A 2DU8A 3LECA 3KU1A 2ZW1A 4C1CA 3BQ9A 4WWHA 4BFCA 4TKMA 4REQA 4YRBA 3USCS 3RSFA 2PBFA 2G4LA 1GD1O 3UTDA 1TQ6A 4CVNA 3ADOA 4S05A 1DT3A 5K8IA 2GMNA 1V5OA 2F1OA 1P2DA 5KTMA 5DTIA 2MEKA 1TMYA 5HGJA 1FRVA 1E4EB 4PYNA 3S2ZA 4INOA 4BWGA 4B79A 5EJMA 1GDTA 1OQRA 3WAGA 4IRUB 3R77A 4ARIA 3P2IA 1EPUA 1QBKC 2J0JA 2KBEA 4KQWA 1Q95A 1CDOA 4MRVA 2DCMA 1FXUA 1E99A 2EEPA 5D1NA 4F4DA 5DXAA 3K0BA 2ZE7A 2J30A 3IMEA 1MDBA 1E7UA 1V7PC 3M5WA 1VMKA 1YIDA 2X1VA 1X1EA 4J43A 3N70A 2IPXA 2HWKA 3LWBA 2PZAA 4KIKB 2ZZMA 3H4MA 1NBEA 3F6CA 1FVXA 5TS2A 4FINA 3EHVA 3AF4A 1IJKA 1KK0A 4WKNA 3H3JA 2AC2A 4DPLA 1KF0A 5F7XA 5H4GA 4UHFA 1PYDA 2HD5B 2O7VA 4IW3B 4ZICA 2VKTA 3S5UA 4QOEA 5E6OA 4UDUC 4XDCA 1TU4A 4PINA 2F67A 4MVXA 4H77A 3NHRA 2GKSA 2X19A 2PVCA 3WS7A 4X1KB 2J41A 3WWZA 4ZEOA 2V96A 3B48A 1MA0A 1H2BA 3SFTA 4M87A 3C0RB 4R8VA 3MBOA 4BX2A 4FADA 3L06A 1Z12A 4BO9A 2WU5B 1YZFA 4RMIA 2TMDA 1IK4A 3H7SA 3GLHB 3V4LA 4CIYA 4DXGA 2VLIA 3HS3A 1KI6A 3TSAA 2MWMA 4NQ4A 5EZYF 4Q82A 5EE0A 1IUPA 1HQYE 1QHFA 1M6YA 4ML3A 3OIVA 4KODA 2ZS7A 3EBOA 2VSQA 2GZ3A 1M5RA 3FCXA 2WLTA 4CL3A 5DK6A 5I8ZA 5DJ5A 4IIFA 3F6YA 3F90A 1JDPA 3RTEA 3PXXA 4J7AA 1VE5A 2EFYA 1W88A 1CZLA 3PQDA 4EA9A 3FB1A 4AJHA 4UOEA 2NZ8A 3EQ9A 2ZJ8A 4ZI7F 3P0FA 4ABTA 1P7CA 4J0FA 3QQPA 2A7XA 4JLKA 3L6NA 3CTMA 4AULA 1R0RE 1USWA 2PL5A 2C7GA 1WXDA 1M10A 1BE8A 4YO8A 1N5JA 4N4AA 3DEIA 1HY3A 2PWBA 2WXPA 1GL6A 4RADA 5HTKA 3TTXA 4NV0A 3UFXA 5BMGA 4PO3X 4FW9A 1JR6A 4Y30A 3H3XA 3VFKA 1RHRA 4NBVA 3COVA 4U2BA 2IH5A 1BEZA 4UXJA 4FE4A 5AI8A 3D7MA 4CQJA 2ZRLA 1VJ1A 1OH7A 4IHJB 2FK6A 4B3HA 5AVZA 2H2IA 4C0AC 4ZIRB 3R3MA 4J16A 2I80A 4R1MA 1BQEA 2BI8A 3D6MA 4MRPA 2PZJA 1YUMA 3IA7A 2BHNA 2JXXA 2DPGA 2PM8A 1I9CA 2XRYA 2DHQA 2IZ5A 2R5FA 1R0YA 3B89A 2FLWA 3N07A 1K9SA 2GEVA 2IBSA 3NC1C 1P1RA 1XEFA 1XMIA 2QQGA 3UM9A 2N9PC 1DUIA 3RABA 4ND8A 4PRYA 4MQUA 5HS6A 2WDTB 3ITDA 2Y3IA 5BORA 2W2NA 4R6WA 2R62A 1AGXA 2Q7DA 1DIGA 2KM1A 1Q50A 3UOAB 1BGWA 1E2PA 5E4TA 1LFDA 1TAGA 1DCFA 5A06A 3SR6A 4PFJA 1RYFA 2OD7A 4O3MA 3PGKA 3OEWA 4EL0A 3UG7A 4R83A 4B6PA 1Y37A 3DW1X 1YVEI 4GXNA 1L0YB 3ITKA 1WM1A 4ZOQI 1XVIA 2JJ1A 3ZDTA 2XNAC 4LF4B 1E6EA 3BMOB 3M2TA 5JLAA 4KMOA 4OQZA 3LA8A 1N5RA 3E2PA 3HZZA 3MGBA 4P92A 5DRYA 3QKRA 1TRKA 5BNTA 2GD0A 1DWQA 1T5LA 3F9OA 5JASA 2P1EA 4C9BA 1M5TA 4NYJR 3GMSA 4DIMA 3PFCA 1L4NA 2P9TA 3TLGA 4QUKA 2QQFA 5AT1A 5L4NA 2OVBA 2BW2A 2ONJA 3IAS6 3BDAA 3SG0A 1DMSA 1YU9A 4DBLE 2REQB 4LMBA 4PLGA 1EO6A 4EYFA 1U7XA 1L1FA 4QJ3A 1YFJA 2GETA 3T9FA 3LH5A 2RHJA 3EUB2 1SUAA 3QX1A 4TN5A 4LZWA 4QU9A 1XDUA 4YAKA 4LNFA 4BB0A 1K50A 2O2YA 3U30A 2AX4A 5BWLA 1DAMA 4MKXA 3HJTA 3DPIA 4BX9A 1VSVA 3NHPA 5HKHA 4XDGA 2ZO4A 3K53A 5BR4A 2R6JA 4GXQA 4UM5A 3ES9A 5EIBD 4UCFA 4H7JA 3BMQB 2V6IA 3WZ2A 4URFA 3UGTA 1R4NI 4NZOA 3EF3A 2WUVA 4FDMA 3IDSA 3S70A 3BWVA 1P3DA 1G8YA 4W9CA 3LY7A 4W5OA 5CVEA 3V3KA 5BW5A 1NRJB 3WB9A 5GQSA 1TPYA 2BD0A 4EPVA 4F6ZA 4RL0A 3MGAA 5DBGA 2CZCA 2TYSB 2XT6A 4D0RA 2QINA 2NNWB 4GYQA 4HDOA 3KB8A 3ED1A 2CV2A 5K4NA 3I52A 2FEAA 2Z98A 2AG5A 3AM4A 3H8VA 4WDQA 2OB2A 2B8WA 5E7JA 4RZHA 1SBQA 2XMCA 3E9ZA 4O08A 2C5AA 3O0TA 3PDJA 4AI6A 2XQGA 1SD1A 3PFBA 2Q9CA 1G98A 2OLKA 4ZYZA 2ZJ6A 3NYWA 4U4LA 3GVXA 3I1YA 2ISCA 1BRMA 4GYKA 1XALA 2QUKA 5B1HA 1CS0B 1Z7WA 4B4WA 4EAAA 1DBWA 1U0JA 3LO8A 1DC3A 4JLUA 5F73A 4WAUA 4R1NA 3OEEA 2C2MA 3S40A 1DIAA 2YV2A 3RNAC 3IIMA 3PPIA 3PNQA 2JWUA 2I0FA 2PL1A 1HEZE 4N58A 2Q0SA 4RXTA 1M6VA 1C7RA 4OHBA 4ICUA 4OP3A 3ZZNA 3H42B 2WYOA 1B6GA 2R3SA 4RNCA 5D7GA 1GTRA 2DR0A 4YUWA 3HBFA 4RHCA 5LOVA 3JWPA 2PVSA 4ZHOA 3FVWA 4QTUB 4DVGA 4BQNA 4XD7D 3KT6A 1N77A 3PQFA 1FNWA 2YH2A 2D7CA 1NR5A 1QF6A 3H5VA 5BURA 3EE6A 4RMGA 1UF9A 4PS0A 2ZVPX 1CF4A 4KE6A 3ZVLA 3O82A 5DXFA 3IQDB 2DLBA 4REMA 4B83A 5ACRA 1NUHA 1RHJA 2JJQA 2QDKA 4FDAA 3B85A 5KKNB 3V1TC 1RJ9A 2AHRA 3RRBA 5HZGA 1OXTA 1K97A 3ZJUA 1PNQA 1Q1ZA 3WA7A 4PNZA 4P7GA 1NVWQ 1W5TA 3ESHA 5JNTA 1DWPA 1NW3A 1NATA 1V39A 2JRCA 4KH1A 4NZNA 5BNFA 4TXNA 1TUEA 4B3IA 2W6NA 1MG4A 5JE8A 1F9AA 3RKKA 3Q3JB 3KLOA 4QEDA 1CFZA 1C7ZA 1HFKA 1WVIA 5LA6B 1WD7A 5DX0A 4G09A 2UZ1B 4CIDA 4AO6A 3BXZA 3TR5A 2ZI6A 4CLDA 3RJZA 2BKXA 4BNWA 3OM8A 1P72A 4PONA 3WK7A 4IILA 4UEKA 4ZAZA 4ESOA 4WKPA 5GOZA 1KJYA 2NLOA 4WBSA 3TLAA 1X7WB 5FX2A 3DVNV 1I14A 1C4KA 3IILA 1WCIB 1I7PA 2XOKD 2OAP1 3SC2A 5B36A 2FZ4A 5BN3B 3OZBA 1A8TA 2PIAA 1RDFA 2ZIGA 3PGMA 4YDSA 1JFRA 3ECCA 2VHXA 4RTKA 1ISNA 3VVBA 4DREA 4NSNA 2B0CA 4PPFA 3ND7A 2OEPA 3PF9A 4IIGA 1MFWA 1JWBD 2K22A 2AEEA 5HA5A 1FS6A 1XR3A 3VH4B 4WA7A 2G09A 3EZLA 2HSEA 4BBAA 1USKA 2GCIA 2CG2A 1RWBA 2RD0A 3I5MA 1VE6A 1TZ2A 5AQ1A 2WZQA 2JLYA 1FVHA 1KOGA 5IF9A 1X7XA 2H57A 3PC3A 4V1CA 2WJZB 1EP3B 5BYQA 1DEOA 1SE9A 4IYJA 1A2OA 1LC3A 1NURA 3I2GA 5KHAA 3QE2A 1KZ4A 2SKDA 2EBHX 1H8HA 4HWGA 1IMJA 4HSEA 1IHXA 4XGQA 5CPBA 1WPGA 3QK0A 2NTEA 2FDRA 4QYWA 4YSXB 2CLCX 3JTEA 4AUEA 1F0ZA 3UIEA 3WHLA 3VO1A 3T3MB 1KY3A 4JLOA 3EQ6A 4Y2JA 3LUDA 1YBMA 2P91A 2WI8A 3A05A 1U90A 2JFNA 2HQRA 2O4UX 4MUJA 3TQTA 2QJSA 3NUGA 2G5GX 2DQSA 4P0PB 4RK7A 4QBKA 1VRAB 2JIDA 4JC0A 3ZJ4A 2IHVA 5TQVA 1S3SA 3V2UA 1AS2A 1DBRA 2W9XA 1SKBA 3TLJA 5EWLB 1ZP0B 5A62A 1U2GA 2HWWA 2MYUA 2QBYB 4FQ8A 1J5EB 2L19A 5BNWA 3GGSA 4O2AA 1YQUA 2WYLA 3A6GA 2C8VA 3N0XA 3F7TA 3L5OA 4E74A 1RVDA 1L5HA 3W5HA 1C50A 3KOMA 3IESA 4B0PA 4C0SA 4F60A 1CD5A 3TSSA 1AUQA 4JC4A 2BQQA 2OCLA 4K9RA 4KN9S 3K9BA 1KFEB 2QXTA 2QL7A 3IUBA 1SEBD 4BVLA 4IDIA 2HTHA 3ND6A 4ZYTA 4LWQA 2ATCA 1U02A 2VR1A 5CXUA 4O4LB 5HF8A 3EEBA 2CLEB 1ZKHA 2JJ8A 4GLLA 3U31A 2R2OA 2W5UA 5E1OA 2Q29A 2IO3B 3V34A 1H8ED 2BOVA 3EVEA 2W93A 5ESWA 3ZCVA 1T2CA 3VUYA 3N2GA 2F17A 4GGMX 4GDKA 3LPDA 4P4UA 3KVYA 2N7DA 1BXTA 2D2QA 1NJ6A 1JYEA 3GJ4A 2IV2X 1EXWA 5DLYA 2JZCA 3QW2A 2N1WA 2A5JA 1KZ9A 3AILA 4PZYA 3AUXA 2C7MB 2CFZA 1DG3A 1P1BA 3GAMA 3CGWA 4IXNA 1E0KA 1PQPA 1W6RA 4JNCA 4H59A 4KXWA 1TK9A 4O1NA 1ZXBA 1HYHA 5CVDA 4X63A 4JXXA 4DBZA 1VLHA 1UJCA 5DWQA 2ZRBA 1IIBA 2DH5A 5JXWA 4HDKA 3C3JA 3OX2A 1OMOA 1TYAE 2WU0A 4H3VA 1TU0A 3E5MA 1X9GA 1H05A 5JSYA 1V5FA 1VCMA 4UJ5A 1Q7CA 3C7TA 4CUJA 2G4VA 2WXFA 1Y5LA 3NRBA 3E9DA 5EHQA 2QMUA 3BICA 4KXUA 1MKYA 5E4YA 1OXBB 3M5PA 1EFUA 4GPBA 2GYVA 3IBTA 3VISA 1XM8A 2CNKA 4Q9KA 1VJDA 1C4CA 5I9MA 3CNLA 2VJNA 1HV8A 2E37A 1OVMA 1JWLA 3IPCA 1CUYA 2VXBA 5CFQA 1IOLA 1KYTA 2Z59B 1KE1A 1QTRA 4HGNA 4HB4A 3I53A 2D5CA 4YJ2F 3VBCA 5GWXA 4EGAA 3WGIA 1I4OA 3PRHA 4OI4A 4GC9A 3RIHA 3UZUA 4B6OA 2KC2A 3DMTC 1OLUA 3RVPA 1IYZA 4E08A 4BO2A 4EFDA 4Q0MA 1Z73A 2VZLA 4KXQA 4YMLA 4LJAA 4E70A 4R8MA 2JI7A 4GDMA 2UUAB 3J9CA 3ICWA 3MHPA 4BLQA 1XRRA 1XGKA 4YRRA 3TXYA 4JT4A 4DUGA 2BMFA 1SOAA 1MBZA 2BEJA 3KQPA 1M1YA 1N33B 2WU3A 2BHLA 2GB4A 1TUGA 2QTMA 3DFZA 4PZPA 2XKKA 1BVTA 1L6IA 2EHJA 3H2HA 3WWCA 1MB2A 1GAXA 3PXGA 2OV4A 1UBHS 1P6XA 3QHPA 4UQLA 5IBCA 3BVZA 1Z2AA 3J81k 1G66A 4F86A 2G28A 3V1YA 4D96A 1R0CA 2KWUB 2UYHA 1HQRD 2OCXA 4LC1A 2B35A 1BMTA 4LCJA 1ACLA 3W8FA 2IEZA 4M3NA 3DVAA 1AZLA 1WD5A 1NJFA 2IHUA 1CIPA 3ENKA 4CKWB 2NS5A 4JZYA 2ET6A 4QTYA 2FU5C 3U4GA 1X38A 4K6GA 3CUVA 2UVDA 2B37A 5EJ9A 4XQCA 3ZOKA 3D8TA 2HF7A 4LXQA 4YWHA 1G6KA 2JXTA 3TB6A 1TKEA 1JEDA 2QZ9A 2FW6A 4U63A 2CLIB 5K7SA 4TTTS 4ZCIA 1EVQA 4QT4A 5KCZA 2D8MA 3GZNI 2H1LA 2R6GA 4YYZA 3FVTA 4CG0A 4BKGA 3WK5A 1S3GA 4KC0A 3L8MA 2XSZA 2Y27A 3WGJA 3MINB 1L4FA 1E1MA 2GZMA 1QVZA 1QU3A 5IWCA 1T3HA 1Z5UA 3QYFA 2IYNA 1C0IA 1L5WA 5ADVA 2EEZA 2F3UA 4AWYB 4R8SA 4GOCA 1XL0A 3UHFA 4X92A 3DCJA 4LVUA 3LY5A 2BEVA 3H5TA 2GJAA 1K68A 3BL8A 4TWJA 3OCCA 3WOVA 3SF8A 4EEXA 2R5NA 2WB4A 5FPYA 3GEEA 4RPLA 2PTLA 2NMVA 2NTYC 3RVMA 5A9SB 4DJ5X 4XGKA 1G64A 3TBLD 5BN4A 1V11A 3LD9A 2BELA 1U3FA 5LCAA 1N2SA 4FKZA 3B9JA 4XYLA 5D86A 5F35A 3M3JA 1WNFA 2XRMA 4GI7A 3PV1A 1QZXA 5M3BA 3T1HB 3O95A 2WPNA 1N2IA 3D31A 3QUQA 2VTBB 2RHBA 4TLMB 1PR1A 5BUCA 5K9ZA 2BKEA 4FZ3A 5EEHA 4KN6A 3C4JA 3DKKA 3TUJC 4N7RA 1SIBE 3TR0A 5B7QA 1LRLA 3MCZA 3K09A 3TINA 2HTFA 3R7AA 3M9LA 4TS1A 4N9QA 4RK0A 1VJ5A 4IVPA 1J00A 1AG9A 1YCDA 2IYOA 1W46A 1SKYE 3OP1A 5L7WA 2YFHA 2M5CA 1N9GB 1AGPA 3WDMA 4LJ5A 2LGYA 2FG6C 4KRFA 4JVSB 4DLZA 1FTNA 9GPBA 2ZUVA 4I55F 3NJRA 3K4PA 4C0QC 5CA0B 1XTBA 2YZ3A 1XTUA 1Y3AA 1YFLA 1U9IA 3MJCA 3OWOA 1THTA 3WAOA 2F8SA 4RA6B 5K3AA 4BL5A 3WK6A 1OQQA 4BLSA 4LMAA 1SC3A 4MGKE 2R1VA 1JYSA 1Z17A 4AJIA 2A8YA 1A5BB 3HVUA 1G5PA 3A9SA 2OAGA 3WIBA 4QNNA 1CP2A 3LDHA 2A3NA 3VYSB 2NW6A 3A0UA 4GKAA 1KJ8A 2HK7A 4ONEA 2A7QA 4PHTA 4Q4HA 2QE7D 2VYQA 4M36A 1PJ8A 5SY4A 1A82A 2IS2A 1FUUA 2PKQP 1NN0A 4Q47A 3MS7A 1ODJA 2C83A 3E58A 5EJIA 2IYLD 4C80A 2YXEA 2B99A 2NYAA 1EWYA 2MW5A 1YE8A 3BQNB 2QTHA 3IVGA 1G59A 3KX2A 1Y81A 3RADC 4PZDA 1SK9A 4ER7A 3TUZC 1I4PA 1TKGA 3IC5A 1G5QA 3LDUA 1EVKA 4RAOA 3RJTA 4NQRA 3ZHOA 4TV8A 4G6ZA 1TFUA 5F1YA 2C2KA 1UMDB 1A4RA 3MOSA 2HDOA 4LZOA 2I6QA 5FWYB 5F4BA 1D8TA 4MHOA 3O9ZA 4IRMA 4UWSB 2DAFA 2R1TB 3L01A 4BVUC 3ULKA 4AROA 4ERXA 3VZPA 4JDUA 4RX1A 2XWBF 5L3VA 1WKCA 4C4AA 4C09A 2QNBA 5DCWA 1HYEA 4OK5A 1TZOA 3RS9A 1OI4A 3BTVA 4U9UA 5BR8B 3V6EB 2XE7A 4KE7A 4Y2GA 3IV9A 1WBDA 4JEUA 1JPNA 4YSYB 2FSPA 4B0EA 4G24A 2FSFA 3LYAA 3L6RA 3I04M 3GEPA 4ILEA 1Q3HA 3LRTA 6GPBA 4F11A 2OGWA 3Q72A 3DVQX 1XLUA 1FEHA 2SKEA 4R1TA 4MQ5A 3RAFC 3I2HA 2H31A 1UUPA 1VIAA 3G8YA 3VU8A 121PA 1SZJG 2R2AA 3ICPA 2DX7A 2KBFA 2EFJA 2FW9A 5KJCA 1R6XA 4P36A 3FZEA 1AKRA 4M9ZA 1WJ6A 3QCAA 3AI7A 2QW0X 3UMCA 5CR9A 3OCWA 3O7WA 3NANA 3W78A 4H0CA 4ZOBA 3IA2A 4C7KA 2DUMA 4OMFG 4RKQA 4CTMA 3GDGA 2C7QA 1PSWA 1HNXB 4X91A 1FNUA 4ROSA 4KO4S 1T29A 3I9V6 1F0YA 2HK6A 2H54A 1J8MF 5KTTA 4R2KA 5I8WA 4H3KB 1NL3A 1BQ4A 2VWHA 2R8YA 1F06A 2XBUA 4F1WA 4E4RA 2O05A 3IDOA 3FLBA 4YP7A 4OMUA 4N6OA 3FGZA 2WSLA 1Z29A 1JEOA 2V58A 3TRFA 3VVLA 8MHTA 1FFWA 4ATNA 1EDOA 5KOIA 3K0FB 1J0DA 3AVYA 4D0LB 3QE3A 5FI0B 4H9GA 4IW0A 3F74A 1P7WA 4LA4A 3DJFA 2WE8A 1YZKA 3QVGB 2OWEA 4CM9D 2AOTA 3OJLA 2GI9A 3AI3A 4YDQA 1K5DA 5AUQA 4PS3A 1J8FA 4Y6QA 4U7JA 3A1TA 1MX3A 3PR2B 3VGJA 4TLBA 1GG5A 1TM2A 4OHPA 2CB0A 1HFWA 2WXQA 4LBVA 1MAAA 2R0QC 3PG4A 3TD2A 3U19A 4AKSA 1TYDE 1XQWA 3SOPA 1WKVA 1VCOA 2PX4A 3W3AA 1CUEA 1TY2A 3EXEA 3DAHA 5E4JA 2NVWA 1UJBA 4WIPA 4HOYA 4AC9A 3WNBA 2OE2A 2EP7A 3CJRA 3HB4X 3BC1A 1S4MA 5FBZA 3NPAA 4Q18A 4TXHA 3GFBA 4DCSA 2X4DA 1P73A 4GGQA 1JN0A 1KOTA 3EFOA 3OU7A 4DBVO 3JQ8B 2CXOA 2AXQA 1G20B 3K15A 5CH3A 1STOA 4CCYB 5H8WA 3QA9A 3T99A 4P4SB 5CCDA 5CW1A 5ALIA 4RQTA 2VJOA 1E3IA 2C4HA 3U61B 5FB3A 3GF4A 3ZWDA 4JLMA 3FCAA 1G2QA 2MBHA 5AKIA 1LJUA 5L83A 4IGAA 2IU4A 4PGMA 4LTUA 1CQWA 3BFVA 3LXUX 2C1EA 4D3SA 4TQ1A 1RP1A 5FPHA 1WM2A 1H3EA 1V9LA 3M0EA 1U2RA 5CT5A 2R68A 3ESDA 5ACQA 2NQ8A 2GSWA 1IM2A 2C42A 3OQBA 4RW0A 5D2CA 2PGAA 2ODEA 1XEEA 1A70A 1GAQB 2YXBA 1AXGA 1SE2A 1DEAA 4LDZA 1ZL0A 4ALNA 2DSTA 3PHJA 3ZV3A 2Q6TA 4DLXA 2BDEA 3MK31 4F3CA 1HZZC 4DMLA 1DKMA 1E9AA 5KYXB 5KX5A 3WQBA 1NVBA 2Z6QA 1TLTA 5KWJA 1WJNA 1C30A 4QPZA 4DRXB 4N6GA 3ZDXB 5IU6A 1K2WA 5FBRB 4R1UA 4Z4IA 4COKA 2EOAA 4FSBA 3OX4A 5FOSA 2BGGA 2X0IA 2LJ5A 1ORTA 2PU7A 4NC9A 5IABA 1LPBB 2FEWB 2JGRA 2LIVA 4JJAA 4PBRA 4BZ3A 4X41A 3HSYA 5K0LA 1IM8A 2YQ4A 1VI5A 4JELA 1XDGA 4QVGA 3NXKA 3LF1A 3DNMA 2GAFA 3S29A 4KDLB 5FQOA 4BBNF 3QPAA 1KH0A 2ZDGA 5ESXA 3R9XB 4RM5A 1K6XA 1U5BA 4LQDA 1MZVA 2IBMA 4BQQA 4BVGA 1KO2A 3JZAA 1C29B 4GQIA 1QVWA 1O5OA 4JIOU 4EECA 1XJQA 1DV2A 1U8EA 4L8YA 1Y48E 3PD7A 3GQBA 3ZXVA 2IYRA 3AMZA 3BMXA 2GBIA 1XRQA 4EP1A 3SDZA 3UHJA 3HU1A 3DO5A 4LF7B 3A9TA 5HZHA 2K8BA 2NTVA 5AUNB 1J8VA 3B1WA 1ORIA 2YVQA 3EXG1 3JXPA 1EE1A 3SOZA 2OXCA 4NU8X 3TG2A 2WUDA 4NFYA 2CVQA 2B1QA 3DL4A 1PCXA 3VPBA 1A5ZA 2XCRB 3DL0A 5FTKA 4PWYA 1JFSA 2BGNA 1QILA 4EEKA 2WKPA 4RTLA 1VZ3A 2PKQO 1JIXA 4FS8A 5GJBA 1DXOA 2A4ZA 1BGXT 5FUBA 5ICGA 1LF0A 1AN8A 1F2VA 3RF7A 3HCCA 5DN6D 5AZFA 4XZ4A 3QE4A 4BBNC 5EPUA 4A73A 4KACA 2D3WA 1YCHA 3EFCA 4B2IA 1ZW1A 5FXMA 3ONSA 5BO5A 5FI5A 3GC6A 5FEUA 2Q4RA 2Y4NA 3UKJA 5DSTA 2GYUA 1ZOLA 3M62B 1EJ0A 3NP9A 1ADCA 1RM6C 2MLBA 3DBLB 3BUSA 1NJ5A 1VLBA 3DB2A 1BXZA 1PO7A 1IOWA 1PR4A 1U0HC 1KR5A 4B9KA 1GVNB 2QTCA 1TXGA 3A1SA 1ESZA 3SFVA 3LCUA 5AVQA 4KYTA 3KQNA 5TMBA 4S1OA 1Z13A 4LHXA 5EJ5A 2BDUA 2K6QA 5FKJA 4MUMA 1J56A 3Q2KA 4HADA 1UBGA 2ZYTX 3N75A 3DKVA 1U8XX 2OEDA 1U0TA 1XQQA 2N0SB 2WVGA 5I7AA 1IZ9A 1EBFA 3HCNA 2UXDB 2B1RA 3GBSA 1YOVA 2NPTA 3DMRA 3F2IA 5CYGA 4W82A 1WGKA 4XLLA 3GJTA 3MJHA 1J0GA 5EIWA 1YDFA 3BAFA 1IATA 2BISA 3HVKA 1YZGA 1T9BA 2JPHA 2X1MA 1Y82A 2PKWA 4NY1A 2XXJA 3KPUA 1T8PA 4JP2A 2V9ZA 4RJ2A 4M21A 1GA1A 5U4XA 5EQFA 4CO7A 4ZAWA 5LSAA 3R7LA 2FP3A 2QM3A 4F4FA 4GUDA 4K9QA 4XPIB 1X9IA 4W8GA 2PRKA 5GZ1A 1T6XA 2R4QA 3KRTA 3S6JA 2D5BA 2QLLA 2X15A 3G0GA 4BUCA 5G4KA 1C4AA 3GQVA 5JY6A 3O8CA 2DPMA 2EKPA 4TMVA 4EY8A 1TFRA 3GLGE 1QIMA 3P96A 4K0KB 3GAAA 4FFBA 5JRJA 4B2LA 1V2YA 2GKLA 3VDQA 4LF5B 2GZ2A 5BR7A 3THYB 3HWRA 3FPBA 4M1OA 4O1HA 5EQJB 1M34A 3Q1KA 2CJFA 4XQGA 3NU1A 4JB3A 3KIPA 3A33B 3B3FA 2ZNVC 3DMNA 4XQ0A 4YR7A 1KPIA 1A9ZA 4F2PA 2WFAA 2VYVD 5A5EA 3VZSA 5J47A 2ZIUB 3T3OA 1PEDA 4FIZA 5JXGA 4GL2A 2GARA 4B82A 5A2QA 1OFVA 5HRAA 4GPD1 1CZUA 4L2YA 4O4HB 1NXXA 1YKGA 4YUAA 5CT4A 7GPBA 1GR0A 2IPMA 3HCDA 1VPVA 3A37A 5TGTA 2P2ZA 3PVSA 3CLTD 2NMQA 5EH9A 1SK8A 4MQ4A 2LHEA 1T6ZA 3UK0A 4GD3Q 2AFHE 2X9VA 1FVOA 2QRHA 1BDJA 1KMIY 3K70D 4XJXA 5AVYA 4HN2A 3RYCA 5DCNA 4G86A 1Y8QA 2D3TA 3APFA 5DYTA 1JWUD 4PSCA 2O0LA 4KAXA 3KEMA 1T5XD 2Y1OA 4TL9A 1UBKS 1Z2OX 2OAQ1 2VAVA 4UTXA 1OXMA 3FPKA 2KJRA 4F6HA 1XEAA 4WQOB 2GD6A 5AZHA 2MSWA 2MBOA 1SJ9A 3T3EA 3JAWB 3Q7EA 1VL8A 4DCVA 5PNTA 5AI6A 3AY3A 3NHAA 4Q02A 4JLDA 2DTXA 1PKXA 3BORA 1XCBA 4IOIE 1Q0WB 2X5XA 4K2AA 2IHYA 4DR2B 1BMCA 3B3GA 4ZDJA 4GN1A 3FYCA 3WQHA 3X1MA 2CHGA 1W5AA 1J0AA 2H7XA 5B53A 5BUZA 4RBNA 3WCQA 3BCHA 2B8EA 3ZPXA 3VUXA 1H0SA 4QXQA 3UHAA 3T1YB 3H1GA 2O1XA 1E0JA 1WZ3A 4GLSC 4FYMA 1ZIDA 2Z8XA 2WHPB 1T8RA 3WSWA 1GPXA 4Q9NA 5LXTB 2K0PA 1JU9A 4OJKA 5EGNA 5AVSA 5LBIA 1ZZEA 2NZYA 5K8LA 3I9KA 2QJFA 3BVPA 3H75A 4QICA 2QCZA 3FN4A 5CRIA 2UYZB 3DZGA 4LGYA 4HDRA 5KTRA 2YV1A 2XKJE 2QAIA 2WYUA 3THSA 1JMVA 4OAPA 3LCRA 5FT9A 5KWSA 3NBKA 4D80A 1NZJA 1IVYA 1HPLA 2V7QD 3C48A 3HMKA 3MEQA 3PVCA 5EHTA 5TY0A 2KMAA 3QA8A 2Q21A 5FNVB 1T5BA 3EZ9A 2PVOD 3MN1A 2RHDA 1LLFA 2ONZA 2YVKA 1E6CA 3O4FA 2RDHA 3D8HA 2BC2A 2QP3A 5I01A 4A6QA 4CMBA 1TQHA 3UUWA 4I50B 5I7HA 1QX3A 3STVA 1WVGA 3E5RA 2C61A 3L0PA 4MGYE 1XF5L 3OFND 1WY8A 4ZAGA 3VJLA 2IH2A 1PN3A 1QH8A 2XWSA 2ONYA 3JD4A 1UKVY 1VGNA 2COUA 1BOFA 4TL7A 4I3GA 1ZGAA 4ND3A 4Y2YA 4ZU6X 5ACTA 5EPEA 4OHWA 2PNJA 1XZHA 1OLSA 2IW1A 4M0KA 2VYND 2B4AA 3RTDA 2PKXA 4JZKA 1NNEA 1W25A 5IVHA 3PC4A 1RP7A 5I7EA 4G3XB 4Z9BA 1KMHB 1HG1A 4P62A 3CIOA 3UFBA 1FMAD 2J33A 5EVJA 2VHEA 3F9RA 3I6QA 3G7SA 2VBIA 1BHJA 1R66A 3KL4A 1PJRA 4N3GA 4TTIA 4RV5A 4E5NA 2JJ2A 3WBBA 3H3EA 2QJRA 3W2EA 2PAAA 3RUIA 1CUIA 3HVJA 2GNPA 3SXUB 3I73A 4BGIA 5EFOA 1FOEB 2NU9A 3AEQA 2XB8A 4IIJF 1V1JA 3KUCA 4EEZA 4Z6XA 2NXEA 4IWQA 3ZZTA 3C8HA 1PHPA 4CCSA 2OQRA 3KAJA 4C6TB 4C01A 4F8CB 3OE5A 1JFFB 4FMPA 2P9CA 2QNRA 4Z99A 4FFWA 1EGAA 1JB9A 5EW0A 2RH4A 2FMXA 1FIUA 4XUKA 1SXJD 1Q74A 4JUFA 3KSBC 5KTKA 3JSVA 1G3MA 4ZAYA 3UXEA 1P19A 3IOBA 1A96A 3MJRA 2EATA 1JPJA 1D2MA 1M2HA 3L92A 1WUKS 3EGDA 2JQRB 1IOVA 1VJCA 4RIFA 3GUVA 2J87A 4GR5A 3FAHA 1LDYA 4LXYA 1O8CA 4E21A 1TC1A 3IAHA 2HZBA 4AJYB 4EI2A 3AE7B 4N8DA 3DEHA 3L6BA 3FTNA 4BNMA 4DLWA 2BTNA 4MKGA 1QFJA 3CEMA 1Q77A 1GO2A 4YAJA 1JDNA 2GYWA 4EZEA 1C9FA 4DHJD 2IEIA 2WWRA 3RVKA 2CEAA 4BAXA 5HX7A 2IKSA 2MIIA 3IBFA 2Q3MA 4Y9TA 3G89A 1P4AA 3C6YA 4W9RA 1GA6A 3FZQA 2YMQA 3N59A 1VJGA 5AW4A 2IA5A 4P7FA 1JQKA 4CXMA 3KJGA 3THXA 1CDZA 1X2BA 1N8TA 1ND6A 4ZYUA 5JFGA 3H9BA 2QP4A 3V4ZA 2FIFA 3TD9A 4EQ6B 4UZSA 1Q6YA 2M6RA 5BYBA 3NT2A 3A2MA 3A3YA 4FFLA 2WJJA 3JTMA 2P1ZA 2G45B 2JW5A 3Q8WA 4B87A 5LLTA 1NMZA 1H69A 2QUJA 4DNQA 3AHCA 4PLPA 4AECA 1QORA 2WP8J 5B3LA 3H2KA 4XGAB 1KQGA 2AKYA 3U44B 2KHWB 4JI5B 4J0EA 4BKSA 2XMPA 1Q1QA 3ENQA 5IUKC 3D3NA 2N1BA 5AIAA 2KLHA 4MB2A 4PEVA 4BGUA 4YV1A 4HTFA 2QPOA 2UYXA 2AYZA 2BSAA 5AIJA 2D74A 3O1LA 1YZLA 4KRYA 2FZVA 1XZFA 1HT0A 1KBOA 4P4GA 1VMIA 4MAFA 3PFKA 3FCSB 3WWYA 1S1CA 2QJWA 1T91A 1RXYA 3MGKA 5LP1A 1A4UA 3HB5X 4O4IA 4IAOA 4EHIA 1T9GS 3IBYA 4X8LA 1GUYA 1J25A 5B6JA 3JZDA 1ECLA 2DBQA 4UZEA 2JFHA 1FE8A 1GDDA 2C4TA 1GY8A 4LBZA 4YI5A 2QMEA 1MOQA 2YINC 3DOUA 4EG1A 1EJ6A 3ML1A 2GF2A 1QV9A 5HR5A 1EK5A 4BNZA 8ATCA 3BERA 4NEGA 1TVCA 3LXFA 2HSDA 1SKQA 4JV5B 3IPXA 4AZTA 4RGOS 1YNOA 5HIMA 2EGHA 2WAAA 1DKRA 5CTAA 3LQQA 1JEAA 3RUEA 3CBGA 1KORA 3EYAA 2VATA 2Y67A 2J7PD 2YWBA 1T4GA 5MHTA 1U3UA 3MC9A 2IYTA 4WEOA 2G80A 3EA5A 1V3TA 1KYIA 5BWNA 4S1TA 5L8VA 3FD8A 2H1HA 4DDVA 2IITA 3JALB 4LHEA 2H4HA 4DN6A 2PJDA 1NX9A 4EHJA 1EKXA 3BRQA 4MW9A 3DCYA 2GRUA 4QWMA 2XE8A 2VPTA 3QIVA 4CQLA 4ZYSA 3PNPA 3VPFA 3AJ9A 1MP0A 2PLPA 4WZAB 3TWOA 2N4FA 5C80A 5ICFA 2CWDA 3BHNA 1UDBA 3ZHVA 2DB3A 3ZI4A 1O4VA 3E70C 4B4DA 2ZCBA 1SU6A 3RD2A 1ZOIA 5DGXA 3H84A 3KLMX 4XE5A 3ZDAA 3TSWA 1P1FA 3A1VA 3WGKA 1FFXA 2I1WA 2RHLA 2HN9A 1CSEE 1V97A 1OX5A 3F2VA 1AY0A 1K5PA 3O9VA 3WNZA 1XMOB 3V8RA 2UWQA 5H3CA 2Q1SA 4A8JC 4MQFA 1WGGA 2G67A 3PDHA 1N62A 2P9QA 4JPSA 3R2TA 4NJCA 3PRMB 1NG1A 2W6QA 1SC1A 1EU3A 2OCBA 3TLZA 5BN5B 1LNQA 4TUYA 3OTQA 4MYSA 3H65A 2FCSA 4JBHA 2RGRA 1P9LA 4M8LA 2HRQA 2K6GA 5JDIC 2REXB 2DPLA 4MW1A 3S0JA 3ILSA 4D82A 4FJ0A 4DE5A 4JLCA 3VPSA 3FAZA 1YJJA 1WFYA 3R7DA 4MW4A 2MBEA 2QU8A 3L05A 3EECA 4QE3A 2WICA 5A87A 4NOLA 4L4UA 3PHGA 1ECFA 1NJGA 3FSGA 4RCYA 2YBEA 3TOVA 1DARA 1ACJA 4HVTA 3HBLA 2IIQA 3UW3A 4O1IA 1DCTA 3NOXA 3L6DA 3TPFA 3B0AA 4ASUA 4GI1A 4ZYYA 1NULA 4IKGA 1BVRA 2HWYA 1QFXA 3JW8A 4RPKA 1WUTA 3NUQA 3PXUA 1NWHA 4N48A 5CDHA 3AVPA 2C4NA 4GRAA 2FZEA 1XZKA 3RRMA 5C34B 4FM9A 3BL6A 3FDJA 2KWCA 2H4FA 2JZPA 3W5CA 4BFXA 3VJRA 2DHEA 2HAEA 3GJQA 4PM4A 1XXLA 4NFHA 3L46A 3F6EX 1OZGA 4HFRA 3ZGVA 4DLBA 3BCSA 2Q6VA 5E6RA 5A5GA 1CQIA 2LZ0A 5CFMA 5L3QA 2ZB4A 3OAAA 4TWRA 1AGYA 2L00B 4TV9F 5FUXA 1F7VA 2FU7A 2EG9A 3HKDB 1Z45A 2CXTA 2ZQZA 4IZIA 1QP4A 2Q4TA 3O74A 1E10A 1UC9A 5K4MA 3HJUA 3ZNHB 1FQJA 3FLAA 3MJEA 4OM8A 2LE0A 4YWGG 1PUJA 3P2EA 3MJ4A 2HMYB 4X6UA 1QVRA 4AN4A 2G82A 4M46A 3RVBA 3QFSA 2X3UA 2G3YA 3T7SA 3LYLA 3PC2A 1C2TA 2WJ3A 4JI2B 4C4RA 3IOMA 3JYOA 3Q88A 2AIOA 1DXQA 4U2KA 5H1YA 2JI4A 4TT8A 1GPYA 4LOKA 4WOBA 3OZDA 3SFZA 1HLDA 3EDYA 4YT0B 3CISA 4M1QA 2VK4A 4BOZB 1O8BA 2BGLA 4E09A 2A92A 2CU3A 2JRLA 5AICA 4WOJA 2FMFA 5LQJA 3RRNA 1YL6A 3BPSA 4C89A 1VTKA 1LQTA 1P7YA 1Z4MA 4YAWA 5KNCA 1YZNA 4CN8A 2HADA 2KLCA 1CQJB 1EGQA 1K8QA 1IY2A 1V7QA 4GYJA 3TVTA 3ESXA 4D4GA 1OX6A 1W93A 3WSVA 5C5IA 3KQHA 1U0SY 3DQPA 3WIOA 4DBGA 1QKJA 2YXDA 3W5AA 5ARCA 1Q20A 1POWA 2ON6A 1WMBA 1YD8U 3JQ7A 4G4IA 4BOYA 3I2KA 5AOBA 4P0TA 3L5KA 3VYVA 3IH5A 3S3TA 3ZIMA 1CF9A 3ZD8A 2HDNB 3IDFA 1ZI8A 3WP0A 4EOYA 5IT5A 4AX8A 2VP5A 4ZJZA 4NCIA 1SVOA 1U94A 2LCFA 2WFLB 3EEIA 4PQYA 3AKEA 3JD1A 3JZMA 3FCEA 1GTZA 4WCFA 2EWVA 2OBYA 3IP1A 1Q0RA 1MFPA 3ZE6A 3D7RA 4W9JA 2WEKA 2DUNA 2ZYIA 4ZO3A 4WK2B 4HL2A 4IXWA 4QJ4A 1K88A 2Y1CA 5DWVA 5JZSA 2XGMA 4UPEA 1BE1A