4P62A

Directed evolution of a b3 metallo-beta-lactamase aim-1
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
269
structure length
269
Chain Sequence
ASRGCADDAGWNDPAMPQKVYGNTWYVGTCGISALLVTSDAGHILVDAATPQAGPQILANIRALGFRPEDVRAIVLSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLPDRTDPQFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRSCEGDDCRQMVYADSLTAISDDVYRYSDDAAHPGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRIGPRAAAPLMDTTACRRYAQGARQRLEKRLAEEAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Directed evolution of a B3 metallo-beta-lactamase AIM-1
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords Metallo-beta-lactamase AIM-1
total genus 92
structure length 269
sequence length 269
ec nomenclature
pdb deposition date 2014-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4p62A00
1QH5A 3DHAA 2YNWA 4AX0B 3BV6A 4UBQA 3L6NA 2Q42A 1X8IA 2FHXA 5AHOA 2ZO4A 2OHJA 4FSBA 3ADRA 2OHHA 2BMIA 2I7VA 2NZFA 4C1EA 4UA4A 3X30A 4F6ZA 3BK1A 2YNVB 1QH3A 4Z60A 1E5DA 3FCZA 5LS3A 3SPUA 5EW0A 2WYLA 1WUPA 4O98A 5EV6A 3PY6A 4C1GA 3T9MA 4YSLA 2Q9UA 2BFLA 3AJ3A 3BC2A 2ZWRA 2GKLA 2WRSA 1BMCA 4Z7RA 4PVOA 2GFKA 2BGAA 3AF5A 2YNVA 4AWYB 1VGNA 2YZ3A 4UWSB 2NYPA 5EVKA 4C1CA 2Y8BA 5LM6A 2A7MA 3SBLA 4U4LA 2Y8AA 3IE0A 4HL1A 4Z67A 2QINA 1BVTA 3PY5A 4RL2A 4EY2A 5HH5A 2FU8A 3KNRA 5K0WA 4EYBA 3I0VA 4FEKA 5LMCA 3IOFA 4WD6A 4DIKA 4D1VA 5LLDA 5LCHA 2FU7A 2P4ZA 1X8GA 4RBSA 3IOGA 2P1EA 4XWWA 4JO0A 2P97A 1ZKPA 3IE2A 1SMLA 4EFZA 4NQ2A 1VMEA 1BC2A 2UYXA 2XR1A 1WW1A 2ZZIA 4H0DA 4TZEA 2BIBA 2P18A 4XWTA 5A0VA 3T3OA 4UAMA 5K4NA 1M2XA 2FHXB 3PG4A 4UWRB 4PVTA 1HLKA 5AYAA 2Y87A 1MQOA 1K07A 3DHCA 4GCWA 2BR6A 3WXCA 3SRXA 2QJSA 2BFKA 2AZ4A 3RPCA 2BG8A 3R2UA 1JT1A 2E7YA 4Z5YA 2M5DA 3LVZA 4J5HA 4D1TA 4NQ5A 3IEMA 4RL0A 5B1UA 3I15A 1VJNA 5A5ZA 3MD7A 2FU9A 5EHTA 4EYFA 5ACUA 4FR7A 4GYUA 4YSKA 2BG8B 4ZEJA 4TYTA 5A87A 2WYMC 4C1DA 1XTOA 5ACQA 3FAIA 3I11A 2AIOA 4ZNBA 4TZBA 1Y44A 5LCFA 3QH8A 3RKKA 2HB9A 4TZ9A 1KO3A 2R2DA 1JJTA 5HIQA 4D1UA 3ESHA 3KL7A 4EYLA 2QDSA 1YCGA 3ZNBA 2GMNA 5KILA 4D1WA 2WYMA 4HKYA 1X8HA 5AEBA 3ZWFA 4RM5A 3SD9A 4BP0A 2BG2A 5FQCA 4J5FA 1KO2A 2DOOA 2YNTA 4TYFA 1P9EA 3G1PA 2DKFA 4F6HA 2BFZA 4ZO3A 5ACPA 2Q0JA 1DD6A 5ACTA 3TP9A 2QDTA 3P2UA 2BC2A 4GYQA 4YSBA 1DXKA 1A8TA 2YNTB 4ZO2A 2NZEA 5LSCA 2CBNA 4UWPB 5ACRA 2VW8A 5ACVA 4HL2A 1WRAA 3SFPA 2BFZB 4RAMA 1YCFA 5HH4A 2BG7A 2YNUA 4Z6XA 1WUOA 2OHIA 3H3EA 5FQAA 5AXOA 5IQKA 5B3RA 5LE1A 3I14A 2GCUA 4EXYA 4Z5ZA 4B87A 5EVDA 3DHBA 3ZR9A 3KNSA 5ACWA 5AXRA 4AWZA 3IELA 4DILA 4TZFA 3F9OA 1L9YA 2GFJA 3A4YA 2FU6A 2FM6A 5B15A 5A0TA 4AX1B 2ZNBA 2XF4A 5ACXA 4P62A 4CHLA 5KIKA 5HIPA 2BTNA 5FQBA 4C1HA 2H6AA 4AD9A 4UWOB 4C1FA 4D02A 2QEDA 2BG6A 3X2XA 5DPXA 4BZ3A 3X2YA 5AHRA 4KEQA 3SW3A 1JJEA 3X2ZA 3I13A 3VPEA 1A7TA 1XM8A 3IE1A 5K4MA 3VQZA 4LE6A 5K4KA 3T3NA 5EVBA 3RKJA 2I7TA 4NQ6A 5ACSA 5HISA 1YCHA 4RAWA 5EH9A 3DH8A 4V0HA 2I7XA 3JXPA 5HIOA 3IDZA 2YCBA 3S0ZA 2Q0IA 4EXSA 3BK2A 3IEKA 2NXAA 5EV8A 3Q6VA 4C09A 4XUKA 3ZQ4A 4KEPA 2WHGA 3AF6A 2M5CA 1ZTCA 1ZNBA 2FK6A 1KR3A 4NQ4A 5HH6A 5LCAA 5EWAA 1DDKA
chains in the Genus database with same CATH superfamily
1QH5A 3DHAA 2YNWA 4AX0B 3BV6A 4UBQA 3L6NA 2Q42A 1X8IA 2FHXA 5AHOA 2ZO4A 2OHJA 4FSBA 3ADRA 2OHHA 2BMIA 2I7VA 2NZFA 4C1EA 4UA4A 3X30A 4F6ZA 3BK1A 2YNVB 1QH3A 4Z60A 1E5DA 3FCZA 5LS3A 3SPUA 5EW0A 2WYLA 1WUPA 4O98A 5EV6A 3PY6A 4C1GA 3T9MA 4YSLA 2Q9UA 2BFLA 3AJ3A 3BC2A 2ZWRA 2GKLA 2WRSA 1BMCA 4Z7RA 4PVOA 2GFKA 2BGAA 3AF5A 2YNVA 4AWYB 1VGNA 2YZ3A 4UWSB 2NYPA 5EVKA 4C1CA 2Y8BA 5LM6A 2A7MA 3SBLA 4U4LA 2Y8AA 3IE0A 4HL1A 4Z67A 2QINA 1BVTA 3PY5A 4RL2A 4EY2A 5HH5A 2FU8A 3KNRA 5K0WA 4EYBA 3I0VA 4FEKA 3IOFA 5LMCA 4WD6A 4DIKA 4D1VA 5LLDA 5LCHA 2FU7A 2P4ZA 1X8GA 4RBSA 3IOGA 2P1EA 4XWWA 4JO0A 2P97A 1ZKPA 3IE2A 1SMLA 4EFZA 4NQ2A 1VMEA 1BC2A 2UYXA 2XR1A 1WW1A 2ZZIA 4H0DA 4TZEA 2BIBA 2P18A 4XWTA 5A0VA 3T3OA 2CG3A 4UAMA 5K4NA 1M2XA 2FHXB 3PG4A 4UWRB 4PVTA 1HLKA 5AYAA 2Y87A 1MQOA 1K07A 3DHCA 4GCWA 2BR6A 3WXCA 3SRXA 2QJSA 2BFKA 2AZ4A 3RPCA 4AV7A 2BG8A 3R2UA 1JT1A 2E7YA 4Z5YA 2M5DA 3LVZA 4J5HA 4D1TA 2CFUA 4NQ5A 3IEMA 4RL0A 5B1UA 3I15A 1VJNA 5A5ZA 3MD7A 2FU9A 5EHTA 4EYFA 5ACUA 4FR7A 4GYUA 4YSKA 2BG8B 4ZEJA 4TYTA 5A87A 2WYMC 4C1DA 1XTOA 5ACQA 2CG2A 3FAIA 3I11A 2AIOA 4ZNBA 4TZBA 1Y44A 5LCFA 3QH8A 3RKKA 2HB9A 4TZ9A 1KO3A 2R2DA 1JJTA 5HIQA 4D1UA 3ESHA 3KL7A 4EYLA 2QDSA 1YCGA 3ZNBA 2GMNA 5KILA 4D1WA 2WYMA 4HKYA 1X8HA 5AEBA 3ZWFA 4PDXA 4RM5A 3SD9A 4BP0A 2BG2A 5FQCA 4J5FA 1KO2A 2DOOA 2YNTA 4TYFA 4NURA 1P9EA 3G1PA 2DKFA 4F6HA 2BFZA 4ZO3A 5ACPA 2Q0JA 1DD6A 5ACTA 3TP9A 2QDTA 3P2UA 2BC2A 4GYQA 4YSBA 1DXKA 1A8TA 2YNTB 4ZO2A 2NZEA 5LSCA 2CBNA 4UWPB 5ACRA 2VW8A 5ACVA 4HL2A 1WRAA 3SFPA 2BFZB 4RAMA 1YCFA 5HH4A 2BG7A 2YNUA 4Z6XA 1WUOA 2OHIA 3H3EA 5FQAA 5AXOA 5IQKA 5B3RA 5LE1A 3I14A 2GCUA 4EXYA 4Z5ZA 4B87A 5EVDA 3DHBA 5AJLA 3ZR9A 3KNSA 5ACWA 5AXRA 4AWZA 3IELA 4DILA 4TZFA 3F9OA 1L9YA 2GFJA 3A4YA 2FU6A 2FM6A 5B15A 5A0TA 4AX1B 2ZNBA 2XF4A 5ACXA 4P62A 4CHLA 5KIKA 5HIPA 2CFZA 2BTNA 5FQBA 4C1HA 2H6AA 4AD9A 4UWOB 4C1FA 4D02A 2QEDA 2BG6A 3X2XA 5DPXA 4BZ3A 3X2YA 5AHRA 4KEQA 3SW3A 1JJEA 3X2ZA 3I13A 3VPEA 1A7TA 1XM8A 3IE1A 5K4MA 3VQZA 2YHEA 4LE6A 5K4KA 3T3NA 5EVBA 3RKJA 2I7TA 4NQ6A 5ACSA 5HISA 4AXHA 1YCHA 4RAWA 5EH9A 3DH8A 4V0HA 2I7XA 3JXPA 5A23A 5HIOA 3IDZA 2YCBA 5AIJA 3S0ZA 2Q0IA 4EXSA 3BK2A 3IEKA 2NXAA 5EV8A 3Q6VA 4C09A 4XUKA 3ZQ4A 4KEPA 2WHGA 3AF6A 2M5CA 1ZTCA 1ZNBA 2FK6A 1KR3A 4NQ4A 5HH6A 5LCAA 5EWAA 1DDKA
chains in the Genus database with same CATH topology
1QH5A 3DHAA 2YNWA 4AX0B 3BV6A 4UBQA 3L6NA 2Q42A 1X8IA 2FHXA 5AHOA 2ZO4A 2OHJA 4FSBA 3ADRA 2OHHA 2BMIA 2I7VA 2NZFA 4C1EA 4UA4A 3X30A 4F6ZA 3BK1A 2YNVB 1QH3A 4Z60A 1E5DA 3FCZA 5LS3A 3SPUA 5EW0A 2WYLA 1WUPA 4O98A 5EV6A 3PY6A 4C1GA 3T9MA 4YSLA 2Q9UA 2BFLA 3AJ3A 3BC2A 2ZWRA 2GKLA 2WRSA 1BMCA 4Z7RA 4PVOA 2GFKA 2BGAA 3AF5A 2YNVA 4AWYB 1VGNA 2YZ3A 4UWSB 2NYPA 5EVKA 4C1CA 2Y8BA 5LM6A 2A7MA 3SBLA 4U4LA 2Y8AA 3IE0A 4HL1A 4Z67A 2QINA 1BVTA 3PY5A 4RL2A 4EY2A 5HH5A 2FU8A 3KNRA 5K0WA 4EYBA 3I0VA 4FEKA 5LMCA 3IOFA 4WD6A 4DIKA 4D1VA 5LLDA 5LCHA 2FU7A 2P4ZA 1X8GA 4RBSA 3IOGA 2P1EA 4XWWA 4JO0A 2P97A 1ZKPA 3IE2A 1SMLA 4EFZA 4NQ2A 1VMEA 1BC2A 2UYXA 2XR1A 1WW1A 2ZZIA 4H0DA 4TZEA 2BIBA 2P18A 4XWTA 5A0VA 3T3OA 4UAMA 5K4NA 1M2XA 2FHXB 3PG4A 4UWRB 4PVTA 1HLKA 5AYAA 2Y87A 1MQOA 1K07A 3DHCA 4GCWA 2BR6A 3WXCA 3SRXA 2QJSA 2BFKA 2AZ4A 3RPCA 2BG8A 3R2UA 1JT1A 2E7YA 4Z5YA 2M5DA 3LVZA 4J5HA 4D1TA 4NQ5A 3IEMA 4RL0A 5B1UA 3I15A 1VJNA 5A5ZA 3MD7A 2FU9A 5EHTA 4EYFA 5ACUA 4FR7A 4GYUA 4YSKA 2BG8B 4ZEJA 4TYTA 5A87A 2WYMC 4C1DA 1XTOA 5ACQA 3FAIA 3I11A 2AIOA 4ZNBA 4TZBA 1Y44A 5LCFA 3QH8A 3RKKA 2HB9A 4TZ9A 1KO3A 2R2DA 1JJTA 5HIQA 4D1UA 3ESHA 3KL7A 4EYLA 2QDSA 1YCGA 3ZNBA 2GMNA 5KILA 4D1WA 2WYMA 4HKYA 1X8HA 5AEBA 3ZWFA 4RM5A 3SD9A 4BP0A 2BG2A 5FQCA 4J5FA 1KO2A 2DOOA 2YNTA 4TYFA 1P9EA 3G1PA 2DKFA 4F6HA 2BFZA 4ZO3A 5ACPA 2Q0JA 1DD6A 5ACTA 3TP9A 2QDTA 3P2UA 2BC2A 4GYQA 4YSBA 1DXKA 1A8TA 2YNTB 4ZO2A 2NZEA 5LSCA 2CBNA 4UWPB 5ACRA 2VW8A 5ACVA 4HL2A 1WRAA 3SFPA 2BFZB 4RAMA 1YCFA 5HH4A 2BG7A 2YNUA 4Z6XA 1WUOA 2OHIA 3H3EA 5FQAA 5AXOA 5IQKA 5B3RA 5LE1A 3I14A 2GCUA 4EXYA 4Z5ZA 4B87A 5EVDA 3DHBA 3ZR9A 3KNSA 5ACWA 5AXRA 4AWZA 3IELA 4DILA 4TZFA 3F9OA 1L9YA 2GFJA 3A4YA 2FU6A 2FM6A 5B15A 5A0TA 4AX1B 2ZNBA 2XF4A 5ACXA 4P62A 4CHLA 5KIKA 5HIPA 2BTNA 5FQBA 4C1HA 2H6AA 4AD9A 4UWOB 4C1FA 4D02A 2QEDA 2BG6A 3X2XA 5DPXA 4BZ3A 3X2YA 5AHRA 4KEQA 3SW3A 1JJEA 3X2ZA 3I13A 3VPEA 1A7TA 1XM8A 3IE1A 5K4MA 3VQZA 4LE6A 5K4KA 3T3NA 5EVBA 3RKJA 2I7TA 4NQ6A 5ACSA 5HISA 1YCHA 4RAWA 5EH9A 3DH8A 4V0HA 2I7XA 3JXPA 5HIOA 3IDZA 2YCBA 3S0ZA 2Q0IA 4EXSA 3BK2A 3IEKA 2NXAA 5EV8A 3Q6VA 4C09A 4XUKA 3ZQ4A 4KEPA 2WHGA 3AF6A 2M5CA 1ZTCA 1ZNBA 2FK6A 1KR3A 4NQ4A 5HH6A 5LCAA 5EWAA 1DDKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QH5 A;  3DHA A;  2YNW A;  4AX0 B;  3BV6 A;  4UBQ A;  3L6N A;  2Q42 A;  1X8I A;  2FHX A;  5AHO A;  2ZO4 A;  2OHJ A;  4FSB A;  3ADR A;  2OHH A;  2BMI A;  2I7V A;  2NZF A;  4C1E A;  4UA4 A;  3X30 A;  4F6Z A;  3BK1 A;  2YNV B;  1QH3 A;  4Z60 A;  1E5D A;  3FCZ A;  5LS3 A;  3SPU A;  5EW0 A;  2WYL A;  1WUP A;  4O98 A;  5EV6 A;  3PY6 A;  4C1G A;  3T9M A;  4YSL A;  2Q9U A;  2BFL A;  3AJ3 A;  3BC2 A;  2ZWR A;  2GKL A;  2WRS A;  1BMC A;  4Z7R A;  4PVO A;  2GFK A;  2BGA A;  3AF5 A;  2YNV A;  4AWY B;  1VGN A;  2YZ3 A;  4UWS B;  2NYP A;  5EVK A;  4C1C A;  2Y8B A;  5LM6 A;  2A7M A;  3SBL A;  4U4L A;  2Y8A A;  3IE0 A;  4HL1 A;  4Z67 A;  2QIN A;  1BVT A;  3PY5 A;  4RL2 A;  4EY2 A;  5HH5 A;  2FU8 A;  3KNR A;  5K0W A;  4EYB A;  3I0V A;  4FEK A;  5LMC A;  3IOF A;  4WD6 A;  4DIK A;  4D1V A;  5LLD A;  5LCH A;  2FU7 A;  2P4Z A;  1X8G A;  4RBS A;  3IOG A;  2P1E A;  4XWW A;  4JO0 A;  2P97 A;  1ZKP A;  3IE2 A;  1SML A;  4EFZ A;  4NQ2 A;  1VME A;  1BC2 A;  2UYX A;  2XR1 A;  1WW1 A;  2ZZI A;  4H0D A;  4TZE A;  2BIB A;  2P18 A;  4XWT A;  5A0V A;  3T3O A;  4UAM A;  5K4N A;  1M2X A;  2FHX B;  3PG4 A;  4UWR B;  4PVT A;  1HLK A;  5AYA A;  2Y87 A;  1MQO A;  1K07 A;  3DHC A;  4GCW A;  2BR6 A;  3WXC A;  3SRX A;  2QJS A;  2BFK A;  2AZ4 A;  3RPC A;  2BG8 A;  3R2U A;  1JT1 A;  2E7Y A;  4Z5Y A;  2M5D A;  3LVZ A;  4J5H A;  4D1T A;  4NQ5 A;  3IEM A;  4RL0 A;  5B1U A;  3I15 A;  1VJN A;  5A5Z A;  3MD7 A;  2FU9 A;  5EHT A;  4EYF A;  5ACU A;  4FR7 A;  4GYU A;  4YSK A;  2BG8 B;  4ZEJ A;  4TYT A;  5A87 A;  2WYM C;  4C1D A;  1XTO A;  5ACQ A;  3FAI A;  3I11 A;  2AIO A;  4ZNB A;  4TZB A;  1Y44 A;  5LCF A;  3QH8 A;  3RKK A;  2HB9 A;  4TZ9 A;  1KO3 A;  2R2D A;  1JJT A;  5HIQ A;  4D1U A;  3ESH A;  3KL7 A;  4EYL A;  2QDS A;  1YCG A;  3ZNB A;  2GMN A;  5KIL A;  4D1W A;  2WYM A;  4HKY A;  1X8H A;  5AEB A;  3ZWF A;  4RM5 A;  3SD9 A;  4BP0 A;  2BG2 A;  5FQC A;  4J5F A;  1KO2 A;  2DOO A;  2YNT A;  4TYF A;  1P9E A;  3G1P A;  2DKF A;  4F6H A;  2BFZ A;  4ZO3 A;  5ACP A;  2Q0J A;  1DD6 A;  5ACT A;  3TP9 A;  2QDT A;  3P2U A;  2BC2 A;  4GYQ A;  4YSB A;  1DXK A;  1A8T A;  2YNT B;  4ZO2 A;  2NZE A;  5LSC A;  2CBN A;  4UWP B;  5ACR A;  2VW8 A;  5ACV A;  4HL2 A;  1WRA A;  3SFP A;  2BFZ B;  4RAM A;  1YCF A;  5HH4 A;  2BG7 A;  2YNU A;  4Z6X A;  1WUO A;  2OHI A;  3H3E A;  5FQA A;  5AXO A;  5IQK A;  5B3R A;  5LE1 A;  3I14 A;  2GCU A;  4EXY A;  4Z5Z A;  4B87 A;  5EVD A;  3DHB A;  3ZR9 A;  3KNS A;  5ACW A;  5AXR A;  4AWZ A;  3IEL A;  4DIL A;  4TZF A;  3F9O A;  1L9Y A;  2GFJ A;  3A4Y A;  2FU6 A;  2FM6 A;  5B15 A;  5A0T A;  4AX1 B;  2ZNB A;  2XF4 A;  5ACX A;  4P62 A;  4CHL A;  5KIK A;  5HIP A;  2BTN A;  5FQB A;  4C1H A;  2H6A A;  4AD9 A;  4UWO B;  4C1F A;  4D02 A;  2QED A;  2BG6 A;  3X2X A;  5DPX A;  4BZ3 A;  3X2Y A;  5AHR A;  4KEQ A;  3SW3 A;  1JJE A;  3X2Z A;  3I13 A;  3VPE A;  1A7T A;  1XM8 A;  3IE1 A;  5K4M A;  3VQZ A;  4LE6 A;  5K4K A;  3T3N A;  5EVB A;  3RKJ A;  2I7T A;  4NQ6 A;  5ACS A;  5HIS A;  1YCH A;  4RAW A;  5EH9 A;  3DH8 A;  4V0H A;  2I7X A;  3JXP A;  5HIO A;  3IDZ A;  2YCB A;  3S0Z A;  2Q0I A;  4EXS A;  3BK2 A;  3IEK A;  2NXA A;  5EV8 A;  3Q6V A;  4C09 A;  4XUK A;  3ZQ4 A;  4KEP A;  2WHG A;  3AF6 A;  2M5C A;  1ZTC A;  1ZNB A;  2FK6 A;  1KR3 A;  4NQ4 A;  5HH6 A;  5LCA A;  5EWA A;  1DDK A; 
#chains in the Genus database with same CATH topology
 1QH5 A;  3DHA A;  2YNW A;  4AX0 B;  3BV6 A;  4UBQ A;  3L6N A;  2Q42 A;  1X8I A;  2FHX A;  5AHO A;  2ZO4 A;  2OHJ A;  4FSB A;  3ADR A;  2OHH A;  2BMI A;  2I7V A;  2NZF A;  4C1E A;  4UA4 A;  3X30 A;  4F6Z A;  3BK1 A;  2YNV B;  1QH3 A;  4Z60 A;  1E5D A;  3FCZ A;  5LS3 A;  3SPU A;  5EW0 A;  2WYL A;  1WUP A;  4O98 A;  5EV6 A;  3PY6 A;  4C1G A;  3T9M A;  4YSL A;  2Q9U A;  2BFL A;  3AJ3 A;  3BC2 A;  2ZWR A;  2GKL A;  2WRS A;  1BMC A;  4Z7R A;  4PVO A;  2GFK A;  2BGA A;  3AF5 A;  2YNV A;  4AWY B;  1VGN A;  2YZ3 A;  4UWS B;  2NYP A;  5EVK A;  4C1C A;  2Y8B A;  5LM6 A;  2A7M A;  3SBL A;  4U4L A;  2Y8A A;  3IE0 A;  4HL1 A;  4Z67 A;  2QIN A;  1BVT A;  3PY5 A;  4RL2 A;  4EY2 A;  5HH5 A;  2FU8 A;  3KNR A;  5K0W A;  4EYB A;  3I0V A;  4FEK A;  3IOF A;  5LMC A;  4WD6 A;  4DIK A;  4D1V A;  5LLD A;  5LCH A;  2FU7 A;  2P4Z A;  1X8G A;  4RBS A;  3IOG A;  2P1E A;  4XWW A;  4JO0 A;  2P97 A;  1ZKP A;  3IE2 A;  1SML A;  4EFZ A;  4NQ2 A;  1VME A;  1BC2 A;  2UYX A;  2XR1 A;  1WW1 A;  2ZZI A;  4H0D A;  4TZE A;  2BIB A;  2P18 A;  4XWT A;  5A0V A;  3T3O A;  2CG3 A;  4UAM A;  5K4N A;  1M2X A;  2FHX B;  3PG4 A;  4UWR B;  4PVT A;  1HLK A;  5AYA A;  2Y87 A;  1MQO A;  1K07 A;  3DHC A;  4GCW A;  2BR6 A;  3WXC A;  3SRX A;  2QJS A;  2BFK A;  2AZ4 A;  3RPC A;  4AV7 A;  2BG8 A;  3R2U A;  1JT1 A;  2E7Y A;  4Z5Y A;  2M5D A;  3LVZ A;  4J5H A;  4D1T A;  2CFU A;  4NQ5 A;  3IEM A;  4RL0 A;  5B1U A;  3I15 A;  1VJN A;  5A5Z A;  3MD7 A;  2FU9 A;  5EHT A;  4EYF A;  5ACU A;  4FR7 A;  4GYU A;  4YSK A;  2BG8 B;  4ZEJ A;  4TYT A;  5A87 A;  2WYM C;  4C1D A;  1XTO A;  5ACQ A;  2CG2 A;  3FAI A;  3I11 A;  2AIO A;  4ZNB A;  4TZB A;  1Y44 A;  5LCF A;  3QH8 A;  3RKK A;  2HB9 A;  4TZ9 A;  1KO3 A;  2R2D A;  1JJT A;  5HIQ A;  4D1U A;  3ESH A;  3KL7 A;  4EYL A;  2QDS A;  1YCG A;  3ZNB A;  2GMN A;  5KIL A;  4D1W A;  2WYM A;  4HKY A;  1X8H A;  5AEB A;  3ZWF A;  4PDX A;  4RM5 A;  3SD9 A;  4BP0 A;  2BG2 A;  5FQC A;  4J5F A;  1KO2 A;  2DOO A;  2YNT A;  4TYF A;  4NUR A;  1P9E A;  3G1P A;  2DKF A;  4F6H A;  2BFZ A;  4ZO3 A;  5ACP A;  2Q0J A;  1DD6 A;  5ACT A;  3TP9 A;  2QDT A;  3P2U A;  2BC2 A;  4GYQ A;  4YSB A;  1DXK A;  1A8T A;  2YNT B;  4ZO2 A;  2NZE A;  5LSC A;  2CBN A;  4UWP B;  5ACR A;  2VW8 A;  5ACV A;  4HL2 A;  1WRA A;  3SFP A;  2BFZ B;  4RAM A;  1YCF A;  5HH4 A;  2BG7 A;  2YNU A;  4Z6X A;  1WUO A;  2OHI A;  3H3E A;  5FQA A;  5AXO A;  5IQK A;  5B3R A;  5LE1 A;  3I14 A;  2GCU A;  4EXY A;  4Z5Z A;  4B87 A;  5EVD A;  3DHB A;  5AJL A;  3ZR9 A;  3KNS A;  5ACW A;  5AXR A;  4AWZ A;  3IEL A;  4DIL A;  4TZF A;  3F9O A;  1L9Y A;  2GFJ A;  3A4Y A;  2FU6 A;  2FM6 A;  5B15 A;  5A0T A;  4AX1 B;  2ZNB A;  2XF4 A;  5ACX A;  4P62 A;  4CHL A;  5KIK A;  5HIP A;  2CFZ A;  2BTN A;  5FQB A;  4C1H A;  2H6A A;  4AD9 A;  4UWO B;  4C1F A;  4D02 A;  2QED A;  2BG6 A;  3X2X A;  5DPX A;  4BZ3 A;  3X2Y A;  5AHR A;  4KEQ A;  3SW3 A;  1JJE A;  3X2Z A;  3I13 A;  3VPE A;  1A7T A;  1XM8 A;  3IE1 A;  5K4M A;  3VQZ A;  2YHE A;  4LE6 A;  5K4K A;  3T3N A;  5EVB A;  3RKJ A;  2I7T A;  4NQ6 A;  5ACS A;  5HIS A;  4AXH A;  1YCH A;  4RAW A;  5EH9 A;  3DH8 A;  4V0H A;  2I7X A;  3JXP A;  5A23 A;  5HIO A;  3IDZ A;  2YCB A;  5AIJ A;  3S0Z A;  2Q0I A;  4EXS A;  3BK2 A;  3IEK A;  2NXA A;  5EV8 A;  3Q6V A;  4C09 A;  4XUK A;  3ZQ4 A;  4KEP A;  2WHG A;  3AF6 A;  2M5C A;  1ZTC A;  1ZNB A;  2FK6 A;  1KR3 A;  4NQ4 A;  5HH6 A;  5LCA A;  5EWA A;  1DDK A; 
#chains in the Genus database with same CATH homology
 1QH5 A;  3DHA A;  2YNW A;  4AX0 B;  3BV6 A;  4UBQ A;  3L6N A;  2Q42 A;  1X8I A;  2FHX A;  5AHO A;  2ZO4 A;  2OHJ A;  4FSB A;  3ADR A;  2OHH A;  2BMI A;  2I7V A;  2NZF A;  4C1E A;  4UA4 A;  3X30 A;  4F6Z A;  3BK1 A;  2YNV B;  1QH3 A;  4Z60 A;  1E5D A;  3FCZ A;  5LS3 A;  3SPU A;  5EW0 A;  2WYL A;  1WUP A;  4O98 A;  5EV6 A;  3PY6 A;  4C1G A;  3T9M A;  4YSL A;  2Q9U A;  2BFL A;  3AJ3 A;  3BC2 A;  2ZWR A;  2GKL A;  2WRS A;  1BMC A;  4Z7R A;  4PVO A;  2GFK A;  2BGA A;  3AF5 A;  2YNV A;  4AWY B;  1VGN A;  2YZ3 A;  4UWS B;  2NYP A;  5EVK A;  4C1C A;  2Y8B A;  5LM6 A;  2A7M A;  3SBL A;  4U4L A;  2Y8A A;  3IE0 A;  4HL1 A;  4Z67 A;  2QIN A;  1BVT A;  3PY5 A;  4RL2 A;  4EY2 A;  5HH5 A;  2FU8 A;  3KNR A;  5K0W A;  4EYB A;  3I0V A;  4FEK A;  5LMC A;  3IOF A;  4WD6 A;  4DIK A;  4D1V A;  5LLD A;  5LCH A;  2FU7 A;  2P4Z A;  1X8G A;  4RBS A;  3IOG A;  2P1E A;  4XWW A;  4JO0 A;  2P97 A;  1ZKP A;  3IE2 A;  1SML A;  4EFZ A;  4NQ2 A;  1VME A;  1BC2 A;  2UYX A;  2XR1 A;  1WW1 A;  2ZZI A;  4H0D A;  4TZE A;  2BIB A;  2P18 A;  4XWT A;  5A0V A;  3T3O A;  4UAM A;  5K4N A;  1M2X A;  2FHX B;  3PG4 A;  4UWR B;  4PVT A;  1HLK A;  5AYA A;  2Y87 A;  1MQO A;  1K07 A;  3DHC A;  4GCW A;  2BR6 A;  3WXC A;  3SRX A;  2QJS A;  2BFK A;  2AZ4 A;  3RPC A;  2BG8 A;  3R2U A;  1JT1 A;  2E7Y A;  4Z5Y A;  2M5D A;  3LVZ A;  4J5H A;  4D1T A;  4NQ5 A;  3IEM A;  4RL0 A;  5B1U A;  3I15 A;  1VJN A;  5A5Z A;  3MD7 A;  2FU9 A;  5EHT A;  4EYF A;  5ACU A;  4FR7 A;  4GYU A;  4YSK A;  2BG8 B;  4ZEJ A;  4TYT A;  5A87 A;  2WYM C;  4C1D A;  1XTO A;  5ACQ A;  3FAI A;  3I11 A;  2AIO A;  4ZNB A;  4TZB A;  1Y44 A;  5LCF A;  3QH8 A;  3RKK A;  2HB9 A;  4TZ9 A;  1KO3 A;  2R2D A;  1JJT A;  5HIQ A;  4D1U A;  3ESH A;  3KL7 A;  4EYL A;  2QDS A;  1YCG A;  3ZNB A;  2GMN A;  5KIL A;  4D1W A;  2WYM A;  4HKY A;  1X8H A;  5AEB A;  3ZWF A;  4RM5 A;  3SD9 A;  4BP0 A;  2BG2 A;  5FQC A;  4J5F A;  1KO2 A;  2DOO A;  2YNT A;  4TYF A;  1P9E A;  3G1P A;  2DKF A;  4F6H A;  2BFZ A;  4ZO3 A;  5ACP A;  2Q0J A;  1DD6 A;  5ACT A;  3TP9 A;  2QDT A;  3P2U A;  2BC2 A;  4GYQ A;  4YSB A;  1DXK A;  1A8T A;  2YNT B;  4ZO2 A;  2NZE A;  5LSC A;  2CBN A;  4UWP B;  5ACR A;  2VW8 A;  5ACV A;  4HL2 A;  1WRA A;  3SFP A;  2BFZ B;  4RAM A;  1YCF A;  5HH4 A;  2BG7 A;  2YNU A;  4Z6X A;  1WUO A;  2OHI A;  3H3E A;  5FQA A;  5AXO A;  5IQK A;  5B3R A;  5LE1 A;  3I14 A;  2GCU A;  4EXY A;  4Z5Z A;  4B87 A;  5EVD A;  3DHB A;  3ZR9 A;  3KNS A;  5ACW A;  5AXR A;  4AWZ A;  3IEL A;  4DIL A;  4TZF A;  3F9O A;  1L9Y A;  2GFJ A;  3A4Y A;  2FU6 A;  2FM6 A;  5B15 A;  5A0T A;  4AX1 B;  2ZNB A;  2XF4 A;  5ACX A;  4P62 A;  4CHL A;  5KIK A;  5HIP A;  2BTN A;  5FQB A;  4C1H A;  2H6A A;  4AD9 A;  4UWO B;  4C1F A;  4D02 A;  2QED A;  2BG6 A;  3X2X A;  5DPX A;  4BZ3 A;  3X2Y A;  5AHR A;  4KEQ A;  3SW3 A;  1JJE A;  3X2Z A;  3I13 A;  3VPE A;  1A7T A;  1XM8 A;  3IE1 A;  5K4M A;  3VQZ A;  4LE6 A;  5K4K A;  3T3N A;  5EVB A;  3RKJ A;  2I7T A;  4NQ6 A;  5ACS A;  5HIS A;  1YCH A;  4RAW A;  5EH9 A;  3DH8 A;  4V0H A;  2I7X A;  3JXP A;  5HIO A;  3IDZ A;  2YCB A;  3S0Z A;  2Q0I A;  4EXS A;  3BK2 A;  3IEK A;  2NXA A;  5EV8 A;  3Q6V A;  4C09 A;  4XUK A;  3ZQ4 A;  4KEP A;  2WHG A;  3AF6 A;  2M5C A;  1ZTC A;  1ZNB A;  2FK6 A;  1KR3 A;  4NQ4 A;  5HH6 A;  5LCA A;  5EWA A;  1DDK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...