4P62A

Directed evolution of a b3 metallo-beta-lactamase aim-1
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
269
structure length
269
Chain Sequence
ASRGCADDAGWNDPAMPQKVYGNTWYVGTCGISALLVTSDAGHILVDAATPQAGPQILANIRALGFRPEDVRAIVLSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLPDRTDPQFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRSCEGDDCRQMVYADSLTAISDDVYRYSDDAAHPGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRIGPRAAAPLMDTTACRRYAQGARQRLEKRLAEEAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metallo-beta-lactamase AIM-1
publication title Directed evolution of a B3 metallo-beta-lactamase AIM-1
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 92
structure length 269
sequence length 269
ec nomenclature
pdb deposition date 2014-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4p62A00
5A0TA 2BR6A 2DKFA 3R2UA 4EYFA 3BK1A 3MD7A 4RAMA 1QH3A 3VQZA 2FHXB 5K4MA 1VJNA 5AXOA 1JJEA 1KR3A 5AHOA 2OHIA 4AWZA 5KILA 4F6ZA 2OHJA 5A5ZA 2BMIA 2YNTB 3SW3A 2BG8B 3T9MA 1ZNBA 2M5DA 4C1FA 3P2UA 4C1DA 2YCBA 4RM5A 3BK2A 5LCFA 4C09A 4RL2A 4EFZA 3RPCA 5HH4A 1QH5A 5HH5A 1JT1A 5HIPA 3X2ZA 5EWAA 2AIOA 4Z5ZA 5ACWA 2Y8BA 3VPEA 2WRSA 2HB9A 4YSKA 5IQKA 3KL7A 4PVTA 3PY5A 5K4KA 4Z6XA 2FM6A 5HIOA 1YCFA 4C1HA 2ZZIA 1WRAA 4D02A 4UWSB 4FEKA 5EHTA 1K07A 5HH6A 1KO2A 4BP0A 4ZEJA 1ZKPA 4B87A 2Q9UA 2BC2A 2GFJA 4ZNBA 3RKKA 1WW1A 2Q0JA 3FAIA 5EV8A 3X2YA 3IEMA 4WD6A 1MQOA 3AF6A 4D1WA 3AF5A 4HL2A 5B3RA 1X8GA 2YZ3A 4D1VA 2QJSA 4GCWA 5ACQA 1BMCA 4O98A 4J5HA 4LE6A 5FQBA 4AX0B 2Y8AA 4UWRB 3I0VA 5HIQA 2BFLA 4HKYA 5LS3A 2BTNA 4Z60A 5A0VA 4Z7RA 4FR7A 5ACTA 5LM6A 4UAMA 2BFZA 2Q0IA 2ZO4A 5ACRA 3T3NA 5AEBA 2A7MA 2BFKA 2XF4A 4DIKA 4YSBA 2NZFA 4RBSA 5EW0A 5LCAA 3IELA 2ZNBA 3WXCA 3TP9A 3DH8A 2P1EA 4KEQA 5LLDA 1YCHA 5A87A 1M2XA 3I14A 4D1UA 4J5FA 2BFZB 2BG6A 4AX1B 3ZQ4A 4XUKA 4PVOA 2I7VA 3SPUA 1A7TA 1DXKA 4XWTA 2QDSA 4NQ4A 1BVTA 2WYMC 5AYAA 1XM8A 1XTOA 1X8IA 3KNRA 3DHAA 4JO0A 2P97A 4TZEA 1X8HA 2UYXA 2QDTA 2BIBA 4V0HA 2BGAA 4YSLA 4HL1A 2VW8A 4C1EA 2NXAA 4NQ2A 3T3OA 4RAWA 2FU6A 5B15A 3SFPA 4TYFA 2GKLA 4EXSA 2BG2A 3IE0A 2R2DA 2XR1A 1BC2A 1SMLA 4TZBA 3RKJA 3S0ZA 4Z5YA 5ACPA 3SD9A 5AXRA 3I11A 4EYBA 3PG4A 4FSBA 3DHBA 4Z67A 3G1PA 2FK6A 2I7XA 3A4YA 4TZFA 1YCGA 5K4NA 1ZTCA 2YNUA 2CBNA 5ACSA 2GMNA 4AWYB 3PY6A 5LSCA 2AZ4A 5AHRA 4P62A 3AJ3A 4AD9A 3ZR9A 3FCZA 4ZO3A 5ACXA 4NQ6A 1WUPA 2WYLA 1DDKA 1VGNA 3IE1A 5EVDA 3IEKA 1A8TA 4H0DA 3ZNBA 3H3EA 4BZ3A 2WHGA 4C1GA 2BG7A 4EXYA 5KIKA 4C1CA 3DHCA 3IOGA 5EV6A 2H6AA 2P4ZA 2Q42A 2E7YA 2GFKA 5FQCA 3QH8A 4ZO2A 4XWWA 5DPXA 1DD6A 1KO3A 3X2XA 2QEDA 4DILA 2YNVA 1Y44A 4CHLA 4NQ5A 4D1TA 2I7TA 5LE1A 3X30A 1VMEA 1WUOA 5B1UA 3BV6A 2NYPA 4UWOB 2NZEA 5EH9A 4TYTA 5LCHA 5EVKA 4U4LA 2FU8A 4KEPA 3I15A 4UBQA 1E5DA 3I13A 4UWPB 1HLKA 3IDZA 4EY2A 3Q6VA 5K0WA 5EVBA 3IE2A 2QINA 3BC2A 5LMCA 2YNVB 3F9OA 2WYMA 4RL0A 2YNWA 2FU9A 3ESHA 1L9YA 2M5CA 4TZ9A 4EYLA 3L6NA 3ZWFA 2FHXA 2Y87A 4GYQA 2FU7A 2OHHA 4UA4A 4F6HA 5HISA 3JXPA 3SBLA 1P9EA 2YNTA 5ACUA 1JJTA 2BG8A 3LVZA 5ACVA 2GCUA 3KNSA 3SRXA 4GYUA 3IOFA 2P18A 5FQAA 2ZWRA 3ADRA 2DOOA
chains in the Genus database with same CATH superfamily
5A0TA 2BR6A 2DKFA 3R2UA 4EYFA 3BK1A 3MD7A 4RAMA 1QH3A 3VQZA 2FHXB 5K4MA 1VJNA 5AXOA 1JJEA 1KR3A 5AHOA 2OHIA 4AWZA 5KILA 4F6ZA 2OHJA 5A5ZA 2BMIA 2YNTB 3SW3A 2BG8B 3T9MA 1ZNBA 2M5DA 4C1FA 3P2UA 4C1DA 2YCBA 4RM5A 3BK2A 5LCFA 4C09A 5A23A 4RL2A 4EFZA 3RPCA 5HH4A 1QH5A 5HH5A 1JT1A 5HIPA 3X2ZA 5EWAA 2AIOA 4Z5ZA 5ACWA 2Y8BA 3VPEA 2CG3A 2WRSA 2HB9A 4YSKA 5IQKA 3KL7A 4PVTA 3PY5A 5K4KA 4Z6XA 2FM6A 5HIOA 1YCFA 4C1HA 2ZZIA 1WRAA 4D02A 4UWSB 4FEKA 2CG2A 5EHTA 1K07A 5HH6A 1KO2A 4BP0A 4ZEJA 1ZKPA 4B87A 2Q9UA 2BC2A 2GFJA 4ZNBA 3RKKA 1WW1A 2Q0JA 3FAIA 5EV8A 3X2YA 5AJLA 3IEMA 4WD6A 1MQOA 3AF6A 4D1WA 3AF5A 4HL2A 5B3RA 1X8GA 2YZ3A 4D1VA 2QJSA 4GCWA 5ACQA 1BMCA 4O98A 4J5HA 4LE6A 5FQBA 4AX0B 2Y8AA 4UWRB 3I0VA 5HIQA 2BFLA 4HKYA 5LS3A 2BTNA 4Z60A 5A0VA 4Z7RA 4FR7A 5ACTA 5LM6A 4UAMA 2BFZA 2Q0IA 2ZO4A 5ACRA 3T3NA 5AEBA 2A7MA 2BFKA 2XF4A 4DIKA 4YSBA 2NZFA 4RBSA 5EW0A 5LCAA 3IELA 2ZNBA 3WXCA 3TP9A 3DH8A 2P1EA 4KEQA 4AV7A 5LLDA 1YCHA 5A87A 1M2XA 3I14A 4D1UA 4J5FA 2BFZB 2BG6A 4AX1B 3ZQ4A 4XUKA 4PVOA 2I7VA 3SPUA 1A7TA 1DXKA 4XWTA 2QDSA 4NQ4A 1BVTA 2WYMC 5AYAA 1XM8A 1XTOA 1X8IA 3KNRA 3DHAA 4JO0A 2P97A 4TZEA 1X8HA 2UYXA 2QDTA 2BIBA 4V0HA 2BGAA 4YSLA 4HL1A 2VW8A 5AIJA 4C1EA 2NXAA 4NQ2A 3T3OA 4RAWA 2FU6A 5B15A 3SFPA 4TYFA 2GKLA 4EXSA 2BG2A 3IE0A 2R2DA 2XR1A 1BC2A 1SMLA 4TZBA 3RKJA 3S0ZA 4Z5YA 5ACPA 3SD9A 5AXRA 3I11A 4EYBA 3PG4A 4FSBA 3DHBA 4Z67A 3G1PA 2FK6A 2I7XA 3A4YA 4TZFA 1YCGA 5K4NA 1ZTCA 2YNUA 2CBNA 5ACSA 2GMNA 4AWYB 3PY6A 5LSCA 2AZ4A 5AHRA 4P62A 3AJ3A 4AD9A 3ZR9A 3FCZA 4ZO3A 5ACXA 4NQ6A 1WUPA 2WYLA 1DDKA 1VGNA 3IE1A 5EVDA 2CFUA 3IEKA 1A8TA 4H0DA 3ZNBA 3H3EA 4BZ3A 2WHGA 4C1GA 2BG7A 4EXYA 5KIKA 4C1CA 3DHCA 3IOGA 5EV6A 4AXHA 2H6AA 2P4ZA 2Q42A 2E7YA 2GFKA 5FQCA 3QH8A 4ZO2A 4XWWA 5DPXA 1DD6A 1KO3A 3X2XA 2QEDA 4DILA 2YNVA 1Y44A 4CHLA 4NQ5A 4D1TA 2I7TA 5LE1A 4NURA 3X30A 1VMEA 1WUOA 5B1UA 3BV6A 2NYPA 4UWOB 2NZEA 5EH9A 4TYTA 5LCHA 5EVKA 4U4LA 2FU8A 4KEPA 3I15A 4UBQA 1E5DA 3I13A 4UWPB 1HLKA 3IDZA 4EY2A 3Q6VA 5K0WA 5EVBA 3IE2A 2QINA 3BC2A 5LMCA 2YNVB 3F9OA 2WYMA 4RL0A 2YNWA 2FU9A 3ESHA 1L9YA 2M5CA 4TZ9A 4EYLA 3L6NA 3ZWFA 2FHXA 4PDXA 2Y87A 4GYQA 2FU7A 2OHHA 4UA4A 4F6HA 5HISA 3JXPA 3SBLA 1P9EA 2YNTA 5ACUA 1JJTA 2BG8A 3LVZA 5ACVA 2GCUA 2YHEA 3KNSA 3SRXA 2CFZA 4GYUA 3IOFA 2P18A 5FQAA 2ZWRA 3ADRA 2DOOA
chains in the Genus database with same CATH topology
5A0TA 2BR6A 2DKFA 3R2UA 4EYFA 3BK1A 3MD7A 4RAMA 1QH3A 3VQZA 2FHXB 5K4MA 1VJNA 5AXOA 1JJEA 1KR3A 5AHOA 2OHIA 4AWZA 5KILA 4F6ZA 2OHJA 5A5ZA 2BMIA 2YNTB 3SW3A 2BG8B 3T9MA 1ZNBA 2M5DA 4C1FA 3P2UA 4C1DA 2YCBA 4RM5A 3BK2A 5LCFA 4C09A 4RL2A 4EFZA 3RPCA 5HH4A 1QH5A 5HH5A 1JT1A 5HIPA 3X2ZA 5EWAA 2AIOA 4Z5ZA 5ACWA 2Y8BA 3VPEA 2WRSA 2HB9A 4YSKA 5IQKA 3KL7A 4PVTA 3PY5A 5K4KA 4Z6XA 2FM6A 5HIOA 1YCFA 4C1HA 2ZZIA 1WRAA 4D02A 4UWSB 4FEKA 5EHTA 1K07A 5HH6A 1KO2A 4BP0A 4ZEJA 1ZKPA 4B87A 2Q9UA 2BC2A 2GFJA 4ZNBA 3RKKA 1WW1A 2Q0JA 3FAIA 5EV8A 3X2YA 3IEMA 4WD6A 1MQOA 3AF6A 4D1WA 3AF5A 4HL2A 5B3RA 1X8GA 2YZ3A 4D1VA 2QJSA 4GCWA 5ACQA 1BMCA 4O98A 4J5HA 4LE6A 5FQBA 4AX0B 2Y8AA 4UWRB 3I0VA 5HIQA 2BFLA 4HKYA 5LS3A 2BTNA 4Z60A 5A0VA 4Z7RA 4FR7A 5ACTA 5LM6A 4UAMA 2BFZA 2Q0IA 2ZO4A 5ACRA 3T3NA 5AEBA 2A7MA 2BFKA 2XF4A 4DIKA 4YSBA 2NZFA 4RBSA 5EW0A 5LCAA 3IELA 2ZNBA 3WXCA 3TP9A 3DH8A 2P1EA 4KEQA 5LLDA 1YCHA 5A87A 1M2XA 3I14A 4D1UA 4J5FA 2BFZB 2BG6A 4AX1B 3ZQ4A 4XUKA 4PVOA 2I7VA 3SPUA 1A7TA 1DXKA 4XWTA 2QDSA 4NQ4A 1BVTA 2WYMC 5AYAA 1XM8A 1XTOA 1X8IA 3KNRA 3DHAA 4JO0A 2P97A 4TZEA 1X8HA 2UYXA 2QDTA 2BIBA 4V0HA 2BGAA 4YSLA 4HL1A 2VW8A 4C1EA 2NXAA 4NQ2A 3T3OA 4RAWA 2FU6A 5B15A 3SFPA 4TYFA 2GKLA 4EXSA 2BG2A 3IE0A 2R2DA 2XR1A 1BC2A 1SMLA 4TZBA 3RKJA 3S0ZA 4Z5YA 5ACPA 3SD9A 5AXRA 3I11A 4EYBA 3PG4A 4FSBA 3DHBA 4Z67A 3G1PA 2FK6A 2I7XA 3A4YA 4TZFA 1YCGA 5K4NA 1ZTCA 2YNUA 2CBNA 5ACSA 2GMNA 4AWYB 3PY6A 5LSCA 2AZ4A 5AHRA 4P62A 3AJ3A 4AD9A 3ZR9A 3FCZA 4ZO3A 5ACXA 4NQ6A 1WUPA 2WYLA 1DDKA 1VGNA 3IE1A 5EVDA 3IEKA 1A8TA 4H0DA 3ZNBA 3H3EA 4BZ3A 2WHGA 4C1GA 2BG7A 4EXYA 5KIKA 4C1CA 3DHCA 3IOGA 5EV6A 2H6AA 2P4ZA 2Q42A 2E7YA 2GFKA 5FQCA 3QH8A 4ZO2A 4XWWA 5DPXA 1DD6A 1KO3A 3X2XA 2QEDA 4DILA 2YNVA 1Y44A 4CHLA 4NQ5A 4D1TA 2I7TA 5LE1A 3X30A 1VMEA 1WUOA 5B1UA 3BV6A 2NYPA 4UWOB 2NZEA 5EH9A 4TYTA 5LCHA 5EVKA 4U4LA 2FU8A 4KEPA 3I15A 4UBQA 1E5DA 3I13A 4UWPB 1HLKA 3IDZA 4EY2A 3Q6VA 5K0WA 5EVBA 3IE2A 2QINA 3BC2A 5LMCA 2YNVB 3F9OA 2WYMA 4RL0A 2YNWA 2FU9A 3ESHA 1L9YA 2M5CA 4TZ9A 4EYLA 3L6NA 3ZWFA 2FHXA 2Y87A 4GYQA 2FU7A 2OHHA 4UA4A 4F6HA 5HISA 3JXPA 3SBLA 1P9EA 2YNTA 5ACUA 1JJTA 2BG8A 3LVZA 5ACVA 2GCUA 3KNSA 3SRXA 4GYUA 3IOFA 2P18A 5FQAA 2ZWRA 3ADRA 2DOOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A0T A;  2BR6 A;  2DKF A;  3R2U A;  4EYF A;  3BK1 A;  3MD7 A;  4RAM A;  1QH3 A;  3VQZ A;  2FHX B;  5K4M A;  1VJN A;  5AXO A;  1JJE A;  1KR3 A;  5AHO A;  2OHI A;  4AWZ A;  5KIL A;  4F6Z A;  2OHJ A;  5A5Z A;  2BMI A;  2YNT B;  3SW3 A;  2BG8 B;  3T9M A;  1ZNB A;  2M5D A;  4C1F A;  3P2U A;  4C1D A;  2YCB A;  4RM5 A;  3BK2 A;  5LCF A;  4C09 A;  4RL2 A;  4EFZ A;  3RPC A;  5HH4 A;  1QH5 A;  5HH5 A;  1JT1 A;  5HIP A;  3X2Z A;  5EWA A;  2AIO A;  4Z5Z A;  5ACW A;  2Y8B A;  3VPE A;  2WRS A;  2HB9 A;  4YSK A;  5IQK A;  3KL7 A;  4PVT A;  3PY5 A;  5K4K A;  4Z6X A;  2FM6 A;  5HIO A;  1YCF A;  4C1H A;  2ZZI A;  1WRA A;  4D02 A;  4UWS B;  4FEK A;  5EHT A;  1K07 A;  5HH6 A;  1KO2 A;  4BP0 A;  4ZEJ A;  1ZKP A;  4B87 A;  2Q9U A;  2BC2 A;  2GFJ A;  4ZNB A;  3RKK A;  1WW1 A;  2Q0J A;  3FAI A;  5EV8 A;  3X2Y A;  3IEM A;  4WD6 A;  1MQO A;  3AF6 A;  4D1W A;  3AF5 A;  4HL2 A;  5B3R A;  1X8G A;  2YZ3 A;  4D1V A;  2QJS A;  4GCW A;  5ACQ A;  1BMC A;  4O98 A;  4J5H A;  4LE6 A;  5FQB A;  4AX0 B;  2Y8A A;  4UWR B;  3I0V A;  5HIQ A;  2BFL A;  4HKY A;  5LS3 A;  2BTN A;  4Z60 A;  5A0V A;  4Z7R A;  4FR7 A;  5ACT A;  5LM6 A;  4UAM A;  2BFZ A;  2Q0I A;  2ZO4 A;  5ACR A;  3T3N A;  5AEB A;  2A7M A;  2BFK A;  2XF4 A;  4DIK A;  4YSB A;  2NZF A;  4RBS A;  5EW0 A;  5LCA A;  3IEL A;  2ZNB A;  3WXC A;  3TP9 A;  3DH8 A;  2P1E A;  4KEQ A;  5LLD A;  1YCH A;  5A87 A;  1M2X A;  3I14 A;  4D1U A;  4J5F A;  2BFZ B;  2BG6 A;  4AX1 B;  3ZQ4 A;  4XUK A;  4PVO A;  2I7V A;  3SPU A;  1A7T A;  1DXK A;  4XWT A;  2QDS A;  4NQ4 A;  1BVT A;  2WYM C;  5AYA A;  1XM8 A;  1XTO A;  1X8I A;  3KNR A;  3DHA A;  4JO0 A;  2P97 A;  4TZE A;  1X8H A;  2UYX A;  2QDT A;  2BIB A;  4V0H A;  2BGA A;  4YSL A;  4HL1 A;  2VW8 A;  4C1E A;  2NXA A;  4NQ2 A;  3T3O A;  4RAW A;  2FU6 A;  5B15 A;  3SFP A;  4TYF A;  2GKL A;  4EXS A;  2BG2 A;  3IE0 A;  2R2D A;  2XR1 A;  1BC2 A;  1SML A;  4TZB A;  3RKJ A;  3S0Z A;  4Z5Y A;  5ACP A;  3SD9 A;  5AXR A;  3I11 A;  4EYB A;  3PG4 A;  4FSB A;  3DHB A;  4Z67 A;  3G1P A;  2FK6 A;  2I7X A;  3A4Y A;  4TZF A;  1YCG A;  5K4N A;  1ZTC A;  2YNU A;  2CBN A;  5ACS A;  2GMN A;  4AWY B;  3PY6 A;  5LSC A;  2AZ4 A;  5AHR A;  4P62 A;  3AJ3 A;  4AD9 A;  3ZR9 A;  3FCZ A;  4ZO3 A;  5ACX A;  4NQ6 A;  1WUP A;  2WYL A;  1DDK A;  1VGN A;  3IE1 A;  5EVD A;  3IEK A;  1A8T A;  4H0D A;  3ZNB A;  3H3E A;  4BZ3 A;  2WHG A;  4C1G A;  2BG7 A;  4EXY A;  5KIK A;  4C1C A;  3DHC A;  3IOG A;  5EV6 A;  2H6A A;  2P4Z A;  2Q42 A;  2E7Y A;  2GFK A;  5FQC A;  3QH8 A;  4ZO2 A;  4XWW A;  5DPX A;  1DD6 A;  1KO3 A;  3X2X A;  2QED A;  4DIL A;  2YNV A;  1Y44 A;  4CHL A;  4NQ5 A;  4D1T A;  2I7T A;  5LE1 A;  3X30 A;  1VME A;  1WUO A;  5B1U A;  3BV6 A;  2NYP A;  4UWO B;  2NZE A;  5EH9 A;  4TYT A;  5LCH A;  5EVK A;  4U4L A;  2FU8 A;  4KEP A;  3I15 A;  4UBQ A;  1E5D A;  3I13 A;  4UWP B;  1HLK A;  3IDZ A;  4EY2 A;  3Q6V A;  5K0W A;  5EVB A;  3IE2 A;  2QIN A;  3BC2 A;  5LMC A;  2YNV B;  3F9O A;  2WYM A;  4RL0 A;  2YNW A;  2FU9 A;  3ESH A;  1L9Y A;  2M5C A;  4TZ9 A;  4EYL A;  3L6N A;  3ZWF A;  2FHX A;  2Y87 A;  4GYQ A;  2FU7 A;  2OHH A;  4UA4 A;  4F6H A;  5HIS A;  3JXP A;  3SBL A;  1P9E A;  2YNT A;  5ACU A;  1JJT A;  2BG8 A;  3LVZ A;  5ACV A;  2GCU A;  3KNS A;  3SRX A;  4GYU A;  3IOF A;  2P18 A;  5FQA A;  2ZWR A;  3ADR A;  2DOO A; 
#chains in the Genus database with same CATH topology
 5A0T A;  2BR6 A;  2DKF A;  3R2U A;  4EYF A;  3BK1 A;  3MD7 A;  4RAM A;  1QH3 A;  3VQZ A;  2FHX B;  5K4M A;  1VJN A;  5AXO A;  1JJE A;  1KR3 A;  5AHO A;  2OHI A;  4AWZ A;  5KIL A;  4F6Z A;  2OHJ A;  5A5Z A;  2BMI A;  2YNT B;  3SW3 A;  2BG8 B;  3T9M A;  1ZNB A;  2M5D A;  4C1F A;  3P2U A;  4C1D A;  2YCB A;  4RM5 A;  3BK2 A;  5LCF A;  4C09 A;  5A23 A;  4RL2 A;  4EFZ A;  3RPC A;  5HH4 A;  1QH5 A;  5HH5 A;  1JT1 A;  5HIP A;  3X2Z A;  5EWA A;  2AIO A;  4Z5Z A;  5ACW A;  2Y8B A;  3VPE A;  2CG3 A;  2WRS A;  2HB9 A;  4YSK A;  5IQK A;  3KL7 A;  4PVT A;  3PY5 A;  5K4K A;  4Z6X A;  2FM6 A;  5HIO A;  1YCF A;  4C1H A;  2ZZI A;  1WRA A;  4D02 A;  4UWS B;  4FEK A;  2CG2 A;  5EHT A;  1K07 A;  5HH6 A;  1KO2 A;  4BP0 A;  4ZEJ A;  1ZKP A;  4B87 A;  2Q9U A;  2BC2 A;  2GFJ A;  4ZNB A;  3RKK A;  1WW1 A;  2Q0J A;  3FAI A;  5EV8 A;  3X2Y A;  5AJL A;  3IEM A;  4WD6 A;  1MQO A;  3AF6 A;  4D1W A;  3AF5 A;  4HL2 A;  5B3R A;  1X8G A;  2YZ3 A;  4D1V A;  2QJS A;  4GCW A;  5ACQ A;  1BMC A;  4O98 A;  4J5H A;  4LE6 A;  5FQB A;  4AX0 B;  2Y8A A;  4UWR B;  3I0V A;  5HIQ A;  2BFL A;  4HKY A;  5LS3 A;  2BTN A;  4Z60 A;  5A0V A;  4Z7R A;  4FR7 A;  5ACT A;  5LM6 A;  4UAM A;  2BFZ A;  2Q0I A;  2ZO4 A;  5ACR A;  3T3N A;  5AEB A;  2A7M A;  2BFK A;  2XF4 A;  4DIK A;  4YSB A;  2NZF A;  4RBS A;  5EW0 A;  5LCA A;  3IEL A;  2ZNB A;  3WXC A;  3TP9 A;  3DH8 A;  2P1E A;  4KEQ A;  4AV7 A;  5LLD A;  1YCH A;  5A87 A;  1M2X A;  3I14 A;  4D1U A;  4J5F A;  2BFZ B;  2BG6 A;  4AX1 B;  3ZQ4 A;  4XUK A;  4PVO A;  2I7V A;  3SPU A;  1A7T A;  1DXK A;  4XWT A;  2QDS A;  4NQ4 A;  1BVT A;  2WYM C;  5AYA A;  1XM8 A;  1XTO A;  1X8I A;  3KNR A;  3DHA A;  4JO0 A;  2P97 A;  4TZE A;  1X8H A;  2UYX A;  2QDT A;  2BIB A;  4V0H A;  2BGA A;  4YSL A;  4HL1 A;  2VW8 A;  5AIJ A;  4C1E A;  2NXA A;  4NQ2 A;  3T3O A;  4RAW A;  2FU6 A;  5B15 A;  3SFP A;  4TYF A;  2GKL A;  4EXS A;  2BG2 A;  3IE0 A;  2R2D A;  2XR1 A;  1BC2 A;  1SML A;  4TZB A;  3RKJ A;  3S0Z A;  4Z5Y A;  5ACP A;  3SD9 A;  5AXR A;  3I11 A;  4EYB A;  3PG4 A;  4FSB A;  3DHB A;  4Z67 A;  3G1P A;  2FK6 A;  2I7X A;  3A4Y A;  4TZF A;  1YCG A;  5K4N A;  1ZTC A;  2YNU A;  2CBN A;  5ACS A;  2GMN A;  4AWY B;  3PY6 A;  5LSC A;  2AZ4 A;  5AHR A;  4P62 A;  3AJ3 A;  4AD9 A;  3ZR9 A;  3FCZ A;  4ZO3 A;  5ACX A;  4NQ6 A;  1WUP A;  2WYL A;  1DDK A;  1VGN A;  3IE1 A;  5EVD A;  2CFU A;  3IEK A;  1A8T A;  4H0D A;  3ZNB A;  3H3E A;  4BZ3 A;  2WHG A;  4C1G A;  2BG7 A;  4EXY A;  5KIK A;  4C1C A;  3DHC A;  3IOG A;  5EV6 A;  4AXH A;  2H6A A;  2P4Z A;  2Q42 A;  2E7Y A;  2GFK A;  5FQC A;  3QH8 A;  4ZO2 A;  4XWW A;  5DPX A;  1DD6 A;  1KO3 A;  3X2X A;  2QED A;  4DIL A;  2YNV A;  1Y44 A;  4CHL A;  4NQ5 A;  4D1T A;  2I7T A;  5LE1 A;  4NUR A;  3X30 A;  1VME A;  1WUO A;  5B1U A;  3BV6 A;  2NYP A;  4UWO B;  2NZE A;  5EH9 A;  4TYT A;  5LCH A;  5EVK A;  4U4L A;  2FU8 A;  4KEP A;  3I15 A;  4UBQ A;  1E5D A;  3I13 A;  4UWP B;  1HLK A;  3IDZ A;  4EY2 A;  3Q6V A;  5K0W A;  5EVB A;  3IE2 A;  2QIN A;  3BC2 A;  5LMC A;  2YNV B;  3F9O A;  2WYM A;  4RL0 A;  2YNW A;  2FU9 A;  3ESH A;  1L9Y A;  2M5C A;  4TZ9 A;  4EYL A;  3L6N A;  3ZWF A;  2FHX A;  4PDX A;  2Y87 A;  4GYQ A;  2FU7 A;  2OHH A;  4UA4 A;  4F6H A;  5HIS A;  3JXP A;  3SBL A;  1P9E A;  2YNT A;  5ACU A;  1JJT A;  2BG8 A;  3LVZ A;  5ACV A;  2GCU A;  2YHE A;  3KNS A;  3SRX A;  2CFZ A;  4GYU A;  3IOF A;  2P18 A;  5FQA A;  2ZWR A;  3ADR A;  2DOO A; 
#chains in the Genus database with same CATH homology
 5A0T A;  2BR6 A;  2DKF A;  3R2U A;  4EYF A;  3BK1 A;  3MD7 A;  4RAM A;  1QH3 A;  3VQZ A;  2FHX B;  5K4M A;  1VJN A;  5AXO A;  1JJE A;  1KR3 A;  5AHO A;  2OHI A;  4AWZ A;  5KIL A;  4F6Z A;  2OHJ A;  5A5Z A;  2BMI A;  2YNT B;  3SW3 A;  2BG8 B;  3T9M A;  1ZNB A;  2M5D A;  4C1F A;  3P2U A;  4C1D A;  2YCB A;  4RM5 A;  3BK2 A;  5LCF A;  4C09 A;  4RL2 A;  4EFZ A;  3RPC A;  5HH4 A;  1QH5 A;  5HH5 A;  1JT1 A;  5HIP A;  3X2Z A;  5EWA A;  2AIO A;  4Z5Z A;  5ACW A;  2Y8B A;  3VPE A;  2WRS A;  2HB9 A;  4YSK A;  5IQK A;  3KL7 A;  4PVT A;  3PY5 A;  5K4K A;  4Z6X A;  2FM6 A;  5HIO A;  1YCF A;  4C1H A;  2ZZI A;  1WRA A;  4D02 A;  4UWS B;  4FEK A;  5EHT A;  1K07 A;  5HH6 A;  1KO2 A;  4BP0 A;  4ZEJ A;  1ZKP A;  4B87 A;  2Q9U A;  2BC2 A;  2GFJ A;  4ZNB A;  3RKK A;  1WW1 A;  2Q0J A;  3FAI A;  5EV8 A;  3X2Y A;  3IEM A;  4WD6 A;  1MQO A;  3AF6 A;  4D1W A;  3AF5 A;  4HL2 A;  5B3R A;  1X8G A;  2YZ3 A;  4D1V A;  2QJS A;  4GCW A;  5ACQ A;  1BMC A;  4O98 A;  4J5H A;  4LE6 A;  5FQB A;  4AX0 B;  2Y8A A;  4UWR B;  3I0V A;  5HIQ A;  2BFL A;  4HKY A;  5LS3 A;  2BTN A;  4Z60 A;  5A0V A;  4Z7R A;  4FR7 A;  5ACT A;  5LM6 A;  4UAM A;  2BFZ A;  2Q0I A;  2ZO4 A;  5ACR A;  3T3N A;  5AEB A;  2A7M A;  2BFK A;  2XF4 A;  4DIK A;  4YSB A;  2NZF A;  4RBS A;  5EW0 A;  5LCA A;  3IEL A;  2ZNB A;  3WXC A;  3TP9 A;  3DH8 A;  2P1E A;  4KEQ A;  5LLD A;  1YCH A;  5A87 A;  1M2X A;  3I14 A;  4D1U A;  4J5F A;  2BFZ B;  2BG6 A;  4AX1 B;  3ZQ4 A;  4XUK A;  4PVO A;  2I7V A;  3SPU A;  1A7T A;  1DXK A;  4XWT A;  2QDS A;  4NQ4 A;  1BVT A;  2WYM C;  5AYA A;  1XM8 A;  1XTO A;  1X8I A;  3KNR A;  3DHA A;  4JO0 A;  2P97 A;  4TZE A;  1X8H A;  2UYX A;  2QDT A;  2BIB A;  4V0H A;  2BGA A;  4YSL A;  4HL1 A;  2VW8 A;  4C1E A;  2NXA A;  4NQ2 A;  3T3O A;  4RAW A;  2FU6 A;  5B15 A;  3SFP A;  4TYF A;  2GKL A;  4EXS A;  2BG2 A;  3IE0 A;  2R2D A;  2XR1 A;  1BC2 A;  1SML A;  4TZB A;  3RKJ A;  3S0Z A;  4Z5Y A;  5ACP A;  3SD9 A;  5AXR A;  3I11 A;  4EYB A;  3PG4 A;  4FSB A;  3DHB A;  4Z67 A;  3G1P A;  2FK6 A;  2I7X A;  3A4Y A;  4TZF A;  1YCG A;  5K4N A;  1ZTC A;  2YNU A;  2CBN A;  5ACS A;  2GMN A;  4AWY B;  3PY6 A;  5LSC A;  2AZ4 A;  5AHR A;  4P62 A;  3AJ3 A;  4AD9 A;  3ZR9 A;  3FCZ A;  4ZO3 A;  5ACX A;  4NQ6 A;  1WUP A;  2WYL A;  1DDK A;  1VGN A;  3IE1 A;  5EVD A;  3IEK A;  1A8T A;  4H0D A;  3ZNB A;  3H3E A;  4BZ3 A;  2WHG A;  4C1G A;  2BG7 A;  4EXY A;  5KIK A;  4C1C A;  3DHC A;  3IOG A;  5EV6 A;  2H6A A;  2P4Z A;  2Q42 A;  2E7Y A;  2GFK A;  5FQC A;  3QH8 A;  4ZO2 A;  4XWW A;  5DPX A;  1DD6 A;  1KO3 A;  3X2X A;  2QED A;  4DIL A;  2YNV A;  1Y44 A;  4CHL A;  4NQ5 A;  4D1T A;  2I7T A;  5LE1 A;  3X30 A;  1VME A;  1WUO A;  5B1U A;  3BV6 A;  2NYP A;  4UWO B;  2NZE A;  5EH9 A;  4TYT A;  5LCH A;  5EVK A;  4U4L A;  2FU8 A;  4KEP A;  3I15 A;  4UBQ A;  1E5D A;  3I13 A;  4UWP B;  1HLK A;  3IDZ A;  4EY2 A;  3Q6V A;  5K0W A;  5EVB A;  3IE2 A;  2QIN A;  3BC2 A;  5LMC A;  2YNV B;  3F9O A;  2WYM A;  4RL0 A;  2YNW A;  2FU9 A;  3ESH A;  1L9Y A;  2M5C A;  4TZ9 A;  4EYL A;  3L6N A;  3ZWF A;  2FHX A;  2Y87 A;  4GYQ A;  2FU7 A;  2OHH A;  4UA4 A;  4F6H A;  5HIS A;  3JXP A;  3SBL A;  1P9E A;  2YNT A;  5ACU A;  1JJT A;  2BG8 A;  3LVZ A;  5ACV A;  2GCU A;  3KNS A;  3SRX A;  4GYU A;  3IOF A;  2P18 A;  5FQA A;  2ZWR A;  3ADR A;  2DOO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...