3BK1A

Crystal structure analysis of rnase j
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
551
structure length
551
Chain Sequence
b'GPQDHVEIIPLGGMGEIGKNITVFRFRDEIFVLDGGLAFPEEGMPGVDLLIPRVDYLIEHRHKIKAWVLTHGHEDHIGGLPFLLPMIFGKESPVPIYGARLTLGLLRGKLEEFGLRPGAFNLKEISPDDRIQVGRYFTLDLFRMTHSIPDNSGVVIRTPIGTIVHTGDFKLDPTPIDGKVSHLAKVAQAGAEGVLLLIADATNAERPGYTPSEMEIAKELDRVIGRAPGRVFVTTFASHIHRIQSVIWAAEKYGRKVAMEGRSMLKFSRIALELGYLKVKDRLYTLEEVKDLPDHQVLILATGSQGQPMSVLHRLAFEGHAKMAIKPGDTVILSSSPIPGNEEAVNRVINRLYALGAYVLYPPTYKVHASGHASQEELKLILNLTTPRFFLPWHGEVRHQMNFKWLAESMSRPPEKTLIGENGAVYRLTRETFEKVGEVPHGVLYVDGLGVGDITEEILADRRHMAEEGLVVITALAGEDPVVEVVSRGFVKAGERLLGEVRRMALEALKNGVREKKPLERIRDDIYYPVKKFLKKATGRDPMILPVVIEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Metal dependent hydrolase
publication title Structural insights into the dual activity of RNase J
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 167
structure length 551
sequence length 551
ec nomenclature ec 3.-.-.-:
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bk1A03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 3bk1A02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3bk1A01
4RAMA 3I11A 5DPXA 2QINA 4XWWA 1KR3A 5K0WA 5EW0A 4NQ2A 4Z5ZA 2BFKA 3FAIA 4ZO3A 2GMNA 2NXAA 5K4MA 4F6HA 1KO3A 4TZBA 4AWYB 1XM8A 2Q42A 3IDZA 2H6AA 2GKLA 4B87A 3IE0A 5LE1A 3MD7A 1WW1A 3L6NA 4V0HA 2Y8BA 3T3NA 1E5DA 4D1TA 4HL1A 5B1UA 4NQ6A 3ESHA 4RBSA 4FR7A 4C1FA 2OHJA 3IE1A 3PY6A 2QJSA 1L9YA 5B3RA 3AF6A 3BK1A 3PY5A 3I0VA 2P4ZA 2Q0JA 1BMCA 4DILA 4J5HA 4UWOB 1VMEA 4BP0A 1A8TA 2BG6A 4UWPB 4D02A 4Z67A 2A7MA 4YSLA 4AX1B 5LLDA 2FHXA 1BC2A 4EXSA 5HISA 3Q6VA 4TYFA 1M2XA 2P1EA 4EYLA 1X8IA 5AHRA 1KO2A 2WYMA 4GYUA 2BMIA 2FM6A 3A4YA 4KEPA 3IOGA 2DKFA 2OHIA 1X8HA 4AX0B 3R2UA 2BGAA 5FQCA 2FHXB 2FK6A 4UWRB 5EWAA 3AJ3A 3KNSA 5AXOA 1YCGA 4EY2A 5A0TA 4HKYA 3SFPA 4PVOA 3SBLA 3G1PA 1VGNA 4C1HA 3LVZA 5EHTA 4TZEA 3X2YA 4C1CA 4FSBA 4EYBA 4XWTA 4RL0A 2P97A 4JO0A 4H0DA 4NQ4A 3FCZA 2FU9A 5EVDA 4LE6A 2ZNBA 5HH5A 2QEDA 2XR1A 3KL7A 2BR6A 3IOFA 1ZTCA 1BVTA 2AZ4A 5A0VA 5LCFA 3SW3A 1ZNBA 3AF5A 5HIQA 3DHBA 4ZO2A 2WYMC 2GFKA 4EXYA 5AEBA 3P2UA 4UA4A 5ACPA 4YSKA 2WHGA 3VQZA 5EH9A 3RKJA 3S0ZA 3WXCA 2R2DA 5LSCA 2QDTA 3ZWFA 5KILA 2YNUA 5HIOA 4AWZA 2BFZB 5HH6A 3SPUA 1DD6A 3SRXA 2YCBA 5AXRA 3F9OA 5ACSA 2Y8AA 4D1UA 4U4LA 4C09A 2ZZIA 5AYAA 2WRSA 1QH5A 5FQAA 5HH4A 2HB9A 4KEQA 4D1VA 2GCUA 1VJNA 4ZEJA 1P9EA 5LCHA 5ACVA 2QDSA 3SD9A 4GCWA 1WUOA 3QH8A 3T9MA 2YNWA 3ZR9A 5K4NA 5LMCA 2I7TA 5EV6A 5LS3A 2BG2A 4C1DA 1ZKPA 4O98A 2ZWRA 2NZEA 3PG4A 4Z7RA 5EVKA 2CBNA 2BFLA 2NZFA 5B15A 1JJEA 4TZFA 4C1GA 4BZ3A 3BC2A 4RL2A 3I13A 1YCFA 4FEKA 3KNRA 3H3EA 3RPCA 4CHLA 5A5ZA 2BG7A 5ACWA 2I7XA 3BV6A 4GYQA 4C1EA 3X2XA 1DDKA 2BFZA 4TYTA 5LCAA 2NYPA 3TP9A 2OHHA 2FU6A 2BIBA 5ACQA 1A7TA 1K07A 4WD6A 2XF4A 2YNVA 3X30A 4EYFA 2BG8A 4F6ZA 2AIOA 2Q9UA 3DHAA 3JXPA 1JT1A 3ZQ4A 3DH8A 3ZNBA 2P18A 2YZ3A 4PVTA 3T3OA 5EVBA 5EV8A 3IELA 3IEMA 1YCHA 4XUKA 3X2ZA 4UAMA 2YNVB 3I15A 2BG8B 1Y44A 1X8GA 1WRAA 4D1WA 2YNTA 5ACRA 2GFJA 3RKKA 1QH3A 4RAWA 5AHOA 4NQ5A 2I7VA 4DIKA 3I14A 2Q0IA 3DHCA 5ACTA 4P62A 4Z60A 1DXKA 4AD9A 4TZ9A 3VPEA 4RM5A 1MQOA 5KIKA 2BTNA 4Z5YA 5IQKA 4J5FA 5A87A 2E7YA 1XTOA 2YNTB 2M5CA 3ADRA 4UWSB 4UBQA 5FQBA 2ZO4A 2WYLA 2FU7A 5ACUA 2FU8A 5LM6A 1SMLA 4HL2A 4ZNBA 2DOOA 5HIPA 3IE2A 1HLKA 2BC2A 2M5DA 5K4KA 1JJTA 4YSBA 2UYXA 3BK2A 4EFZA 4Z6XA 2VW8A 5ACXA 2Y87A 3IEKA 1WUPA
chains in the Genus database with same CATH superfamily
4DG8A 2GAFA 2POQX 2Q3DA 3EVFA 1SB8A 4F71A 1ZCBA 4LTUA 4BQSA 1M0WA 1SCNE 4MI9A 4HAUA 1LNQA 4LRXA 2C7MB 1OXVA 4RU1A 3HU3A 1CF9A 1G9TA 4B76A 3ZK9A 5EE0A 1EK5A 2DP4E 2FMTA 5EMKA 4FCWA 3SS8A 2HYDA 3B38A 2TMKA 4B6OA 2Q3FA 4JB2A 3VR8B 3C70A 1YOVA 3BS4A 3G85A 3KB6A 1KOGA 4R1PA 1Y6ZA 1E2IA 5I9MA 4NWIA 4CKEB 1FL9A 3CWQA 3EQ2A 4MIKA 3F8SA 1DAKA 3QEBZ 2NU6B 3QMWA 3PCXA 1OW3B 3SVTA 4ACFA 1T5SA 5EIBC 1BMFD 2KPOA 1ACCA 4H1VA 2PANA 4EJSA 4Y2YA 2PU7A 4MV8A 3N39C 2P30A 3T4UA 5J2UB 3IUMA 2OP0A 3DCGA 4NICA 1CY6A 4UFPA 2VXCA 3EGEA 2LTAA 1MH9A 2PNJA 4IDCA 5BN5A 3FBWA 4NNJA 2GZRA 3NG1A 4AZ0B 2C4UA 4BZZA 4BQIA 4L7QA 3UAXA 1AB5A 4M98A 4QZVA 5TGTA 2QRPA 1IZZA 3FCXA 3PNOA 1UIRA 3PLAE 2Q2OA 3WIMA 4GSYA 3Q3EA 3WMGA 1QKZA 4G4JA 3UINB 4DLPA 2EFEB 3DTVD 2XUJA 5JS7A 1MABB 1FFXA 2RHDA 1T0JB 3F6BX 4Y2RA 3IXLA 4ZN6A 5JECA 2R7MA 4RM2A 5GOTA 3JQCA 2WS3B 3OE4A 4NXNB 2JRIB 2AQ1B 1JR6A 3A6GA 3S0ZA 4AJEA 3NXKA 3RFZB 4ZT7A 3SE7A 4URZR 2IITA 5J4LA 2AI3A 2H1HA 3M5DA 1AGRA 2OXCA 3M89A 4QARA 4EITA 4M1OA 1Z82A 3W5UA 3REOA 3X1YA 4EKGA 2HPZA 4WN9A 1KK3A 3R3WA 5FQAA 2HGZA 2WD7A 1TIFA 2VWQA 2G77B 4RTOA 4EFMA 2P2DA 2ODQA 3G9UA 3JQFA 3SX2A 1KF0A 4UXJA 5J4VA 3HM6X 1Z2CA 5TMDA 1L5ZA 4CF5A 5JHAA 5IP4D 1NUTA 3HB1A 1KZHA 3OCVA 1U2RA 3BWDD 3ZE6A 1QJ4A 4LHSA 4MGIR 2EWMA 2O2SA 3RAPR 4DR2B 3IAHA 3GE3C 4IIBA 1W36C 1DQNA 1BC5A 1FYWA 2JRLA 3DZCA 1OFTA 1S3GA 4NAMA 2VT3A 2DZIA 3HB0A 2XOKD 3EGWA 1MHPA 1Q57A 3RBZA 4CM4B 1IVSA 5JZBA 1PZFA 2H8KA 3D4BA 3BL6A 4CE6A 4GMXA 3QI2A 3AE1B 5E8JA 4MJ7A 1PYOA 1K8ZB 4BRWA 1U5BB 3C85A 2BGKA 1KP2A 3NBKA 3B1FA 3LDAA 1XTPA 2ZVQX 4ER3A 3RKSA 5A5EA 1MDFA 2PVSA 4ENPA 2CXHA 3RYTC 5NULA 4DV2B 3W8DA 1C79A 3GELA 3B2NA 1O96A 3LT1A 1MG5A 4WASA 5JAOA 3H42B 3GLIE 4G4GA 3C0KA 3PQ5A 1QHHA 3E2PA 5DCYA 3SJUA 3EMVA 1T10A 1XO1A 4MACA 3DDOA 3BWBA 5D3KA 4JQZA 1Y6QA 2WM8A 1T3GA 3ICPA 1IH8A 4UTRA 1WCV1 3ZNQA 3BH7A 2IGTA 3NCHA 3IPXA 2FQWA 3ZK8A 3O21A 4EEWA 2E4UA 3ZZMA 1E1LA 4RMNA 5EUQB 3OWXA 1QFZA 4FHCA 2XQIA 5IEJA 3V3XA 2FGJA 3C15C 5EXSA 4BZPA 3CX6A 1B8VA 1DV1A 1HM5A 4HL2A 4P5DA 2WINI 1KQGA 4EJSB 4Q34A 4BYMA 3A7DA 2Q3BA 3I1YA 1ZY2A 3MT8A 2QM8A 3RNAC 1XHLA 3SKYA 2JAXA 3PFCA 2MDTA 4Q1CA 3RADC 4NMMA 1DRKA 5B2EA 3LPAA 1SCIA 2PA3A 2GM9A 4BFZA 3WGJA 2E6XA 3ZTCA 5E4FA 1C80A 5JIBA 2HF7A 4DC0A 5J58A 2NV6A 5HZKA 3B1ZA 1IZ0A 4ZQFA 1Y3CE 1UDBA 1NBWB 2G9QA 2X2PA 4NYMR 4Q3OA 1K5GA 3QP9A 1A69A 1HURA 1ZGGA 2OQVA 4XQGA 3URKA 2CT8A 2IODA 3BJIC 4YXWA 1X2BA 2L0TA 3KKLA 1ZOLA 2RHJA 3LWZA 4ZYVA 3NHYA 4YECA 3U6KA 4HOYA 4KQCA 1CVIA 4PZZA 3BWVA 7REQA 3UYKA 2GN1A 4USAA 4J07A 2HV9A 4CQMD 1G20A 2R9VA 2QLLA 3W5UB 4WN9B 1RM5A 2L32A 1J5PA 1Y8QB 5KJCA 1JZQA 1EO6A 3INTA 3CF6E 2B5OA 1PN3A 3Q7PA 2OK7A 4D80A 1WF3A 4RAQA 2DFVA 2P9HA 4LS3A 2FSFA 1NDHA 3HL4A 1P0RA 3CBGA 3SGLA 1NZJA 3Q0IA 1VRCA 4YTPB 1HF3A 5ADHA 5BXQC 4KE7A 3KUDB 1JP7A 5J2TA 1PGPA 2AG8A 4BRZA 3I73A 5FLXA 2FGKA 2V7BA 2EW2A 1WE7A 2DRIA 3IQXA 2QN1A 4B75A 2JI4A 5FCDA 4KQ9A 4HNSA 4MRRA 4OFXA 3DZIA 2ZGVA 2C54A 2B83A 3NWPA 4B4KA 4G0XA 1IY2A 5ALEA 2PL5A 3ZBQA 1JDBC 1AZSC 2HFJA 4NLLA 5DSTA 4AN0A 4GRDA 5ADWA 3WWYA 1GPXA 2OM6A 1GITA 2P0EA 4XQ0A 4IG9A 3RI7C 1J9ZA 1JH9A 4C09A 5TE9A 2INCC 3BVMA 2NVBA 1HFWA 4MP6A 1ODKA 1I4WA 2YZNA 2GLXA 4KIKB 1EIWA 3JD0A 4IIGA 4CHTA 1PLKA 3NG0A 1V2GA 5FNVF 1RQNA 4D9KA 3PYMA 5CLIA 4S2EA 4A3SA 3ZCUA 2Z57A 4C2AA 2JGLA 5EV6A 4HQNA 3ZDAA 2VYCA 4Q82A 2IFTA 2AE1A 1EKXA 2QT1A 2VTDA 5ITVA 2DUJA 2EHJA 5B15A 5CW2A 1Z2PX 3D4PA 2D62A 1P3JA 8MHTA 1SUWA 4FXCA 4R51A 4GKBA 4TSFA 5FOXA 1YCFA 3E0XA 3AEFB 3WAPA 2BR4A 4FEKA 4YACA 3TI9A 1FXIA 3L49A 4S05A 4IWXA 2FG7C 4O29A 2NO7A 1FFUA 3QA8A 1VSQA 3AR3A 5CNKA 3E9QA 4R4JA 2GD1O 3T7IA 2J41A 3WGHA 3L10B 5HQJA 4J1SA 3V2UA 4O0LA 1HG1A 3WL3A 2IY0B 1IXKA 3QVLA 1Y7HA 3D3NA 1P2BA 9GPBA 1AO0A 1J33A 3UUFA 2D5IA 2VXYA 1GUBA 2CHQA 1IM5A 3C8ZA 4OQLA 4XSVA 1S3IA 4LY3A 3W7AA 2P2YA 1PQPA 3H05A 1KI6A 4XUKA 1CY1A 4Q6WA 1QCYA 2XYVA 2IW3A 2P5YA 2Y71A 3BGOS 3IEXA 3INYA 1ESCA 3ZLVA 1K98A 4ZCPA 4KWEA 2H4YA 3MTIA 5AHOA 3F97A 3LSTA 4NU8X 4RV9A 3BXOA 2H31A 4G9GA 4EHIA 2QYSA 5FK9C 5G53C 1I4DD 4QRDA 3RZFA 3MBIA 1ODLA 3SFVA 1YKFA 3NGXA 2ISCA 3IBTA 1YBVA 3MEQA 2YHBA 3RVKA 5EP4A 1IWOA 1HDGO 5CX4A 1DIOB 5EKUA 3GUYA 1XL0A 3PJFA 1XZEA 7REQB 1COWA 2IOFA 1OKKD 1G17A 1W47A 2CWDA 1G20B 1GQYA 2X7JA 3MP9A 2O8EB 3EASA 3VZQA 5CPBA 2WWXA 2BC9A 3BINA 1UMKA 2ZSFA 1TYGB 4MWZA 4IV5A 4PWZA 4ZVKA 4BCCA 3W5DA 2C84A 1AUOA 4AG5A 2FN3A 4WINA 1C7JA 4EB8A 1QF9A 5ECWA 1I9CA 4BLUA 2O20A 1GZHB 2M0XA 4LSMA 2IDJA 4JSRA 2HA5A 4ABYA 1T5TA 2HD4A 3GOQA 4TMTA 1RLIA 1BW9B 3GIDA 4JLBA 1J99A 4P34A 2ZR8A 2K6QA 1L6RA 2NSLA 2DQKA 1QDLB 4EL5A 5FFNA 2A58A 1XLTC 3RASA 5L7TA 1C0LA 4B74A 2QRGA 3OQBA 5F23A 1FX0A 4IIFA 1SZJG 3PEUA 2X4IA 2FPGB 1JBEA 2ZRQA 2Z9DA 3X44A 2X4DA 3N1YC 1PNRA 2ZNVB 1VI5A 4GP7A 5BYAA 1Y4UA 1KWKA 4HEA1 1XZAA 1X1MA 4YJFB 4ZYZA 4YCDA 3AOEC 4PYZA 3HN6A 3KDAA 1E2EA 1YDFA 4MJXA 4UWRB 1NI4B 2CXUA 5AICA 4FYVA 4B5LA 1VIMA 4B6RA 5JQWA 1XZCA 1JYSA 1XK7A 4M0WB 4M89A 3ZDBA 4M49A 3C3WA 3NM5A 1ZR4A 3JQ7A 4FYXA 2Y1XA 1XVLA 2G1PA 2NT4A 4HT3B 1NLZA 4BOYA 2RDHA 1L4UA 1XDDA 2WJPA 3W8EA 2NGRA 4MKFA 1N2CA 3H8SA 3IBGA 4DJTA 3HK2A 1FMCA 2CDAA 4IO0A 3FSJX 4WA7A 1P7PA 4JB0A 3ST7A 2VT2A 3BXFA 1DBRA 5FUQA 5AKJA 2Q1WA 3EAGA 1Z6TA 1XU7A 1MU0A 4FDVA 2GCPA 1UCFA 4Z1MD 4KQXA 5DTJA 3EUWA 3SQLA 2ZIZA 4U4LA 2ADOA 3K9OB 2ZZIA 1B8NA 3BTSA 4QULA 4HGOA 1OXKB 4FS3A 1DJNA 2HIGA 3DBHB 4XKJA 4J0JA 1KE2A 2QRHA 3OIYA 2YC2C 1A1VA 4G85A 2QL6A 3DE2X 5H9VA 3UUEA 4QNRA 1SOVA 1KI6B 2VAMA 3ZIMA 1UGMA 1V3QE 5CCXA 2A0XA 2VDNB 1FRVA 3DQZA 2ZATA 2J0VA 1ZAYA 2WU2B 1IB6A 1VYHA 4WSOA 5KTKA 4IVNA 1E8YA 1F8XA 1N5DA 3EDRA 1ZGUB 2W37A 1EBUA 2ZYTX 2PPLA 3RVSA 4JGIA 2GBRA 2LUEA 3COSA 1N4DA 3WLMA 5M3BA 4LRUA 2OT3B 3QXSA 3A3YA 2QM7A 4WEOA 2DZKA 1JIVA 4GYQA 1P61B 1KDZA 1ZBDA 1O6FA 5IBRA 5A9TA 3RYIA 1DXHA 3U7DA 4QE3A 1ZK2A 2P3LA 1R5BA 1K6MA 3KZNA 4EKIA 1Y56A 1XU9A 3CUWA 3KUCA 1Q83A 4YRGA 3L06A 1D5XC 1FW8A 3M2TA 3IELA 3LQYA 3W8RA 4DR7B 4IJMA 4E03A 4KWTA 1OZFA 3I9FA 4RANA 4TVBA 2W8BB 2QS9A 4W9DA 1VYUA 1N9GA 4HJKA 1DCMA 3A36A 1XYYA 1XX6A 3EK2A 4Z3OA 5IKOA 2OZEA 2VTEA 3K1AB 1JRLA 3P4PB 3DWMA 2FSUA 3IMGA 5D51S 2QZ9A 3Q40A 3HZRA 2KXJA 2WXQA 3V6LA 2VJOA 1VB3A 3UO8B 4MQMA 4IG4A 1P5JA 5ALPA 4RVCA 1E32A 1VE6A 3B7GA 3O2QB 5K45A 4XOUA 1PEKE 3T1OA 3I72A 4NS4A 2WHPB 1X1TA 4F97A 1HT1E 5G5HA 1UP6A 1TC2A 1DTSA 2EDCA 2BM9A 3AHJA 1Q7CA 1ZIOA 5FA6A 3QEMB 2ZSJA 3ZDQA 2DHZA 1JWUD 5ALZA 1NU6A 2FX2A 5JCJA 3ZDDA 4OGFA 5C46F 3JZFA 4EJ2A 3CEJA 5CYOA 3HDHA 3T5AA 2HRBA 4P3YA 3W1EA 2I8CA 1FDWA 1U3VA 4Y7DA 521PA 2FJUA 3ZXSA 2C31A 1NMYA 3HUIA 5HE9A 2PSEA 1WX9A 4ZK6A 2KJQA 1ECBA 5K4MA 5I7SA 3AUSA 1LLCA 4J43A 4D25A 3OT1A 3RVNA 4N7BA 3FDJA 2OMEA 1LS6A 2QHOA 1DBSA 3JX9A 4GI2A 1PYWD 1BDBA 1H8ED 3JQ7B 3QF7A 1E20A 4U7HA 5FOSA 3CW8X 3RROA 2PZKA 4B3SB 2HTME 4MWOA 2EJTA 3VMMA 3KXIA 3LPNA 4KVGB 1N2CB 1WMAA 1AY0A 1A8TA 2W6QA 4WLFA 4CODB 3KUZA 3Q5EA 3KQSA 3RS4A 1YFKA 2YBDA 4JJEA 3VDZA 1RRGA 1I3LA 3DLAA 3RFXA 4BNGA 1R7RA 1DLJA 2FK7A 4XD2A 1H0HA 1RHUA 2K6GA 3HRKA 1YX6B 4C0KA 3N9IA 2FWPA 1B8OA 4B5KA 2KLBA 4MTLA 2HK7A 5IANA 3H6KA 2JRCA 5CP8A 1UIMA 2E21A 4PFSA 1CUHA 4X85A 2XRYA 5HG2A 3AFOA 3IXQA 3ZH9B 1GXSB 4II2B 4YRSA 1JFLA 4BO0A 1SIBE 4XARA 4TN1A 3G1PA 5KOHA 4R8MA 5DH9A 5LZ7A 2YV1A 5B36A 4UXIA 3OHPA 2PGAA 1Q1OA 1Z8NA 3LQKA 2P79A 2FJPA 3HN7A 3ZQJA 4D9FA 1WSAA 3NHKA 4HYEA 1C4WA 4MEBA 4ZQCB 3UYLA 1A8PA 2Q4RA 5LOVB 1ZNBA 5EPEA 4UTPA 1A9SA 4CMJA 5TMPA 2Q5OA 3W5BA 4GECA 2AC2A 2ZUBA 4C7OA 5LSAA 1QCCA 4WIAA 2WAXA 4FLEA 4YSKA 2DEUA 5IWCA 4OB6A 1WBJB 3FUCA 3DC2A 1GPAA 2VKTA 3SQWA 3LKZA 1ZCFA 3A0RB 1JG7A 4AWZA 2SKEA 2SAKA 1E1RD 1BROA 4FONA 2WZQA 3F5DA 1AKTA 3TFWA 2ZAYA 3DWGC 1QV6A 1LSSA 3KUCB 2D8AA 4BKSD 5EKDA 5ACVA 3B9BA 4I50A 1YDGA 4K9NA 3HCPA 1LI5A 5EOVA 3SBXA 2HF9A 4H3SA 1WXVA 2I71A 2YZ2A 5AM5A 3MINB 1Z56C 5L3QA 2ODTX 3W2GA 3BGVA 4JYPA 4NZYA 2KMCA 4I6JA 2XJ9A 1ISHA 3K2IA 3K6JA 3BFJA 3OJWA 4DYHA 1K9SA 1J25A 2PRZA 1Z4LA 1FDSA 4OHFA 3JARB 2WIFA 2LGIA 2PXAA 1BEUB 2B34A 2CFOA 1BD3A 3ON5A 4JKIA 4X54A 2PS0A 1KO8A 5FP0A 3MRSA 5TQJA 1KDTA 5K3EA 3KVVA 1RYEA 3AVVA 3ZWMA 5GZ1A 2KSQA 2YHEA 3ER6A 4RZUA 2JJ1A 4BLPA 3SYMA 2IV7A 5JDIC 3DQPA 2BIBA 3I6ZA 4G11A 4TLEA 3P1JA 2DH5A 3VDXA 3KB1A 5DE3A 4K7JA 1DHTA 3JR3A 5DLEA 1PFQA 4UU1A 1YAHA 1T9GS 5CNMA 1EZZA 1UDRA 3WKBA 1XQQA 2BZ0A 5CFMA 1QX4A 2C61A 3KP1A 1WULS 1XRRA 3D54D 2LW7A 4J6EA 2HHLA 3BZUA 4TQAA 4FA6A 1XD3B 3FOFC 2BGGA 4S1WA 3LBIA 4UUBA 4E5PA 5INTA 2C99A 3PXGA 5HK8A 1XF1A 2Y67A 1V97A 4PAOA 4RPLA 1A9XB 3ZY4A 1B42A 3NALA 3L1JA 1W49A 3OZTA 3IB3A 4YRPA 4OVVA 3TCAA 3RLFA 1Z29A 2Z95A 3Q41A 1WRIA 5LDDC 1FNUA 3B1XA 3LX6A 4H1WA 2CVHA 3HA7A 3ZUNA 1QLHA 5IMSA 1RC8A 3GLGE 5IULC 1J39A 1QOPB 4QBIA 2W6PA 3N0WA 3PWKA 4YWGG 3VTVA 1Q44A 3FPLA 3HJHA 5IMBA 1NVUQ 3UT6A 2NBUA 4HKTA 3DHVA 4FEGA 1XNJA 1O9GA 3HVRA 4EK9A 4UMFA 2BGJA 1SQSA 2UU9B 4KZPA 4NAWA 4FFPA 3RS2A 2ECFA 5EW0A 1GA1A 2Y1FA 1RC1A 4IQ0A 1TA9A 2J9GA 4PLZA 2Q42A 4DR3B 2G8LA 1QG4A 1QOFA 2QLTA 3WNZA 2J52A 2WFLB 3IB6A 1H4VB 3IP9A 1YUNA 1BTOA 2AFIE 4WKCA 3OFKA 3W6UA 5K0JA 2YRFA 1I7LA 1Q20A 4FN4A 3FIUA 1BE6A 1DOYA 5LD2C 1HYGA 1A5BB 2JKZA 4ERXA 3P4SB 5IUJC 3VR0A 4KGXA 4RZ2A 1AQUA 4DDID 1O0SA 1KFYB 4G0ZA 1QPGA 3JVDA 3Q8LA 4TGLA 3NLLA 4UHEA 3JRXA 2O0KA 2IS6A 4FJYA 2AEEA 3WHLA 3CEMA 1VKOA 3A4RA 1I8TA 4GYUA 2EG9A 2NVOA 4YMHA 4NBWA 3IOGA 2HJGA 1W8DA 1UPUA 4E88A 4A0FA 4WVLA 5C7IO 4R83A 1JKFA 2OFOA 5KZMB 2AUMA 1FJXA 3Q98A 1F6DA 2QX7A 4WXRA 1LI4A 1AURA 1DAPA 3T4EA 4I50B 1I6LA 2XNCA 1VGNA 1FUEA 3VISA 1Y9JA 4FXOA 2FEWB 5EJGA 3ABRB 3ITNA 1D8AA 1P1KA 3SPXA 4OFBA 4W9MC 4BMXA 2PL3A 3VPDA 4NJEA 1YJ1A 1YV9A 4ODIA 2MJ3A 5G0TA 4P7BA 4NKRA 2PEAA 2QTVA 4LHYA 4YRIA 1Z6QA 4JI3B 4W9CA 1XMIA 1MVNA 2C9YA 3DEAA 3UQZA 2BFBA 1G7SA 3GGGA 3N3AC 3AMVA 1SCKA 3ZNOA 4C0AC 2K22A 2EAUA 7AT1A 4QATA 4CR8A 3ZWFA 3HCEA 5FJJA 5AKYA 2P8SA 2A7QA 1JHYA 5FQNA 4YK7A 3C24A 2X38A 5LQSA 2GSDA 2DPLA 3O9ZA 3C6XA 1TKGA 1NKSA 3IUQA 3M2PA 2YWRA 1XVAA 4DXAA 3EVNA 2LVOA 2QZJA 2FSSA 4R1OA 4INPA 2Q4EA 4D0GA 5A6SB 3GYGA 2A7XA 1VE3A 5BURA 1DWPA 2DWUA 4KBYA 1Y8ZA 3PHGA 1FDTA 3MWFA 3FGPA 1I14A 1MAUA 1CWUA 1QH9A 4TWJA 3CRNA 3TIIA 4W1QA 1BGXT 3BX1A 2QUZA 2HN9A 3ZLUA 3CZPA 3C41J 4L1BA 3EXHA 4DJAA 1S02A 4CTNA 3P4XA 3CF2A 4IQ4A 1T0RC 1VLLA 3PF8A 1SE2A 4WEQA 2LHDA 2QROA 2ZI5A 4UUAA 1Q0ZA 2O07A 2WYVA 3O4JA 5EHQA 2UUOA 4JX9A 4R05A 3X2EA 1AQJA 2L0FA 4QO7A 3AYXB 2OHHA 1X1EA 4DCNA 1WXEA 4CYMA 3A9RA 4YPOA 4O4JF 3SJZA 2EBFX 2RHCA 2VP4A 4QTTB 2H5LA 4Q4AB 3GNQA 3V8QA 4UU0A 1IDN1 1QK5A 1D5CA 1D0VA 5FBWB 4KPYA 4K87A 2IEIA 2E1PA 3KYBA 1J7CA 2JAUA 1SBZA 3L54A 1JKIA 4NAWB 4ZOEA 3DW3X 3NS7A 1KY2A 4DLSA 2GYVA 3JVZX 2XODA 5CCDA 4LCBA 2BGWA 5DGCA 3WP0A 3ESAA 1KA9H 1E6EA 4TV9A 3EAQA 3FJOA 2YNTA 3RCZA 1SVLA 1LCIA 1XTVA 3AZPA 3BVGA 1AKNA 4FKBA 2IIBA 4ZVOA 1G3QA 2E0IA 1K8QA 1KJYA 1UKZA 5IVPA 1JBKA 3BYZA 2AEMA 4BCBA 1IN1A 2B2CA 2VDMB 2PKCA 4AZVA 1CQWA 1Z2MA 1P31A 3R5SA 2OMKA 4QU0A 3Q72A 1DAHA 3EGXA 2ID9A 3JQQA 2I91A 2ROQA 1IXYA 4IF4A 1JSZA 4TTSA 3C19A 4J3FA 2F1RA 1OR8A 2Q7OE 4D7AA 2QV0A 5CVDA 5C8DA 3KEQA 3AR6A 1FFCA 4M1YA 1FRZA 3H1EA 3MVEA 2XLCA 3E6AA 4FQ7A 3GN1A 4QVGA 1RE0A 2W71A 2PTHA 1CY2A 2ZBQA 3S28A 4IUMB 3JQPA 2A9JA 1FMLA 4RHFA 3LKVA 2D74A 5M2QA 4RNAA 1XZHA 4MQEA 2OHFA 3DG9A 2QU8A 1Z2OX 3MD0A 1LUAA 4MS3B 5KNLA 2VA9A 4L57A 2HCTA 4CQLA 5LE1A 2GTPA 2KWUB 1WXAA 4DRZA 2G6TA 3VR2A 2QUIA 3G1UA 4XPIA 1SKBA 3VU3A 1VM6A 3NGLA 4OA8A 3MQ4A 2BIFA 3L8ZA 4B83A 1CW2B 1QH1A 5LUBA 1CX9B 1MGPA 1WXGA 1AKMA 4BLOA 4HQ6A 4NJEB 3DF7A 3SQDA 5DBGA 3ZNPA 5AM1A 5JWHA 1SIJA 4HGZA 5LL6P 2QTVB 3MWJA 2YMPA 1K88A 4PYJA 2IXTA 3Q3GE 4AICA 1P75A 3ET4A 4IS2A 1M2XA 1LZKA 3JVEA 2OBMA 2GKSA 3PNYA 1I6MA 1U1CA 4ZOLA 1ZMBA 4AJ4A 2BEKA 2PJHA 3KQHA 2WEKA 1HRDA 4UCXA 1C9FA 1ZXLA 1NF3A 1JQ5A 3CH4B 5B1DA 4CR6A 1YZHA 3GL9A 1ZSNA 2HQRA 1Z37A 2C78A 4AK9A 4WQOB 1RRMA 2ZBVA 2AFRA 3CX8A 4G36A 3HJNA 4E5MA 3L46A 1S2IA 3ZBPA 3K05A 2YXNA 2I4NA 4OQZA 1GTL1 2WA1A 1CR1A 4LISA 5KQGA 2HM7A 4XWGA 3WGUA 1Y1QA 1LF0A 2HSGA 4JU9A 3WLKX 1C30B 2OO7A 3EXHB 4DYVA 1RRVA 4IRUB 4DANA 1TI7A 4XUDA 4PV7A 4CEJB 1NPDA 3I6QA 3DOJA 2C7RA 1EE2A 1ZMXA 5F3RA 2VH2A 4JE3B 2JLSA 1L4YA 4ZOCA 5A9RA 3F5MA 2EFDB 4FINA 6YASA 1QH5A 1SCQA 4HWTA 3C14C 3QWFA 4RJLA 4OEHA 5F1YA 3SLRA 3QBEA 3MRTA 3HHMA 4QOHA 1NVID 1DDIA 3QJZA 3LUKA 2DBYA 1THGA 4E5NA 3F96A 3SYRA 1BQEA 4YMVA 4UEQA 4DJEC 3WLQA 4AO7A 2IJ0A 4CF6A 4BN4A 2XZTA 1M34A 5F73A 2VJBA 1JAIA 3VR6A 1O08A 4D2IA 5EHNA 2B4YA 4DNXA 5E7IA 3HTXA 4NPAA 4GZMA 3M6UA 5ALIA 3UK1A 2QLFA 3KYCA 4RF1A 5CDYA 4RWEA 3EGXB 2FAXA 5K4HA 4N41A 4QLAA 1SWVA 1X7HA 1KSJA 5ESWA 3MCVA 2BZ1A 3G0OA 1RXSA 4YRLA 3EMDA 2XRFA 2N0SA 3G5MA 2PE6B 4B32A 1Q1EA 2FW1A 3S8EA 4QELA 4OJMX 4LDRA 1WMHB 1WIAA 5J18A 4B3CA 2AW3A 4HCJA 3V1MA 4PNZA 2Y0DA 1QIHA 2BSQA 3ZTWA 4D8WA 3RPEA 4MQEB 4GKVA 3LIIA 2CR5A 4WJQA 3LWNA 4HWKA 4WBNF 2OYRA 1YJCA 4BNZA 4FYPA 2HO4A 3ZH2A 1T5DX 4ZO4A 1ZU5A 2QLNA 2X6QA 3UIEA 2P2NA 3BXHA 1PDXA 3FNFA 1EGAA 3H4TA 2L3ZA 2Y0EA 2FG5A 2ARKA 3C43A 2I7CA 3VU8A 1WY5A 1YKGA 3M1AA 2IHZA 3PPIA 2JD0A 4TYNA 4MUKA 3ZGNA 2CK3A 1VFPA 4KRYA 1TKAA 4PXSA 4MW0A 4J29A 4EFDA 2O8VA 3AO0B 1NEKB 2B3AA 1X87A 5T3UA 2JQRB 1JVBA 4TTRA 4CWAA 2LCFA 3VX4A 1C1HA 2FN7A 1MOPA 3AJEA 2D2VA 4ZZ3A 1V6SA 1SRQA 4J9VA 2B99A 4KPEC 3R0IA 1UODA 4IR7A 2WWIA 2HDWA 2EELA 1SU8A 2G5PA 1NW4A 5JCXA 2CYCA 4Z7JA 2GR9A 1DC5A 3CWIA 4CKEA 1J19A 8GPBA 1BNCA 3WJAA 4GX1A 2TSYB 3WYDA 4JHLA 3NTRA 2EF0A 4RH3A 2HADA 4HATA 4AYXA 2Q5FA 4ATNA 3IT2A 2HAEA 5JH5C 5B7QA 2R8XA 4HDCA 3ITEA 4E7PA 1AKUA 5AKZA 3MCTA 5J2UA 5A4AA 1RBZA 3ANMA 2ZU6A 2G4LA 3HI4A 1HZ6A 1U9CA 2E5FA 5LLDA 4XE5A 1SUIA 1OIVA 1S2DA 3AJDA 2EEZA 5EJ9A 3GC6A 4UD2A 1TL7C 2EQ5A 1CQJB 1WUIS 3MQFA 3FVRA 2E9SA 3PR1A 4AZ0A 1RKVA 3FCYA 4FNAA 4BXOA 2I6FA 3WL4A 1YFJA 4HNGA 5CRIA 2C7BA 3NV9A 2ZRDA 1Z5UA 3O13A 3WAKA 2K25A 3NC4A 3NBAA 4XVQA 1LW6E 1H0RA 2WLBA 4EG4A 5JC1A 5K2OA 1OVMA 2GPJA 3LP5A 1WGHA 5F1KA 3NHMA 3KEFA 1XCTL 2AF3C 4P7GA 4UE2A 2FZKA 1OC4A 1YRBA 3VYRB 1VG0B 4CUJA 3P9CA 1DX6A 1QP8A 3MUOA 4KVFA 4H35A 5AUOB 2OA0A 4CT4B 3L7CA 2BFPA 5TS2A 2JEYA 5L53A 3HYSA 3GN2A 4H6VA 3PGA1 4HEA6 2HV8A 1J0XO 1L6IA 1NRWA 5IDWA 4HEJA 3RSSA 1S3SA 4N01A 4Z53A 3GPIA 3NWOA 5CGZA 1Y37A 3X0WA 1NX9A 4WZZA 3F2VA 4RVOA 4D81A 4ZO6A 4EWLA 4GXTA 1FY2A 4KXNA 4NDAA 1R6DA 2N0SB 4LGCA 4MW6A 1ZLXA 5CNJA 2N9KA 1L8QA 3TAUA 1J7KA 1HNNA 1Y8RB 3JYOA 2AX4A 5JZEB 1KY3A 4J2OA 4NE2A 3EB9A 1YDHA 3O73A 1N33B 1IEQA 4C1DA 4L27A 1GL7A 1FUKA 3PO0A 2HL6A 4CM4A 1WZIA 4I1YA 4X97A 1H66A 1QMGA 3L4EA 3DMYA 4IIEA 3U4QB 1NUPA 2HWKA 3E4DA 1POXA 4E4YA 1FP1D 5BV2P 2QAIA 4K03A 3R77A 1ESEA 1ORWA 2FMXA 4EI8A 4HPWA 3RD2A 4NCIA 2A0UA 2GPYA 3FMPB 4UCWA 4O63O 4ZYNA 1M1YB 1JF8A 2MSDB 2I7XA 4R9NA 5FTJA 1A5RA 4KO1S 4Z8YA 1OLSB 4LRWA 2YYAA 1E7QA 1NVBA 2EZTA 3RS5A 4YMWA 4YV7A 3H2BA 3O4GA 1EVQA 5A02A 4XQEA 4JEUA 1FRFS 4A5OA 1TUBA 1E96A 3X0DA 3H5VA 4RPCA 4P31A 2YJ5A 3VUXA 1SK8A 2AJLI 5FIUA 3BCRA 2HCRA 3GEBA 2C9CA 3IJRA 5EDSA 2P9EA 3M83A 5B55A 4D96A 2IHJA 3UTDA 3UJAA 1FP2A 1XWWA 3BAZA 2I2AA 3I5AA 2FWRA 2HRDA 3DA8A 4G1BA 3RJMA 5K3DA 2WDVB 4ZAWA 1CEEA 3N74A 4P7FA 2IS1A 2I2CA 4OQFA 2W8ZA 2CL6X 1X7WA 5KX5A 3GDFA 5DHUA 2ZUTA 1FFYA 3FTFA 2R6GA 4FI3F 3PK0A 5CIYA 3F7NA 1JDSA 4DS3A 3W90A 3TGPA 3M9LA 4G1UC 2E5LB 1QF6A 1PBNA 3OOSA 1X3SA 4R0NA 3IEUA 3ZVKA 1IVNA 3B85A 3VZDA 1ZW6A 3GJ8A 4C7KA 3R5XA 3MOGA 4DC9A 3ZNNA 4WNYA 2PBRA 2NR2A 2F1IA 3ASZA 3BL8A 3ZUPA 4BXOB 4QSHA 1R0XA 5CB4B 4ARBA 4LQLA 4OXRA 4C01A 1KETA 3AI2A 1KS9A 1XLWA 1VIAA 2BM8A 2ES4A 1DTEA 5LZ8A 1JE1A 1P3DA 1FRNA 2IUYA 1H69A 2A1TS 1DO2A 2BV3A 4GGPA 1N9KA 1SNYA 5TGZA 5BWNA 1EWVA 3V4LA 3X1ZA 4EUNA 1CQVA 2WHQA 1A8QA 1C1DB 4UATA 3NDBB 3QEAZ 1YTLA 1NI5A 2J0KA 3FA2A 5BWCA 1JG2A 3A37A 5FI5A 4UWPB 1G6OA 4IJVA 4AX1B 3ROEA 1Y8QA 3PFHA 1FCCC 2JUOA 2ZJAA 2W4IA 2XCQA 4AL4A 5DLYA 2LVPA 4XW2A 1RHMA 3B3FA 4ZHPA 5KVCA 4RPGA 3EOZA 1W2GA 1Q1GA 1T1GA 5UKDA 2PKEA 3AB7A 4WKBA 1J1ZA 3KUDA 4KZKA 1OGWA 5FTMA 1I2MA 1JU4A 1N5KA 3H2GA 1I1OA 2HNAA 1PX2A 3GVCA 1RBMA 1N6LA 3B6ZA 2QSUA 1K08A 3NV7A 3D3KA 3I6YA 1E1KA 2AX5A 1NW3A 5FDFA 3CFYA 1KSGA 5FXMA 4L76A 1JAZA 2H63A 4OGWA 1C50A 1GG8A 1M7GA 4DB2A 4EXYA 4NYJR 3OH8A 1IBSA 3R6GA 4KIKA 3KQPA 2JKYA 4YCSA 2FQ1A 3DVAB 3UICA 2CVFA 3IXMA 4YAEA 4ENWA 4L9WA 1K5PA 2TS1A 3CBQA 5BWBA 3SRXA 4HAVA 3F9OA 3EGCA 3BD9A 3Q1LA 3VHRA 1Z0ZA 4WAAA 5F2OA 3JZAA 3AL2A 2VCHA 1Z2NX 1TUBB 4TLCA 1E5LA 1Z3CA 4CI9A 4G0WA 1WU8A 5B57C 4LSZA 1G7CA 3S44A 4MYCA 5GVRA 3ACDA 4KKVA 5ETJA 2C4KA 2XPCA 2F3UA 2ZLBA 2CBNA 1VE5A 3IUPA 1NLYA 1SHKA 2AR9A 4RFBA 3ZDYB 4I5GA 1T2VA 3DV2A 2XXJA 2QVZX 4U8GA 1X7WB 4YNBA 5FFFA 5KX5B 3AHIA 4UAJA 2ZU0C 1ZU4A 4LZOA 1J00A 2QPTA 3RV4A 3NIWA 3PA6A 3JQ6A 3SQMA 3MAGA 1BOOA 2O3QA 4P1BC 3VPXA 1L4DB 3RUIA 2IYFA 3B9RA 5FB3A 4IIJF 1IQRA 2ZTUA 3IVFA 3HMKA 4ANUA 3F74A 1WMFA 1U0OC 1C78A 1QJCA 1MG0A 3GZNI 3JXPA 2VQFB 3TKYA 3KW5B 1U2GA 2RR9A 4AO6A 2EJUA 2HDHA 4AWBA 4PGHA 5HHDG 4WURA 1NOKA 4LJ9A 2YZ3A 5FO1A 3T3OA 1MI0A 2FWAA 2AV6A 2WJ3A 4LVNA 2HKIA 3B1VA 2YY6A 1PYGA 3MUNA 2PV0A 1FRRA 5EHXA 1ZW7A 3RK1A 4B6QA 1YBFA 2AJCA 1C3EA 2GFJA 2YV5A 2GF2A 2HWUA 1ZOPA 3EHVA 2ZVOA 3RT3B 2FSGA 2Y92A 3DSRA 2IVFA 2BMAA 3V62A 1SD2A 2VSQA 3GDHA 4P84A 4NY0A 1EF5A 4OBXA 4XM2A 1IBXA 2BFNA 3MS2A 2I87A 3NZEA 5KTPA 2J9RA 4HP8A 4X63A 2O8EA 3JSVB 3KZOA 2VPYA 2PT9A 1AWDA 4WX2B 4HUTA 1PHRA 5IA7A 2JFYA 1T0HB 1QB8A 1M5TA 3HR4A 4B7XA 1AQNA 4A55A 4HLNA 5ILQA 3DT8A 1EUZA 2F90A 3NVVA 1XQ9A 4RXMA 4OLJA 4BDTA 4DGQA 4OOEA 3FNEA 1BW9A 2B94A 1HEIA 1CETA 3ZVMA 3HXTA 4AJJA 2P9GA 4CIWA 4FLMA 3BHMA 3KQTA 2C60A 4TS4A 3F3KA 2AMVA 3GCGA 4IO1A 1R4NI 3T5TA 2N9EB 3MHZA 2WFAA 3U81A 3IV7A 2H29A 2FPGA 3HFRA 1Y34E 1IC6A 4I1OA 1NF9A 4YJFA 1NNI1 1IVYA 4A16A 1JX6A 4EXSA 1NI4A 2NZYA 3BDIA 4F8CB 4ANWA 4QRIA 3K2BA 1H3FA 4H1HA 4M0WA 2WIBA 3NYQA 2A6PA 4WJLA 4LYAA 5IW8A 1GCOA 1D2CA 4MVJE 5CEFA 4TX1A 1RI5A 2PLWA 4V2IA 2RAUA 4TV8A 3TLCA 1E5TA 4ES6A 1W34A 4TKMA 1XDUA 4KGZA 4RLFA 3WLIA 3D6TB 1OTXA 4MVCA 1TJNA 4MPRA 5ALJA 5LBIA 4OXNA 2PFGA 5EIHA 3JPYA 3JWIA 4ZDIA 4QDXA 3K5HA 3NX4A 5FI0B 2O6VB 4GSKA 3QNWA 2WPDA 2WHIA 3JTEA 2DOKA 4PFQA 3DBHA 2RGGA 3F6SA 3EZ9A 1SBYA 5KJ1A 3IHWA 1AU9A 1ND5A 1QIKA 2IHYA 4ZCQA 4ZVTA 4OZAA 5CUQA 1E0SA 3DXXA 3RC1A 2MSEB 1UPTA 3KPVA 4ZI7F 3RUIB 3TB6A 1KYTA 1DS6A 4D1UA 3H9EO 1DSSG 1UD7A 5LQNA 4DOMA 1GJRA 1L5WA 2FPPB 5HWSA 1R9NA 4I36A 1UC8A 4NBUA 5FO0A 3RLIA 3L8HA 3NDRA 1OB5A 1P0QA 3Q85A 4MW2A 1DZ3A 1OY1A 4BFSA 1TD9A 2QX9A 4TZKA 5TB5A 3OCZA 1RM3A 2H65A 1C3OB 3WL7A 3DMTA 1XKTA 5TMEA 5AOCA 4HGRA 4JKOA 3I61A 1JFVA 2P3SA 4M1ZA 3EDOA 4E13A 1TZJA 1C4XA 3O94A 4XDYA 4C7VA 4XGKA 2EDAA 4ZVPA 1M1XB 2C03A 3GW8A 1CF2O 5HKKA 4HVLA 4ALLA 4PZLA 5FR6A 4C1EA 3KYDA 2M98A 1IBXB 1F0PA 2DX5B 2Z2XA 2C3PA 2IEGA 2C58A 3BBPA 3DL7A 2V3PA 2W8BA 4ALNA 4EKUA 2DLBA 3U4AA 4G25A 4RPHA 3JSAA 3CT4A 2R6AA 3UBMA 2FSVA 3NH9A 4Z8XA 3LFTA 4INZA 3K1AA 4FDAA 4M4SA 1BE0A 4UEJA 1I6WA 3BTVA 3IRVA 4M0KA 1R10A 3OEHA 3QIJA 1VYTA 3F49S 2WJJA 1IQUA 2QUAA 2J5KA 4CPDA 2LGYA 2FEKA 3B3AA 4Z4FA 1YSCA 4OHOA 4H6XA 2WHPA 1U0HC 3CLRD 3L0DA 5KNDA 1UF0A 4X60A 2WZCA 4GVXA 5FD8A 5IO9A 4XLLA 3QEMA 4NAUA 3A3OA 1A4IA 3E9SA 3ZZNA 1ZK4A 2I6TA 4PRZA 4YRDA 1W9HA 3IHLA 3JY6A 1GVNB 1LDMA 5C81A 1USKA 1RQGA 2P3OA 2X3YA 2ZR7A 2PMDA 4JAVC 3I6BA 1Q16A 2DTEA 2EEPA 2X19A 2G5CA 3KFLA 4NEQA 5DVZA 1MT0A 1N2SA 3U8ZA 4TZTA 1ENOA 4MRAA 4ZRJA 2VI5A 4FN2A 1R9JA 1SXPA 1SOAA 3I23A 4RAMA 4O8CA 4XWWA 3RM3A 3M9XA 4Q9JA 4F72A 2I2FA 5F4ZA 1URPA 2IXFA 3WWEA 2OXTA 4OQPA 4TV8B 4KVGA 6LDHA 4YLEA 4DSTA 3ZLZA 4RTKA 4YJ3A 3VR5H 4EGJA 2IYOA 2FF5A 5EIXA 1E79A 2OPBA 4IDAA 4I3GA 2EL7A 1ZM7A 1Z7WA 1NV8A 5B1EA 2V3CC 5BT9A 3KU4A 1RWBA 3AFIA 4B3IA 1F8YA 4ZXPA 5K6AC 2C5LC 1PYDA 2LKCA 5EL0A 4GE3A 3SX0A 4UWOB 3QK0A 5HHTA 2DUWA 1ZL0A 4AJ1A 4MR7A 1R4AA 2VRBA 4EZJA 2BR3A 1GXSA 4II2A 4P7IA 3W5AA 2J46A 4DV1B 3B1WA 3WMEA 3T35A 3WMFA 1ZXIA 5IKXA 1DG9A 2QV7A 2Y1LA 3EMKA 4BJ3A 2JAQA 3BREA 2FRDA 3NANA 2XNDA 4QFBA 1SCJA 3VNAA 1ES9A 2QNIA 2MCNB 3GVXA 4DQLA 1OXXK 2ZXFA 3X23A 1RVV1 3F4LA 1J5XA 4TMVA 1QANA 3AJ3A 5EJFA 2BGLA 3NS8A 4O1HA 4R1QA 1GPJA 5LOVA 4QDZA 3D7RA 4UDOA 3GFOA 5CFNA 3FKQA 5AVRA 5F4BA 2OV2A 1S89A 4CI0B 1QOQB 3C3AA 4HX9A 1QP4A 2Q29A 1FXUA 2C8KA 2RGUA 4YASA 3JVIA 1UXHA 3ORHA 1B0ZA 1JG1A 1E3DA 2WU5B 1J2EA 4GXQA 2N42A 1U1DA 3H16A 4TL6A 3KJZA 1L1EA 1T4MA 3V2HA 2J7QB 2ZCUA 4GWLA 2QENA 4UE6A 1Y3FE 3S2AA 4DCMA 1D1SA 4F6LA 1U0SY 3VSBA 4KLNA 2XZDA 1RAXA 2YNUA 3KYDB 9MHTA 4Z2AA 1IBKB 1S4QA 2R7NA 3B89A 5AXRA 3SJ7A 1J7BA 1FPQA 5IJZA 4NRDA 3MINA 5CFQA 3IKMB 2WM2A 2ZYVX 1VG8A 2FVXA 2AJ8A 2G7MC 2VWPA 1RIIA 2IPXA 5DX0A 1G5HA 1NVMB 2LRHA 2FPUA 3SD9A 3JARA 2ADMA 4G1FA 4CF4A 2CC2A 4RACA 3GT0A 2JIOA 3B1LX 2ATEA 5DHAA 2AQ8A 5KREA 3AVXA 4OBBA 2XBLA 1GQRA 4O98A 2ZI4A 3DVQX 2G25A 2FP3A 2W93A 2Z8XA 1J0CA 3O3NB 1JNXX 2A9PA 3BC2A 3N8KA 1A95A 3I5UA 3IDSA 2WMYA 4U2FA 4IWOA 1QKKA 3PXBA 3UHPA 4XIFA 1OI2A 3RG2A 4MYUA 3H7IA 1SULA 4KR6A 1E9BA 2XVAA 3CA8A 3WOHA 4HEHA 1NUHA 3I9V1 2GTIA 3LC1O 1ZZGA 3P0EA 3Q8WA 4JMLA 3DZDA 4JUIA 5TPZA 3GUUA 1A0OA 1K6XA 4NBLA 4YMTA 2VYFA 4M0FA 1F5NA 1A9XA 2H0RA 4XFKA 3WB1A 2J7KA 5C23A 2QG9A 4QPCA 2F67A 4F96A 4DV0B 5JBNA 3BIFA 1LBTA 4BY9E 2JLAA 1YE5A 4FFBA 3V4FA 5C8YF 2PT6A 1YDMA 3DGFC 2QN7A 3EZNA 4ON9A 3UJ7A 3QVSA 3HRHA 4D8TA 5AKLA 3D1JA 2Z83A 4YJ3B 1OX4A 3F7MA 2PLRA 1BUIC 3U7RA 3VPEA 3A2MA 4EF4A 3HFSA 2FPSA 1MQOA 4BN0A 4W9EA 4BQFA 1N61A 2EWVA 2VF7A 3M4YA 3HPQA 1NVVR 3JQBA 5IBCA 2F3RA 3O8NA 4MR7B 1GFSA 5HJ5A 1M5UA 3M5CA 2N9UA 2NCNA 2EZ8A 2J4DA 3I37X 4J1NA 2WFLA 1IY8A 4NFYA 4G1MB 2WU4A 5IJXA 4C0SA 1XLOA 1PEAA 3QLUC 4XYCA 1Q12A 1DXYA 1BHQ1 4U39A 1TJEA 4K7UA 5JH7B 2W6IA 3TZLA 1ZR2A 5CTRC 2IX9A 3EGIA 2JZZA 2YNMC 2AW5A 4J7AA 4BMSA 4M7OA 4JDPA 4ZRNA 4V0HA 2C5FA 5IHXA 2IE8A 1QZEA 4NQ6A 4LSGA 4X0EA 3OZIA 5DNYB 3AEZA 3AE8B 3VVWB 4WWMA 3ZHTA 4E74A 1FLVA 2N7EA 2NZ8A 3F90A 1E9EA 1KU0A 2BG6A 1EFLA 4EHFA 1ZD5A 4JX8A 3DNPA 2XQFA 4DM3A 3HB9A 4CNQA 2ZRNA 1MQSA 2ZZPB 5LVAA 2UZAA 4HB3A 4R2LA 2G08A 1AUQA 4UW9A 2IT1A 5E4JA 1OILA 1KZGB 2H0QA 2H0AA 4Q4HB 2IP2A 1WE2A 3QBJA 2OO3A 4B3HA 1Q6YA 5FRDA 1CUGA 4J0GA 1MEJA 3UANA 1J2TA 3KQVA 5HR5A 2BGAA 1TA4A 3IVRA 5IUKC 1P2SA 1LXDA 1Q15A 1Z5SB 3LVQE 5D01A 1EVLA 1R9GA 2CHVA 1FYDA 3VAYA 2VSFA 1QQBA 4L0CA 3QARA 2G1KA 4BX3A 4R40A 4J16A 2DE0X 1AZLA 1XXHB 4KN8A 3F6RA 1JG4A 3MWEB 1L5HB 3MFQA 3KU1A 4MLCA 3G1WA 4DCJA 4BWFB 1CU1A 3N2NA 1B4DA 5A9SB 2ZDGA 1HT2E 4IDGA 3QFCA 2X41A 4UA4A 1MA3A 3OM8A 4K3CA 3SZ3A 4W6ZA 5A6SA 3P26A 4WFQA 5D6NA 2AZXA 5ICFA 5H4GA 5HTKA 3C8UA 3ZEIA 1L5PA 3PXAA 1XEXA 2CV2A 3RTDA 1K0UA 4QUBA 3RI3A 4Y1FA 4EUSA 1DPGA 4DZRA 4EYOA 1OHHA 2ZBFA 4BO6A 1EP3B 3AJRA 4ZO7A 4HXFB 2EJWA 2HMSA 1NBOA 1E1NA 5TF0A 5FWAA 5MFPA 2R8ZA 3BFVA 2ZZKA 2VBGA 5KNCD 3A1VA 1J20A 2P9CA 3D6MA 1EG2A 4M0PA 4LJ6A 4CLEA 3OTHA 3WWCA 2DAJA 2UV8A 4TN5A 4FFBB 3P8ZA 4OQXA 4UNPA 1T3QA 1XXGA 3ZTYA 2Q07A 4N5IX 4B3MB 1WXFA 4F6CA 3H2SA 3ZCQA 4C4XA 2FEOA 4M8MA 5KVQA 2IZOA 1OX4B 2VUUA 3MC0B 3I13A 4XX1A 4IYRA 3TECE 2JHCA 1X1SA 3ZE0B 3EPPA 5H02A 3K0CA 3EH1A 2QY9A 5BNZA 2ZS9A 4JC8A 1KEVA 2A5YB 1UOEA 4KH1A 4Q4AA 1Z35A 2HUPA 3R3SA 2BR5A 4C6SA 1ZPDA 1ACJA 4B73A 5KYXA 1WWKA 4HN2A 4ZCTA 1NIJA 1UZLA 3N8NA 1LLUA 2WV7A 1WXDA 4JUFA 5FBZA 1TQ6A 4B71A 4XYMA 1L0VB 1SH7A 1W4LA 3RULA 4DHZE 5B2FA 2IELA 1P29A 3BH0A 4MA4A 2C2HA 2G40A 5JMOA 4C3UA 4R2IA 3UG7A 1Z6YA 2GX6A 1GO2A 5DM4A 13PKA 3V1YA 4C7BA 4Y9UA 4ER6A 4U63A 5A03A 3TCNA 4BX8A 2B21A 4OMCA 3N2LA 4JVOA 1ID1A 3SQOA 1GTRA 3ZC3A 3K8YA 1FDIA 3H75A 3NHPA 3W1VA 3I8XA 1PGBA 2W83A 1PE0A 3P94A 2OD7A 4JCOA 1C3XA 2GK3A 3D43A 1IEWA 3E8SA 1PCXA 3ED5A 2FPLA 2RHOA 4MAAA 4OA5A 2WVGA 3OWOA 4Y6GB 2FUKA 1L4MA 3I5YA 4BNKA 1UFQA 1E4OA 3FYCA 3V7UA 5T6MA 3AEAB 3PKJA 2QBYB 1JXAA 4IOMA 3IG3A 4MS3A 2PD6A 5JY1A 4J9UE 3GRYA 4WJNA 5BNFA 1GRNA 1DC8A 1ZJ6A 1TK9A 1GL3A 1F1BA 2Q5WD 3N7AA 5ALFA 3FKSD 4EI2A 4MICA 4M02A 3P2JA 4ARUA 3SHQA 2ZTVA 2C92A 4A6XA 2JZPA 3TX6A 1M9NA 2XWBF 1S0UA 2WW8A 2YN2A 3PQFA 2ZBEA 3MOSA 2XZOA 2OD9A 2KWVB 1P9OA 2PUHA 3UMCA 1KBZA 2BVNA 4PLYA 3OJ0A 4EQ6B 2UVPB 3H4VA 2R5WA 1L7XA 1U63A 5IKCM 2MBHA 1KPHA 3K09A 3ANYB 1TS4A 3RYHB 4HPMB 3Q8AA 3OM9A 1FM0D 3D2BA 2QMTA 3EQ9A 1GT6A 3DQVA 3GLSA 3ZD9A 4UARA 1XEXB 1V1PA 4CEIA 1O0BA 4IIDA 4NYIQ 4PR0A 3PRKE 3U62A 2Q4DA 3FYTA 4B6SA 1I7QB 3RC2A 1Z4MA 4KFUA 5ENVA 5JTTA 1O97C 2O19A 3RFUA 4J75A 4KYIB 4I9HA 3AR4A 1F14A 2OY0A 1C30A 2PH7A 3NKFA 1H9BA 1B14A 2M56B 4MQ6A 4HXDA 4NCNA 3NVYA 2HJVA 3MLAA 2Z1DA 2YFYA 4CEJA 4HVBA 1C4AA 1ZMTA 4BNWA 3U09A 4MPDA 1ZWLA 5LNK6 4TLDA 5EJ8A 3GGJA 3BZBA 4JJZA 2ZVNA 4B6FA 5LBTA 1OWLA 5IC5A 1EJBA 1BVTA 4RELA 2UZ0A 5BN1A 1KBQA 1HTTA 1OXTA 4OXYA 2OFWA 3MCWA 2O8BB 4QBFA 4EDFA 1DO8A 4S0RA 2HJSA 4JJ8A 3KR2A 2OXEA 3HJFA 1MJGA 3B5JA 5KYXB 1ZHOA 2G88A 3OTOB 4C0HA 4W5OA 4PRLA 4FBJB 1C9MA 3JCZA 5DN9A 3EEYA 4DJJA 1UZMA 4B0PA 4CIBA 2BQQA 1IEVA 1M73E 4Z7OB 1YA8A 1NMSA 3K96A 5LJIA 3WICA 3S6JA 4FYHA 3EVBA 1JSXA 2GNOA 2K5UA 4HXEB 4RKWA 4JKYA 3EIQA 2CNWA 4PZ0A 4DQXA 4HSEA 2NZEA 3N75A 2CD9A 4PHFA 2HX1A 3B6KA 5EUCA 4TLMB 4C7XA 4JQYA 4AURA 3FSEA 1Z4OA 5CK4A 2HMVA 4MDHA 4P36A 1M74A 2D0PB 4YRMA 3TQFA 4BV2A 2QVBA 3GFQA 1NW8A 2Y5CA 2QW1A 1NUQA 1WMHA 1JVSA 1WY7A 3RFVA 2YW2A 2ZKIA 3CGWA 3TZQA 1QONA 4RJ2A 3DZBA 1SIWA 1JLRA 4Y7CA 3UH0A 2GAJA 1RLJA 1LZLA 4JNCA 2FUG1 4TTPA 3I5JC 2ATVA 3HUTA 2IY7A 2YVLA 1JR3A 4F45A 4ZOLF 4BOZB 4K1XA 2AZMA 2AQIA 2PZJA 2VN8A 1L7OA 3U3MA 1OFHA 1IUKA 1JXQA 3DKVA 4F5ZA 4ZAZA 3B13B 3L7KA 3COYA 3I39X 2R1TA 2O7SA 2CXOA 3GFSA 4BL5A 4PG7A 1YE3A 4KGVA 5CIQA 1MPTA 1AB6A 4OK6A 3O0TA 4GOMD 2G45B 3LMKA 2VDQB 5ICCA 2KW5A 4ZJPA 1QGUA 2BGTA 4MOWA 1ODSA 4DABA 4NTZA 2PRIA 3BE8A 2VJPA 4BO3A 3OOEA 2VHTA 3NAGA 2BHNA 2XTZA 3K2EA 3L8EA 3WDMA 3BM5A 2BUBA 2LASA 4OKSA 3A9VA 1ORVA 3HJAA 2ZIGA 1Z9BA 2AXPA 3IVXA 1WVMA 3DVGX 1M2GA 4AUMA 5F7ZA 3ETNA 1GG3A 1QG0A 3N8GA 3P71T 5HIPA 3BGIA 4DLRA 4C7ZA 2OP1A 3B1JA 4F06A 1E3IA 1V1PB 1P1AA 1NVAA 4CEIB 1VRAB 5B4TA 1MHHE 3BD8A 2Y87A 2QPAA 2OK8A 4H1UA 3QU5A 4QYMA 1ZMOA 1EXVA 4WWPA 3GVIA 4M36A 3GWGA 1TGYA 1JFTA 2QW8A 3PGLA 4FHZA 1ENZA 3AY6A 2ZP1A 1AQYA 3GFVA 3LDZE 2PUTA 4RF0A 3B6JA 3H5RA 1VIYA 1KM7A 3LGXA 1CQJA 5TSSA 3UA3A 5BSWA 4H08A 4Z9YA 2QTZA 3GS2A 2HLDD 3U3DA 1KZ4A 2GPAA 2JFQA 1CD5A 3ZHSA 3ZWQA 3RS7A 1KDPA 5K03A 4JLCA 3AI3A 5J5AA 4M8SA 3A2NA 4ASUD 1TD1A 3TGLA 1E9VA 3SBOA 4KFSA 5LM3A 1SPBS 1H5QA 3EY4A 1LK5A 3AU5A 3CJRA 5IN5A 4BQPA 5BWMA 3EVEA 2PCJA 3LUGA 1D2GA 4W7HA 3Q1KA 4OJTA 5J59A 4MHSA 2WE7A 1SBHA 3AUUA 5AZFA 1OEYA 2WB4A 4BV9A 5CLLA 1JZTA 1OBVA 2AMFA 1RVDA 2DLNA 2VXBA 1TBEA 4FFLA 4OSEA 1V49A 4MUNA 2A9VA 2DXIA 1E3EA 4LJKA 2CGEA 2GF0A 4JC5A 5HH5A 2FWBA 4X7PA 1G1AA 3H7SA 7ADHA 1VPDA 3AU8A 4UTOA 3FHOA 1QRSA 3P9KA 1ZITA 4I8IA 2QL9A 3MT9A 3IDQA 4E6PA 1Y8RA 2D13A 5LDGA 4X7RA 4M1EA 3ZDZB 4O6VA 3H6NA 4OD0A 4FFDA 3NHEB 4LXXA 2D0OB 3ETLA 1UKYA 4L51A 3LE8A 2C2MA 3AR5A 2WYQA 3FPCA 1HQYE 1CY7A 3PEVA 1CR2A 3SJCA 1A2OA 1A88A 5EP3A 1SGWA 3QZUA 3U4QA 1Z22A 4NOMA 4HJRA 4TKVA 4UBNA 2YNWA 4HTFA 4BKMA 5C31A 4QTYA 3OG9A 1FIQA 1DQYA 2CKHB 2XRMA 1DX9A 7GPBA 2R1TB 2XIJA 1M1YA 2OTCA 1WSDA 1VCIA 1NQOA 4LJAA 3L77A 1CB7A 3V4ZA 3PD7A 1OLSA 1IY0A 3TRJA 4RL2A 3FUWA 1QGUB 3RVOA 2V4UA 3L40A 3SYKA 3HVHA 3O8OB 4NF2A 6AT1A 3HO6A 1MPEA 1USUA 1GSIA 4HB4A 3MTQA 4IDDA 3I45A 5GJCA 3WV4A 3JQRA 1E6KA 1D6NA 1WXSA 2VK1A 1FBTA 4E21A 1OX5A 4Z4QA 3ZXXA 4FSXA 4YDSA 2BN4A 3LW7A 2D5BA 1ZZEA 4DMFA 2HYIC 3ZQ4A 4KREA 1CUIA 3WIUA 2Z58A 4BJ6A 2ZG6A 1QRDA 3ZHCA 1UQRA 3Q7EA 4FWBA 3D9QX 5D87A 221PA 2UYYA 3N05A 3ZW3A 2ENUA 3AXSA 1S9DA 3U4IA 3I9LA 1DAEA 3CUEF 5ELXA 4MUYA 4S17A 3WR5A 1PJSA 1OXUA 1GLNA 1N5LA 3N9YC 3M3PA 3TOXA 5G41A 3GPLA 4UHCA 2H2FA 5DHRA 3L4BA 1X13A 3IC5A 3F4KA 3JYNA 1BN6A 1KLGD 5CB4A 1P4JA 5FOWA 2I2XB 4KNYA 5P8WA 4HAXA 1N2IA 1SHLA 4UZEA 4XH9B 1FX1A 4MQ5A 4IIXA 5TSDA 1UP4A 1Y4ZA 1DUIA 1PUIA 1ZC3A 3NHLA 1Y5IA 2R44A 1EQAA 3KHKA 4GYKA 5I9TA 4COKA 2CJYA 3O2JA 1CNEA 3QKTA 2AQHA 3SFEB 5IRCD 1C1DA 4MAMA 1WPGA 3INNA 2CJOA 1FDOA 4QTZA 4XQCA 4ADSG 3R75A 1MW9X 4I6PA 3ZCVA 1M2OB 2XB8A 4DHEA 1J7AA 4X84A 1G7TA 1ZNYA 2PGJA 2XMCA 3OE1A 1TK3A 4L4RA 2BFWA 3R6TA 4IM3A 4IPTA 4V39A 3WIOA 1PK8A 3DDHA 3R9IA 2BJVA 2XMBA 3RBAA 4EFKA 4ER7A 2QJSA 4B34A 5C3UA 3R7QA 4ROSA 4MGYE 1SUBA 3IQDB 4CGYA 3B51X 1LGYA 3C4JA 4RULA 1SHZA 4GH5A 1H0SA 2IVZA 1ODFA 4HS4A 4LHWA 2XKAA 3DMNA 1GG9A 1OYOA 3HXPA 3WLEA 3S2GA 5ITWA 4DCTA 1QMPA 3K35A 2DFDA 5C3MA 4ZHOA 2Q9CA 4RGNA 2WU8A 3MIZA 1KZ6A 3UQAA 121PA 3THXB 2UUPA 5A4JA 2C4NA 2I6XA 1YASA 4ZMSA 1ZHHA 3IA7A 2DULA 5AXBA 3THSA 1AHHA 1V9LA 2ECKA 3A1TA 3H4MA 5BOSB 3OPVA 4M46A 1GC6A 2I4OA 4TKVB 4K6OA 4ZC1A 4HTFB 2UWQA 1GPDG 1PL0A 3QC8B 3DEZA 1JAYA 4UZFA 4GPD1 1YR6A 3DVAA 1M2VB 3RTGA 1ZTCA 3D1VA 3EW7A 2ECQA 1KI9A 1XYGA 1WZCA 5JAUA 1XPOA 1GPBA 2NO9A 3EE6A 3ZU6A 2OFFA 2MT9A 4ZXFA 4MV7A 3OIVA 4PPGA 4A0GA 1KI4A 1XSEA 1WHSB 3TSSA 1N5XA 1XK6A 3U2SC 3NVZA 2PIAA 1XZNA 3MQ2A 1TRHA 2GDZA 2X5XA 1ZC4A 4IOKA 2DZJA 1D04A 1PVVA 5JEDA 3MA0A 2NVUB 3TCXB 2XYGA 3RVLA 2B8JA 5FBKA 1DOAA 2KMLA 2XT9A 3OPMA 3ZHYA 1VR9A 3RSFA 1NI2A 2IYDB 3CPJB 4Q7MB 2X2EA 3KKPA 4Q02A 3DFMA 2BRUC 1DAMA 3L6BA 3HCDA 4GN1A 1GPLA 1KQOA 2DFPA 1WDLA 2JKVA 4XIGS 5B7GA 4EH1A 3DMDA 4L72A 1YB1A 2ZE8A 5DYNA 3L7NA 2AJBA 1P0MA 4HBZA 2ZBDA 2B3TA 5IVIA 3GFRA 3WJ7A 3LHDA 3TLAA 4BE4A 2Q1TA 3E8XA 4YB8A 3HDTA 2D4AA 1PFVA 1N62A 1Y9ZA 4RVGA 1QVRA 1TCBA 3C4VA 3EHEA 3Q0TA 3SR3A 5D3MA 1M0SA 4Y2SA 4WOBA 1XCGB 3G2NA 1PV2A 1Z73A 2PUFA 4AMZA 3UH1A 1EX1A 4BGEA 5CLQA 1Q2UA 3KRTA 1AO3A 4NZOA 4PIVA 1O89A 1CQPA 5L95C 4F6ZA 2Q9UA 2ANCA 3GHYA 3E7WA 3VYSB 5LU8A 1E61A 4MZDA 5KB3A 2DY1A 1AM4D 2FZGA 1EVYA 4WWNA 2X0IA 3H5NA 2B1JA 5FYDA 3VAZA 5LJLA 4ND6A 2V0GA 4WY5A 1J8QA 2N75A 1JNYA 3T3EA 3VDMA 3IIEA 1Z6GA 1JXMA 2V3VA 1L5OA 3AGPA 2O0LA 1WLYA 1AUPA 1ZJ4A 3T3GA 3TNLA 5LNK1 1VJTA 3JSVA 4LJ7A 4N9WA 4TQGA 1BXKA 1XD2A 2FF7A 2BMDA 1R4MB 4FQ8A 5THXA 1MA0A 2REXA 1W30A 4R68A 3NYIA 2M32A 5L83A 4FFVA 2LUMA 1QZUA 5TJHA 2IHTA 2HJWA 2VF2A 2CXTA 3I9V6 4X1IB 2OLKA 2DLCX 1B2RA 3PITA 5AIAA 3ZZ1A 1M10A 4PT5A 1DT5A 2P6RA 5EIFA 5DT9A 2VLBA 4MGIE 1QBGA 3P2EA 1YHNA 1RQ7A 2ZJYA 5IT4A 4FIZA 4UU7A 3LA6A 1JS1X 3V00A 3L4KA 2F4NA 3BERA 3RNGC 4W99A 4BX2A 2FW9A 2IBTA 3LAWA 1BU8A 4J7XA 5F5XA 3L6CA 2QINA 3JTMA 3P2MA 1EWCA 4P3KA 1SD5A 4LVCA 2D2EA 4PIPA 2ERXA 3LLMA 3FUUA 1F17A 2O2DA 1T2UA 4BIIA 5DW0A 5CBKA 2Z5GA 3O8DA 1DVRA 4C0XA 1NDQA 4I6NB 5KU1A 1LY1A 2DZMA 3IOEA 2A30A 4Q18A 5HCIA 5EQJB 2IF2A 4RK0A 1XMVA 1OXMA 1BG6A 4KXQA 5DBIA 2I4LA 1MIOA 1OWPA 2Q5HA 2XTJA 1H2ZA 2ZW0A 4HC4A 2IEYA 3BORA 4WE3A 2XY4A 1RAEA 3CSUA 4LRYA 1YJ8A 4D45A 2J09A 5JW6A 2LFIA 3QEKA 5T67A 3P4UA 2X0JA 2VDJA 2A2ZA 1CP2A 3IRUA 4DDTA 1HQKA 1IWPB 5BSHA 4LRQA 3ANSA 1H8HA 2Q1XA 3I2JA 4G0YA 3VPGA 2W2TA 2D1RA 1B8PA 2I1VB 1HMPA 2EFHB 3SBLA 2O6VA 1HXYD 2ZDQA 5DJ5A 2W3SA 1IUOA 4RTJA 5CG2A 1SUPA 1NONA 3ZVVA 1YVPA 4IS3A 2ZT5A 2O2ZA 4R9RA 5EVDA 3GRFA 3KR1A 3L7OA 2YUTA 4RZ3A 4POAA 3PBKA 1FTGA 4N4AA 2VOEA 1QQ6A 5G3YA 1UXIA 2JFFA 1K8RA 5JU6A 3FYDA 1EX6A 4KDRA 5CX3A 1TZCA 1DEHA 1BRMA 1L5SA 2BFCA 2PWZA 2FPPA 2IKSA 3WKAA 5JNTA 1ZRMA 3JVUA 2OO5A 2P0YA 1NW5A 4NBSA 5D3MB 5ERGB 2QQ5A 5ICSA 3HBAA 3SHVA 2JGDB 5M7EA 1V2YA 2XF2A 5ARCA 1TMYA 2WXJA 1GKKA 2GYYA 3SF8A 2REQB 3AILA 4N7RA 3LUBA 3IAEA 5C35A 3SIWA 1MXHA 1C3OA 1QHIA 3A14A 1CEYA 2XUAA 3G49A 4C4PA 1AK1A 4IKGA 4K9PA 5J2TF 4Y30A 2O52A 3L2OB 2X1MA 4C4RA 1BYIA 1T5OA 2HU5A 2Z08A 5CVTA 1T1SA 2ONZA 1FC0A 4R31A 3BK7A 3UAZA 1NULA 1P9LA 3F1KA 3DOUA 2FPMA 4X1OA 3C3MA 3WNQA 2DR2A 5T8KA 5FL7D 3BPSA 1WUTA 3PXDA 1V16A 1VZ2A 5HZMA 5JANA 2OCDA 3TXXA 2R25B 5K0CA 1X8XA 3CSDA 1X1CA 4N49A 5JFTA 3LY8A 3D8RA 4HEQA 1RYYA 1XD2B 3LRPA 1NYQA 5K0EA 2REXB 3IOYA 2YL2A 3HA3A 1J9GA 5HUQA 2YVAA 3QMVA 1NA5A 5K05A 2PT7A 5ER6A 3OQ6A 1CRWG 4DCGA 2JFXA 4Z49A 3GQVA 4J03A 1Q7EA 1BHJA 5I45A 2E4WA 4WD6A 1A97A 4IJWA 1G21E 3A9SA 1RWSA 4UREA 1X8KA 2OR3A 2OGSA 2D2QA 2GHRA 1V7ZA 3E9RA 1PR0A 4URXR 5EVBA 3BGWA 1VG1A 2R8YA 1OAKA 5C53B 2EP8A 3A11A 4KQ6A 2D10A 1GUYA 3EFUA 2ZOSA 2JDID 1NRXA 2XT6A 3LCRA 1N8TA 3WL8A 1GTG1 1NFFA 1Y7IA 1A27A 4BO8A 1U8YA 1C1XA 1U28A 1R50A 2BW0A 2XNHA 4P6VF 4MR9A 3ELBA 5KWJA 1HNZB 2ZE5A 1Y3HA 3W2FA 1YNOA 3FGOA 3FMVA 3VR3A 2EIHA 1MIOB 4ASWC 5BN4B 3INRA 3PFBA 2J08A 5A4FS 2CMGA 3EUFA 4FGUA 4XOIA 2J7PD 3ZE8A 4PYQA 4IGEA 1XALA 1FQKA 1PZMA 5JPCA 4GKKB 4RJJA 2KQ4X 2G28A 1C0PA 1NJFA 2ZRIA 4ZJUA 1RLMA 3D4LA 4YT4A 2GJ4A 3W6PA 3P52A 3MYYA 1KZ9A 4EVRA 2CVOA 1ZVJA 5I4DA 5DEIA 3DKRA 1I4HA 4GOLD 3PJEA 4B45A 3F6YA 1PS8A 2R6R1 2MHCA 4J0CA 3H2JA 2KMMA 3E7PA 4XAQA 4OM8A 2G70A 4UUMA 2XX3A 3RHSA 3N6VA 3DMFA 2B4RO 1XTBA 5F3DA 1C7ZA 4KR3A 3EVTA 1KK0A 1II8B 4L02A 1W4ZA 1NQXA 4IIVA 5JSHA 4XASA 3FLAA 3AIOA 2R6DA 3WV5A 1Z16A 4X44A 3TD9A 1V35A 2GAAA 2IL1A 4YALA 3T1TA 4FW9A 5AM3A 4GQAA 4MV9A 4KAFA 1IZ7A 2HXGA 3ZD8A 2QQEA 1K8RB 4C87A 1G4AE 4MUJA 5K0FA 1JB1A 5FT9A 2VUTA 2BFCB 1NTRA 4I0WB 1WSWA 3NBXX 4DM7A 4PU0A 2HOQA 1REQA 2WB2A 4IUDS 1VLQA 2REBA 3CE6A 1PNOA 1SIFA 4ND4A 3SF8B 5CCBA 2I2BA 1YRAA 3ZD6A 1RFGE 1BCSA 3C6KA 1PAUA 4C56C 3KVOA 621PA 1ZXHA 2BKLA 5F76A 1UKVY 3RUFA 5SZKB 3UFBA 2BPSA 4HAIA 2HBQA 3B78A 1BS1A 1QO7A 3GLHB 2E6UX 4AF6A 1EBFA 1MV5A 3ML1A 3ZWOA 1V16B 3G23A 1G8MA 1UOOA 1EA5A 1K89A 3UJ6A 2CLLB 4DE5A 5IP5A 1KERA 2EBWA 1Z07A 1YA6A 2AXQA 4DLKA 3OIFA 5T4EA 3U0VA 1JVNA 1I0IA 5DTIA 2V7GA 3S2UA 2GXSA 1UXOA 3HXKA 1QXSA 4KFCA 1D9ZA 2OUIA 5EHZA 2CVQA 3QEJA 2SEBD 1RPJA 7MHTA 1UQUA 4EG6A 3SF0A 4PW0A 3V9PA 2WU3A 4IRXA 1XLVA 1WP4A 2VDPB 4P2GA 2CFZA 2Y4NA 3WKCA 2FLWA 2VHCA 4Z0PA 3NTLA 1RI4A 4D4GA 1U4OA 3T15A 2V1UA 1JIJA 2X2FA 3PHWB 5DMXA 4OUKX 3OTQA 1AMNA 2NZVG 5LMZA 4AJIA 1YIDA 1A8SA 4FB4A 3PWTA 1GP2A 4HPJB 5G0SA 5IASA 3GXBA 3E53A 1QFXA 3UV6A 2F62A 4GIVA 2V7VA 4H9GA 3U4GA 3WGOA 2HSJA 1C1XB 4CG1A 4ANFA 2CE7A 2FCSA 4EYEA 4CV0A 2AFHE 4MR9B 4PY2A 5GIPE 4FZJA 3QX7A 3NI2A 3IUYA 2W3RA 3E15A 3KSRA 2WAOA 3TBKA 2JASA 2IEDA 2WVHA 4MP3A 4N40A 3GFBA 3BF8A 5KNDH 1QQRA 1I3CA 2Q6KA 5J3JA 1N6KA 3SSMA 3H9GA 4ND1A 1R74A 5IT9A 1CV2A 3K9HA 2NPTB 3R3JA 2JPHA 1Q17A 1I2ZA 2ZJDA 4D3DA 3CX3A 3D8BA 1TTNA 1WO8A 2ST1A 5J5CA 2ZI6A 3K1YA 1NVKA 3R0QA 2WF6A 3JU3A 1SG9A 5JRZA 1GUAB 2QLMA 1WW2A 5KJEA 4OJQA 2YWXA 3CC8A 1L0YB 4U2CA 2QTRA 1YIWA 4HG2A 2F8SA 1JWBD 1N34B 2HWYA 3L3BA 1BDMA 3JQAA 1X3LA 2R8BA 1QAMA 2FUG6 4HX2A 3WNBA 4Q66C 5E1MA 1XQ6A 4JWKA 4CTKA 4E0BA 1YR1A 5D7NA 5TXGA 4BYGA 4QQNA 1WSPA 2LJ5A 4YSXB 4EY6A 5A2GA 3PUXA 2Z9BA 4LF4B 3RV3A 5C34B 3FBTA 2HA7A 5JH7A 4CO7A 4WZAE 5G40A 3CX7A 3CVUA 3GP7A 3AKDA 3AIIA 3DEYX 3TQHA 5IJ0B 1REQB 1JSRA 1RRFA 4CG2A 2QTBA 4PINA 1V1RB 3ABOB 3VJLA 4WXHA 2QD1A 4GBMA 2GOYA 1VP9A 3OZWA 1HORA 3U48A 3C48A 4K9QA 1BCSB 4R16A 1MDBA 4UAUA 2Z6VA 1F6WA 2Q2VA 4KGDA 4YGYA 3CLTD 3WRYC 4XWYA 1USIA 2J9ZB 3K92A 4P0PB 5HG0A 3PNSA 1T8TA 1TCAA 3KB8A 2EBHX 1PP4A 4YREA 4X62B 3IR5A 4Q4HA 1SKUA 3PLNA 2EMSA 5A3QA 2RI6A 1O95D 5U4QA 1O77A 2ZJ8A 2OXFA 5IK2D 2P7IA 3RANA 3ZK7A 1TM2A 3VDNB 3T3MB 4JIMA 3PEFA 1YZVA 2Z8YA 2ID8A 3HUEA 3ZBTA 2GAOA 2FJ0A 4H7IA 3DVGY 1KMNA 2B25A 3A9CA 3OKCA 3M63B 3PHIA 4DHJB 4ZQIA 3DE7X 1B93A 2PZLA 1LBEA 1XXHA 2YWGA 4W9JA 3HBLA 3MWEA 5DF1A 3MSXA 1L5HA 3LZ6A 4EY2A 1CK4A 4PLWA 2P6UA 3B2EA 2II6A 2M19A 3CZRA 5A9SA 1WMDA 5JXIA 4DUYB 4A26A 2QB5A 1AC5A 2KYWA 4O5OA 5K2MA 4YJHA 2MX2A 3W1WA 3TVTA 1EK0A 4CGZA 4NQ4A 4ID9A 3L0CA 1WM1A 1XZBA 1VLMA 2PKQO 3RGGA 1T91A 5CT9A 3BXEA 3AE3B 1WETA 1I36A 2C5EA 3SEFA 1L7MA 5EIBD 3ENVA 4RGVA 3NTOA 2YXDA 1B23P 2NMQA 3AUXA 1KJTA 1ESDA 2X15A 4PYLA 3AE6B 3EVZA 4CTOA 2R84A 2CHFA 4LY9A 4NK4A 1J22A 1XL1A 4P54A 2WAMA 5JJCA 5BMOA 5JROA 1A2KC 3SOPA 2VUIB 2XIQA 4AKHA 1QNLA 1V8BA 1Y6FA 4YDRA 2OSVA 4EP1A 2IV2X 4RW0A 2XUHA 4PVCA 1YUBA 2YMMA 1O03A 1WZEA 1KFBB 4K3UA 1Y9AA 4J3OD 1WUOA 1FNBA 4A03A 4KXLA 1PWXA 4JJFA 5IJWA 1FFDA 4C20A 1HWYA 2BAGA 2I1WA 2C5AA 1WZNA 1EH5A 3P0RA 3D8SA 4UTZA 3EHDA 5JBIA 2OQ2A 1JHXA 4GNKA 4UUQA 3NC1C 3TKAA 4ECEA 2JI6A 2BE7A 5H8WA 4B17A 1SB9A 4YO7A 3TIVA 1E1QA 2KC2A 1L5MA 3HO1A 1Z47A 3UGKA 4JQCA 1KJIA 3FE2A 3JQAB 3TRKA 5K8UA 5K3OA 4JVNA 1D2EA 4IDQA 1U8FO 4HYTA 4NENB 4XRGA 4P0QB 1XZGA 3DTTA 2Q0HA 4ZO9A 4BNVA 5BV7A 1Q0SA 4BP9A 5LU9A 3DOFA 3TMYA 5FWXA 2NU7A 2BI8A 4I50F 1LSOA 2FXVA 3QV2A 2KACA 4E12A 2ZEQA 2JBAB 4U3JA 4BKQA 1BSVA 3IESA 2RIRA 3FOWA 1E6CA 3PPAA 4TWAA 5KJFA 1WFYA 1XGKA 3U3ZA 2BE9A 4M22A 4TL7A 4N3BA 4R71A 3UJNA 2VDOB 4OKNA 3FR7A 1Z5GA 1CY8A 4QXAA 4KHPB 2FCAA 3PQ7A 3PEYA 2IIQA 1ZI8A 1IGCA 3CH7A 3MBOA 4H0FA 3N58A 5K01A 4AS1A 4P32A 3BF7A 3FCUB 3BUSA 4TXNA 4AIIA 3UMVA 5DHPA 2EQAA 3ZZ0A 2FRVA 1G38A 2QBYA 2VEOA 4C03A 2DSNA 1OZAA 3IP8A 1H2BA 1K27A 4RK5A 1CR6A 3TEMA 3HUDA 2RK4A 2UYGA 4L5IA 1OB2A 4Q7EA 3GY0A 3DD5A 5JYDA 5ACUA 3IJ5A 1ODCA 3GPDG 3C3EA 1TS2A 3RF7A 3FR8A 1AZTA 3FZNA 3NKVA 5D7BA 3JD3A 1R27A 4YSBA 1WPXA 4PDXA 4C43A 2H2AA 3WYCA 4ZGWA 3NHSA 3V8VA 3R40A 2HSZA 1VDZA 2ORWA 4FTWA 1ZN2A 3E1GA 4QUEA 4EQ6A 4US1R 1H6BA 3VXKA 1AVTA 2MMCA 4FJVB 2UVPA 1MCZA 2IHBA 1MMFB 3DFKA 4LAFA 3RU7A 1UGJA 2ZUFA 1JUDA 5LMNB 2FDXA 2PKRA 3RYHA 5ENZA 3GJRA 3AIMA 4YJHB 1JWLA 4BKOA 2FYTA 1UJ6A 2QDKA 1W35A 3V4SA 3CURA 4LWPA 1MGOA 4HWRA 1GL6A 4KMSA 1XJCA 4Q1VA 2GPTA 1T25A 4RIEA 4HNQA 2KDIA 1E77A 4JJ7A 1QM5A 4FJZA 4XDDA 1EHIA 2B2NA 5FJIA 3V8MA 4KQ2A 3HZHA 1OLOA 1TXGA 2XMPA 2JXXA 3N2GA 4PZAA 1MN6A 3R4VA 1XCJA 2M1MA 1KC3A 3KNSA 4LTMA 1I51A 5BR4A 3F4BA 5TLSA 3DEJA 3VBEA 3HCBA 1Z8DA 3WLHA 5JHBA 3L8FA 1OBHA 1ZCZA 4HJXA 3L4SO 1NL3A 2O8BA 5EP2A 4JO0A 2I67A 5U1PA 5JI2E 2O2JA 3CKKA 1JFRA 2JLBA 4OVZA 4Y0AA 4F3YA 4AY6A 4RVDA 1YQTA 4BE7B 5A7FA 3CRQA 3VJRA 2AZTA 4QQFA 3FOEC 3EIXA 5IXJA 1O4VA 2B76B 5KTMA 2OFXA 1OWNA 3G68A 4C29A 2KLGA 3W6ZA 3DO5A 3T4XA 1VMKA 5AI6A 5FWXB 1NPYA 1QV7A 2NU7B 2PZBA 5EJ5A 4L50A 3C7AA 3KAKA 4U3JB 4LNUA 3SR6A 2POCA 2ZT8A 3LPCA 1YB7A 5AI0A 4WLNA 5COAA 3R76A 3LYUA 3FPJA 4FI3C 3LCJA 2P40A 5DCUA 2EW1A 1VLZA 3BIXA 3ISVA 5L3SA 5FTKA 3E7DA 3NRJA 5DLDA 1U4NA 4J1TA 3CLKA 1V96A 2BBOA 3GCWA 3DTVA 3MPOA 5JAMA 3WA6A 3N2ZB 1M2JA 1P9DU 1LKZA 1O94D 1U3UA 1W5EA 5A5ZA 3RPCA 3RDPA 4YWJA 4A92A 2BGIA 4YRKA 1R8JA 2CNNA 1SQ5A 2K0PA 3O6VA 1PK9A 2AYYA 3OJCA 1U9YA 2CV0A 4WFIA 3ONWA 1P39A 3PUJA 3E3LA 2JEZA 1TYCA 1WG8A 2VHJA 4K0KB 1GB4A 3PNLA 1HETA 3HB5X 4TKNA 4ZPJA 3RNBC 2C4HA 1JKMA 4IWPA 2G06A 3ZI7A 3HM9A 3MS4A 5KTRA 3U49A 3FVWA 5AW8A