4P62A

Directed evolution of a b3 metallo-beta-lactamase aim-1
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
269
structure length
269
Chain Sequence
ASRGCADDAGWNDPAMPQKVYGNTWYVGTCGISALLVTSDAGHILVDAATPQAGPQILANIRALGFRPEDVRAIVLSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLPDRTDPQFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRSCEGDDCRQMVYADSLTAISDDVYRYSDDAAHPGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRIGPRAAAPLMDTTACRRYAQGARQRLEKRLAEEAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Metallo-beta-lactamase AIM-1
publication title Directed evolution of a B3 metallo-beta-lactamase AIM-1
rcsb
source organism Pseudomonas aeruginosa
total genus 92
structure length 269
sequence length 269
ec nomenclature
pdb deposition date 2014-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4p62A00
5LCAA 1P9EA 4AWZA 2I7XA 4V0HA 4EY2A 4RAWA 3KL7A 1VJNA 2BIBA 3SBLA 3AF5A 4UWOB 1KO3A 4EXSA 3QH8A 4XWTA 3FCZA 1YCHA 4TZBA 1DD6A 2BC2A 4XWWA 3DH8A 4CHLA 2Q0IA 2QDSA 3DHAA 3IE2A 4YSLA 2NYPA 5ACRA 2QDTA 4TYFA 4RM5A 3Q6VA 3ZQ4A 2YZ3A 3I11A 2BFZB 4U4LA 4KEQA 5A0TA 3F9OA 4RL2A 2VW8A 5A5ZA 2YNWA 4P62A 2WHGA 4UBQA 1KR3A 4J5HA 5HH4A 4GYQA 2FU8A 1X8IA 4HL1A 2CBNA 3KNRA 4Z5YA 3R2UA 3IOFA 3PY5A 2GKLA 5ACWA 2R2DA 3BC2A 5HIOA 3FAIA 4Z7RA 3H3EA 1ZNBA 1YCGA 2Y87A 3SRXA 4C1CA 4EFZA 2GFKA 2YNUA 2XR1A 4RL0A 4AWYB 2WRSA 1L9YA 2FHXA 5HISA 4C1GA 4TZ9A 3DHBA 1VMEA 1JJEA 4EXYA 2YNTB 5EWAA 2BG8A 2Y8BA 4AX0B 2P97A 4UWPB 2FU7A 3WXCA 2GMNA 1ZKPA 1X8GA 2HB9A 4YSBA 2QINA 3S0ZA 1XM8A 5EV8A 3SW3A 2FK6A 2BR6A 5ACSA 4UA4A 1X8HA 3I0VA 4FSBA 2P1EA 5LSCA 5HH5A 4D02A 5ACPA 2AIOA 5FQAA 5AXOA 4ZNBA 1BVTA 5LCFA 3ESHA 2BFLA 3X30A 2NZEA 3RPCA 1SMLA 5A87A 3ZNBA 5B3RA 5AXRA 2OHIA 2DOOA 1WRAA 1WUPA 3PG4A 3X2XA 3SPUA 4HKYA 1Y44A 5FQBA 4PVTA 4GCWA 4C09A 3A4YA 3AJ3A 1E5DA 4UAMA 4DIKA 5B15A 5EVBA 5K0WA 4D1UA 2BTNA 2YCBA 4EYBA 1XTOA 4Z6XA 4ZO3A 3PY6A 2ZO4A 3SD9A 4NQ6A 3L6NA 4JO0A 4NQ4A 1DDKA 4HL2A 5EHTA 3VPEA 2H6AA 2GCUA 1MQOA 2I7VA 5AHRA 4LE6A 5ACXA 3IE1A 4Z67A 2M5DA 3MD7A 5LLDA 5ACUA 5EVDA 4Z60A 4WD6A 4C1DA 5LCHA 3ADRA 4AD9A 1WUOA 2GFJA 3BK1A 4BP0A 4ZEJA 3I15A 2FHXB 3IE0A 2M5CA 4PVOA 2NZFA 2BG6A 3P2UA 4ZO2A 3IDZA 2BG8B 5EV6A 1A8TA 4EYFA 1A7TA 2WYLA 3SFPA 5HIPA 2QEDA 3IEKA 4FR7A 3T3OA 5LMCA 5AHOA 2ZWRA 2FU6A 2XF4A 1KO2A 1JT1A 2I7TA 4YSKA 3BV6A 4O98A 1WW1A 1JJTA 4KEPA 3T3NA 3I13A 3ZWFA 1ZTCA 5ACTA 2YNVA 4D1TA 2FM6A 4TYTA 4B87A 3JXPA 2P18A 1K07A 2QJSA 2ZNBA 5ACVA 5LE1A 2FU9A 4AX1B 5KILA 3G1PA 4NQ2A 2E7YA 5FQCA 4RBSA 5K4NA 5AYAA 4RAMA 2WYMA 3X2ZA 2OHHA 2P4ZA 5EVKA 5DPXA 3BK2A 4H0DA 5AEBA 3IELA 3RKKA 2BG7A 5HIQA 2DKFA 1M2XA 4DILA 1BC2A 5ACQA 3T9MA 2NXAA 2A7MA 5A0VA 4GYUA 4EYLA 4NQ5A 5B1UA 1YCFA 5K4MA 3AF6A 1VGNA 5KIKA 5IQKA 2BFZA 4J5FA 1QH3A 2Y8AA 5HH6A 4UWSB 4BZ3A 4F6ZA 5EH9A 3VQZA 3KNSA 3X2YA 2UYXA 4F6HA 4UWRB 4FEKA 5K4KA 3DHCA 4TZEA 3LVZA 4C1EA 5LS3A 2AZ4A 1DXKA 2ZZIA 4D1WA 2Q0JA 4TZFA 2BGAA 2WYMC 1QH5A 4C1HA 2BFKA 3RKJA 2YNVB 3IEMA 5LM6A 1BMCA 5EW0A 3I14A 3IOGA 4D1VA 2Q42A 4XUKA 4Z5ZA 2BG2A 4C1FA 1HLKA 2Q9UA 2YNTA 2OHJA 3TP9A 2BMIA 3ZR9A
chains in the Genus database with same CATH superfamily
5LCAA 1P9EA 4AWZA 2I7XA 4V0HA 4EY2A 4RAWA 3KL7A 1VJNA 2BIBA 3SBLA 3AF5A 4UWOB 1KO3A 4EXSA 3QH8A 4XWTA 3FCZA 1YCHA 4TZBA 1DD6A 2BC2A 4XWWA 3DH8A 4CHLA 2Q0IA 2QDSA 3DHAA 3IE2A 4YSLA 2NYPA 5ACRA 2QDTA 4TYFA 5AIJA 4RM5A 3Q6VA 3ZQ4A 2YZ3A 3I11A 2BFZB 5A23A 4U4LA 4KEQA 5A0TA 3F9OA 4RL2A 2VW8A 5A5ZA 2YNWA 4P62A 2WHGA 4UBQA 1KR3A 4J5HA 5HH4A 4GYQA 2FU8A 1X8IA 4HL1A 2CBNA 3KNRA 4Z5YA 3R2UA 3IOFA 3PY5A 2GKLA 5ACWA 2R2DA 3BC2A 5HIOA 3FAIA 4Z7RA 3H3EA 1ZNBA 1YCGA 2Y87A 3SRXA 4C1CA 4EFZA 2GFKA 2YNUA 2XR1A 4RL0A 4AWYB 2WRSA 1L9YA 2FHXA 5HISA 4C1GA 4TZ9A 3DHBA 1VMEA 1JJEA 4EXYA 2YNTB 5EWAA 2BG8A 2Y8BA 4AX0B 2P97A 4UWPB 2FU7A 3WXCA 2GMNA 1ZKPA 1X8GA 2HB9A 4YSBA 2QINA 3S0ZA 1XM8A 4AXHA 5EV8A 3SW3A 2FK6A 2BR6A 5ACSA 4UA4A 1X8HA 3I0VA 4FSBA 2P1EA 5LSCA 5HH5A 4D02A 5ACPA 2AIOA 5FQAA 5AXOA 4ZNBA 1BVTA 5LCFA 3ESHA 2BFLA 3X30A 2NZEA 3RPCA 1SMLA 5A87A 3ZNBA 5B3RA 5AXRA 2OHIA 2DOOA 1WRAA 1WUPA 3PG4A 3X2XA 3SPUA 4HKYA 1Y44A 5FQBA 4PVTA 4GCWA 4C09A 3A4YA 3AJ3A 1E5DA 4UAMA 2YHEA 4DIKA 5B15A 5EVBA 5K0WA 4D1UA 2BTNA 2YCBA 4EYBA 1XTOA 4Z6XA 4ZO3A 3PY6A 2ZO4A 3SD9A 4NQ6A 3L6NA 4JO0A 4NQ4A 1DDKA 4HL2A 5EHTA 3VPEA 2H6AA 2GCUA 1MQOA 2I7VA 5AHRA 4LE6A 5ACXA 3IE1A 4Z67A 2M5DA 3MD7A 2CFUA 5LLDA 5ACUA 5EVDA 4Z60A 4WD6A 4C1DA 5LCHA 3ADRA 4AD9A 1WUOA 2GFJA 3BK1A 4BP0A 4ZEJA 3I15A 2FHXB 3IE0A 2M5CA 4PVOA 2NZFA 2BG6A 3P2UA 5AJLA 4ZO2A 3IDZA 2BG8B 5EV6A 1A8TA 4EYFA 1A7TA 2WYLA 3SFPA 5HIPA 2QEDA 3IEKA 4AV7A 4FR7A 3T3OA 5LMCA 5AHOA 2ZWRA 2FU6A 2XF4A 1KO2A 1JT1A 2I7TA 4YSKA 3BV6A 4O98A 1WW1A 2CG3A 1JJTA 4KEPA 3T3NA 3I13A 3ZWFA 1ZTCA 5ACTA 2YNVA 4D1TA 2FM6A 4TYTA 4B87A 3JXPA 2P18A 1K07A 2QJSA 2ZNBA 5ACVA 4PDXA 2FU9A 5LE1A 4AX1B 5KILA 3G1PA 4NQ2A 2E7YA 5FQCA 4RBSA 5K4NA 5AYAA 4RAMA 2WYMA 3X2ZA 2OHHA 2P4ZA 5EVKA 5DPXA 3BK2A 4H0DA 5AEBA 3IELA 3RKKA 2BG7A 5HIQA 2DKFA 1M2XA 4DILA 1BC2A 5ACQA 3T9MA 2NXAA 2A7MA 5A0VA 4GYUA 4EYLA 4NQ5A 5B1UA 1YCFA 5K4MA 3AF6A 1VGNA 5KIKA 5IQKA 2BFZA 4J5FA 1QH3A 2Y8AA 5HH6A 4UWSB 4BZ3A 4F6ZA 5EH9A 3VQZA 3KNSA 2CG2A 3X2YA 2UYXA 4F6HA 4UWRB 4FEKA 5K4KA 3DHCA 4TZEA 3LVZA 4C1EA 5LS3A 2AZ4A 1DXKA 2ZZIA 2CFZA 4NURA 4D1WA 2Q0JA 4TZFA 2BGAA 2WYMC 1QH5A 4C1HA 2BFKA 3RKJA 2YNVB 3IEMA 5LM6A 1BMCA 5EW0A 3I14A 3IOGA 4D1VA 2Q42A 4XUKA 4Z5ZA 2BG2A 4C1FA 1HLKA 2Q9UA 2YNTA 2OHJA 3TP9A 2BMIA 3ZR9A
chains in the Genus database with same CATH topology
5LCAA 1P9EA 4AWZA 2I7XA 4V0HA 4EY2A 4RAWA 3KL7A 1VJNA 2BIBA 3SBLA 3AF5A 4UWOB 1KO3A 4EXSA 3QH8A 4XWTA 3FCZA 1YCHA 4TZBA 1DD6A 2BC2A 4XWWA 3DH8A 4CHLA 2Q0IA 2QDSA 3DHAA 3IE2A 4YSLA 2NYPA 5ACRA 2QDTA 4TYFA 4RM5A 3Q6VA 3ZQ4A 2YZ3A 3I11A 2BFZB 4U4LA 4KEQA 5A0TA 3F9OA 4RL2A 2VW8A 5A5ZA 2YNWA 4P62A 2WHGA 4UBQA 1KR3A 4J5HA 5HH4A 4GYQA 2FU8A 1X8IA 4HL1A 2CBNA 3KNRA 4Z5YA 3R2UA 3IOFA 3PY5A 2GKLA 5ACWA 2R2DA 3BC2A 5HIOA 3FAIA 4Z7RA 3H3EA 1ZNBA 1YCGA 2Y87A 3SRXA 4C1CA 4EFZA 2GFKA 2YNUA 2XR1A 4RL0A 4AWYB 2WRSA 1L9YA 2FHXA 5HISA 4C1GA 4TZ9A 3DHBA 1VMEA 1JJEA 4EXYA 2YNTB 5EWAA 2BG8A 2Y8BA 4AX0B 2P97A 4UWPB 2FU7A 3WXCA 2GMNA 1ZKPA 1X8GA 2HB9A 4YSBA 2QINA 3S0ZA 1XM8A 5EV8A 3SW3A 2FK6A 2BR6A 5ACSA 4UA4A 1X8HA 3I0VA 4FSBA 2P1EA 5LSCA 5HH5A 4D02A 5ACPA 2AIOA 5FQAA 5AXOA 4ZNBA 1BVTA 5LCFA 3ESHA 2BFLA 3X30A 2NZEA 3RPCA 1SMLA 5A87A 3ZNBA 5B3RA 5AXRA 2OHIA 2DOOA 1WRAA 1WUPA 3PG4A 3X2XA 3SPUA 4HKYA 1Y44A 5FQBA 4PVTA 4GCWA 4C09A 3A4YA 3AJ3A 1E5DA 4UAMA 4DIKA 5B15A 5EVBA 5K0WA 4D1UA 2BTNA 2YCBA 4EYBA 1XTOA 4Z6XA 4ZO3A 3PY6A 2ZO4A 3SD9A 4NQ6A 3L6NA 4JO0A 4NQ4A 1DDKA 4HL2A 5EHTA 3VPEA 2H6AA 2GCUA 1MQOA 2I7VA 5AHRA 4LE6A 5ACXA 3IE1A 4Z67A 2M5DA 3MD7A 5LLDA 5ACUA 5EVDA 4Z60A 4WD6A 4C1DA 5LCHA 3ADRA 4AD9A 1WUOA 2GFJA 3BK1A 4BP0A 4ZEJA 3I15A 2FHXB 3IE0A 2M5CA 4PVOA 2NZFA 2BG6A 3P2UA 4ZO2A 3IDZA 2BG8B 5EV6A 1A8TA 4EYFA 1A7TA 2WYLA 3SFPA 5HIPA 2QEDA 3IEKA 4FR7A 3T3OA 5LMCA 5AHOA 2ZWRA 2FU6A 2XF4A 1KO2A 1JT1A 2I7TA 4YSKA 3BV6A 4O98A 1WW1A 1JJTA 4KEPA 3T3NA 3I13A 3ZWFA 1ZTCA 5ACTA 2YNVA 4D1TA 2FM6A 4TYTA 4B87A 3JXPA 2P18A 1K07A 2QJSA 2ZNBA 5ACVA 5LE1A 2FU9A 4AX1B 5KILA 3G1PA 4NQ2A 2E7YA 5FQCA 4RBSA 5K4NA 5AYAA 4RAMA 2WYMA 3X2ZA 2OHHA 2P4ZA 5EVKA 5DPXA 3BK2A 4H0DA 5AEBA 3IELA 3RKKA 2BG7A 5HIQA 2DKFA 1M2XA 4DILA 1BC2A 5ACQA 3T9MA 2NXAA 2A7MA 5A0VA 4GYUA 4EYLA 4NQ5A 5B1UA 1YCFA 5K4MA 3AF6A 1VGNA 5KIKA 5IQKA 2BFZA 4J5FA 1QH3A 2Y8AA 5HH6A 4UWSB 4BZ3A 4F6ZA 5EH9A 3VQZA 3KNSA 3X2YA 2UYXA 4F6HA 4UWRB 4FEKA 5K4KA 3DHCA 4TZEA 3LVZA 4C1EA 5LS3A 2AZ4A 1DXKA 2ZZIA 4D1WA 2Q0JA 4TZFA 2BGAA 2WYMC 1QH5A 4C1HA 2BFKA 3RKJA 2YNVB 3IEMA 5LM6A 1BMCA 5EW0A 3I14A 3IOGA 4D1VA 2Q42A 4XUKA 4Z5ZA 2BG2A 4C1FA 1HLKA 2Q9UA 2YNTA 2OHJA 3TP9A 2BMIA 3ZR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LCA A;  1P9E A;  4AWZ A;  2I7X A;  4V0H A;  4EY2 A;  4RAW A;  3KL7 A;  1VJN A;  2BIB A;  3SBL A;  3AF5 A;  4UWO B;  1KO3 A;  4EXS A;  3QH8 A;  4XWT A;  3FCZ A;  1YCH A;  4TZB A;  1DD6 A;  2BC2 A;  4XWW A;  3DH8 A;  4CHL A;  2Q0I A;  2QDS A;  3DHA A;  3IE2 A;  4YSL A;  2NYP A;  5ACR A;  2QDT A;  4TYF A;  4RM5 A;  3Q6V A;  3ZQ4 A;  2YZ3 A;  3I11 A;  2BFZ B;  4U4L A;  4KEQ A;  5A0T A;  3F9O A;  4RL2 A;  2VW8 A;  5A5Z A;  2YNW A;  4P62 A;  2WHG A;  4UBQ A;  1KR3 A;  4J5H A;  5HH4 A;  4GYQ A;  2FU8 A;  1X8I A;  4HL1 A;  2CBN A;  3KNR A;  4Z5Y A;  3R2U A;  3IOF A;  3PY5 A;  2GKL A;  5ACW A;  2R2D A;  3BC2 A;  5HIO A;  3FAI A;  4Z7R A;  3H3E A;  1ZNB A;  1YCG A;  2Y87 A;  3SRX A;  4C1C A;  4EFZ A;  2GFK A;  2YNU A;  2XR1 A;  4RL0 A;  4AWY B;  2WRS A;  1L9Y A;  2FHX A;  5HIS A;  4C1G A;  4TZ9 A;  3DHB A;  1VME A;  1JJE A;  4EXY A;  2YNT B;  5EWA A;  2BG8 A;  2Y8B A;  4AX0 B;  2P97 A;  4UWP B;  2FU7 A;  3WXC A;  2GMN A;  1ZKP A;  1X8G A;  2HB9 A;  4YSB A;  2QIN A;  3S0Z A;  1XM8 A;  5EV8 A;  3SW3 A;  2FK6 A;  2BR6 A;  5ACS A;  4UA4 A;  1X8H A;  3I0V A;  4FSB A;  2P1E A;  5LSC A;  5HH5 A;  4D02 A;  5ACP A;  2AIO A;  5FQA A;  5AXO A;  4ZNB A;  1BVT A;  5LCF A;  3ESH A;  2BFL A;  3X30 A;  2NZE A;  3RPC A;  1SML A;  5A87 A;  3ZNB A;  5B3R A;  5AXR A;  2OHI A;  2DOO A;  1WRA A;  1WUP A;  3PG4 A;  3X2X A;  3SPU A;  4HKY A;  1Y44 A;  5FQB A;  4PVT A;  4GCW A;  4C09 A;  3A4Y A;  3AJ3 A;  1E5D A;  4UAM A;  4DIK A;  5B15 A;  5EVB A;  5K0W A;  4D1U A;  2BTN A;  2YCB A;  4EYB A;  1XTO A;  4Z6X A;  4ZO3 A;  3PY6 A;  2ZO4 A;  3SD9 A;  4NQ6 A;  3L6N A;  4JO0 A;  4NQ4 A;  1DDK A;  4HL2 A;  5EHT A;  3VPE A;  2H6A A;  2GCU A;  1MQO A;  2I7V A;  5AHR A;  4LE6 A;  5ACX A;  3IE1 A;  4Z67 A;  2M5D A;  3MD7 A;  5LLD A;  5ACU A;  5EVD A;  4Z60 A;  4WD6 A;  4C1D A;  5LCH A;  3ADR A;  4AD9 A;  1WUO A;  2GFJ A;  3BK1 A;  4BP0 A;  4ZEJ A;  3I15 A;  2FHX B;  3IE0 A;  2M5C A;  4PVO A;  2NZF A;  2BG6 A;  3P2U A;  4ZO2 A;  3IDZ A;  2BG8 B;  5EV6 A;  1A8T A;  4EYF A;  1A7T A;  2WYL A;  3SFP A;  5HIP A;  2QED A;  3IEK A;  4FR7 A;  3T3O A;  5LMC A;  5AHO A;  2ZWR A;  2FU6 A;  2XF4 A;  1KO2 A;  1JT1 A;  2I7T A;  4YSK A;  3BV6 A;  4O98 A;  1WW1 A;  1JJT A;  4KEP A;  3T3N A;  3I13 A;  3ZWF A;  1ZTC A;  5ACT A;  2YNV A;  4D1T A;  2FM6 A;  4TYT A;  4B87 A;  3JXP A;  2P18 A;  1K07 A;  2QJS A;  2ZNB A;  5ACV A;  5LE1 A;  2FU9 A;  4AX1 B;  5KIL A;  3G1P A;  4NQ2 A;  2E7Y A;  5FQC A;  4RBS A;  5K4N A;  5AYA A;  4RAM A;  2WYM A;  3X2Z A;  2OHH A;  2P4Z A;  5EVK A;  5DPX A;  3BK2 A;  4H0D A;  5AEB A;  3IEL A;  3RKK A;  2BG7 A;  5HIQ A;  2DKF A;  1M2X A;  4DIL A;  1BC2 A;  5ACQ A;  3T9M A;  2NXA A;  2A7M A;  5A0V A;  4GYU A;  4EYL A;  4NQ5 A;  5B1U A;  1YCF A;  5K4M A;  3AF6 A;  1VGN A;  5KIK A;  5IQK A;  2BFZ A;  4J5F A;  1QH3 A;  2Y8A A;  5HH6 A;  4UWS B;  4BZ3 A;  4F6Z A;  5EH9 A;  3VQZ A;  3KNS A;  3X2Y A;  2UYX A;  4F6H A;  4UWR B;  4FEK A;  5K4K A;  3DHC A;  4TZE A;  3LVZ A;  4C1E A;  5LS3 A;  2AZ4 A;  1DXK A;  2ZZI A;  4D1W A;  2Q0J A;  4TZF A;  2BGA A;  2WYM C;  1QH5 A;  4C1H A;  2BFK A;  3RKJ A;  2YNV B;  3IEM A;  5LM6 A;  1BMC A;  5EW0 A;  3I14 A;  3IOG A;  4D1V A;  2Q42 A;  4XUK A;  4Z5Z A;  2BG2 A;  4C1F A;  1HLK A;  2Q9U A;  2YNT A;  2OHJ A;  3TP9 A;  2BMI A;  3ZR9 A; 
#chains in the Genus database with same CATH topology
 5LCA A;  1P9E A;  4AWZ A;  2I7X A;  4V0H A;  4EY2 A;  4RAW A;  3KL7 A;  1VJN A;  2BIB A;  3SBL A;  3AF5 A;  4UWO B;  1KO3 A;  4EXS A;  3QH8 A;  4XWT A;  3FCZ A;  1YCH A;  4TZB A;  1DD6 A;  2BC2 A;  4XWW A;  3DH8 A;  4CHL A;  2Q0I A;  2QDS A;  3DHA A;  3IE2 A;  4YSL A;  2NYP A;  5ACR A;  2QDT A;  4TYF A;  5AIJ A;  4RM5 A;  3Q6V A;  3ZQ4 A;  2YZ3 A;  3I11 A;  2BFZ B;  5A23 A;  4U4L A;  4KEQ A;  5A0T A;  3F9O A;  4RL2 A;  2VW8 A;  5A5Z A;  2YNW A;  4P62 A;  2WHG A;  4UBQ A;  1KR3 A;  4J5H A;  5HH4 A;  4GYQ A;  2FU8 A;  1X8I A;  4HL1 A;  2CBN A;  3KNR A;  4Z5Y A;  3R2U A;  3IOF A;  3PY5 A;  2GKL A;  5ACW A;  2R2D A;  3BC2 A;  5HIO A;  3FAI A;  4Z7R A;  3H3E A;  1ZNB A;  1YCG A;  2Y87 A;  3SRX A;  4C1C A;  4EFZ A;  2GFK A;  2YNU A;  2XR1 A;  4RL0 A;  4AWY B;  2WRS A;  1L9Y A;  2FHX A;  5HIS A;  4C1G A;  4TZ9 A;  3DHB A;  1VME A;  1JJE A;  4EXY A;  2YNT B;  5EWA A;  2BG8 A;  2Y8B A;  4AX0 B;  2P97 A;  4UWP B;  2FU7 A;  3WXC A;  2GMN A;  1ZKP A;  1X8G A;  2HB9 A;  4YSB A;  2QIN A;  3S0Z A;  1XM8 A;  4AXH A;  5EV8 A;  3SW3 A;  2FK6 A;  2BR6 A;  5ACS A;  4UA4 A;  1X8H A;  3I0V A;  4FSB A;  2P1E A;  5LSC A;  5HH5 A;  4D02 A;  5ACP A;  2AIO A;  5FQA A;  5AXO A;  4ZNB A;  1BVT A;  5LCF A;  3ESH A;  2BFL A;  3X30 A;  2NZE A;  3RPC A;  1SML A;  5A87 A;  3ZNB A;  5B3R A;  5AXR A;  2OHI A;  2DOO A;  1WRA A;  1WUP A;  3PG4 A;  3X2X A;  3SPU A;  4HKY A;  1Y44 A;  5FQB A;  4PVT A;  4GCW A;  4C09 A;  3A4Y A;  3AJ3 A;  1E5D A;  4UAM A;  2YHE A;  4DIK A;  5B15 A;  5EVB A;  5K0W A;  4D1U A;  2BTN A;  2YCB A;  4EYB A;  1XTO A;  4Z6X A;  4ZO3 A;  3PY6 A;  2ZO4 A;  3SD9 A;  4NQ6 A;  3L6N A;  4JO0 A;  4NQ4 A;  1DDK A;  4HL2 A;  5EHT A;  3VPE A;  2H6A A;  2GCU A;  1MQO A;  2I7V A;  5AHR A;  4LE6 A;  5ACX A;  3IE1 A;  4Z67 A;  2M5D A;  3MD7 A;  2CFU A;  5LLD A;  5ACU A;  5EVD A;  4Z60 A;  4WD6 A;  4C1D A;  5LCH A;  3ADR A;  4AD9 A;  1WUO A;  2GFJ A;  3BK1 A;  4BP0 A;  4ZEJ A;  3I15 A;  2FHX B;  3IE0 A;  2M5C A;  4PVO A;  2NZF A;  2BG6 A;  3P2U A;  5AJL A;  4ZO2 A;  3IDZ A;  2BG8 B;  5EV6 A;  1A8T A;  4EYF A;  1A7T A;  2WYL A;  3SFP A;  5HIP A;  2QED A;  3IEK A;  4AV7 A;  4FR7 A;  3T3O A;  5LMC A;  5AHO A;  2ZWR A;  2FU6 A;  2XF4 A;  1KO2 A;  1JT1 A;  2I7T A;  4YSK A;  3BV6 A;  4O98 A;  1WW1 A;  2CG3 A;  1JJT A;  4KEP A;  3T3N A;  3I13 A;  3ZWF A;  1ZTC A;  5ACT A;  2YNV A;  4D1T A;  2FM6 A;  4TYT A;  4B87 A;  3JXP A;  2P18 A;  1K07 A;  2QJS A;  2ZNB A;  5ACV A;  4PDX A;  2FU9 A;  5LE1 A;  4AX1 B;  5KIL A;  3G1P A;  4NQ2 A;  2E7Y A;  5FQC A;  4RBS A;  5K4N A;  5AYA A;  4RAM A;  2WYM A;  3X2Z A;  2OHH A;  2P4Z A;  5EVK A;  5DPX A;  3BK2 A;  4H0D A;  5AEB A;  3IEL A;  3RKK A;  2BG7 A;  5HIQ A;  2DKF A;  1M2X A;  4DIL A;  1BC2 A;  5ACQ A;  3T9M A;  2NXA A;  2A7M A;  5A0V A;  4GYU A;  4EYL A;  4NQ5 A;  5B1U A;  1YCF A;  5K4M A;  3AF6 A;  1VGN A;  5KIK A;  5IQK A;  2BFZ A;  4J5F A;  1QH3 A;  2Y8A A;  5HH6 A;  4UWS B;  4BZ3 A;  4F6Z A;  5EH9 A;  3VQZ A;  3KNS A;  2CG2 A;  3X2Y A;  2UYX A;  4F6H A;  4UWR B;  4FEK A;  5K4K A;  3DHC A;  4TZE A;  3LVZ A;  4C1E A;  5LS3 A;  2AZ4 A;  1DXK A;  2ZZI A;  2CFZ A;  4NUR A;  4D1W A;  2Q0J A;  4TZF A;  2BGA A;  2WYM C;  1QH5 A;  4C1H A;  2BFK A;  3RKJ A;  2YNV B;  3IEM A;  5LM6 A;  1BMC A;  5EW0 A;  3I14 A;  3IOG A;  4D1V A;  2Q42 A;  4XUK A;  4Z5Z A;  2BG2 A;  4C1F A;  1HLK A;  2Q9U A;  2YNT A;  2OHJ A;  3TP9 A;  2BMI A;  3ZR9 A; 
#chains in the Genus database with same CATH homology
 5LCA A;  1P9E A;  4AWZ A;  2I7X A;  4V0H A;  4EY2 A;  4RAW A;  3KL7 A;  1VJN A;  2BIB A;  3SBL A;  3AF5 A;  4UWO B;  1KO3 A;  4EXS A;  3QH8 A;  4XWT A;  3FCZ A;  1YCH A;  4TZB A;  1DD6 A;  2BC2 A;  4XWW A;  3DH8 A;  4CHL A;  2Q0I A;  2QDS A;  3DHA A;  3IE2 A;  4YSL A;  2NYP A;  5ACR A;  2QDT A;  4TYF A;  4RM5 A;  3Q6V A;  3ZQ4 A;  2YZ3 A;  3I11 A;  2BFZ B;  4U4L A;  4KEQ A;  5A0T A;  3F9O A;  4RL2 A;  2VW8 A;  5A5Z A;  2YNW A;  4P62 A;  2WHG A;  4UBQ A;  1KR3 A;  4J5H A;  5HH4 A;  4GYQ A;  2FU8 A;  1X8I A;  4HL1 A;  2CBN A;  3KNR A;  4Z5Y A;  3R2U A;  3IOF A;  3PY5 A;  2GKL A;  5ACW A;  2R2D A;  3BC2 A;  5HIO A;  3FAI A;  4Z7R A;  3H3E A;  1ZNB A;  1YCG A;  2Y87 A;  3SRX A;  4C1C A;  4EFZ A;  2GFK A;  2YNU A;  2XR1 A;  4RL0 A;  4AWY B;  2WRS A;  1L9Y A;  2FHX A;  5HIS A;  4C1G A;  4TZ9 A;  3DHB A;  1VME A;  1JJE A;  4EXY A;  2YNT B;  5EWA A;  2BG8 A;  2Y8B A;  4AX0 B;  2P97 A;  4UWP B;  2FU7 A;  3WXC A;  2GMN A;  1ZKP A;  1X8G A;  2HB9 A;  4YSB A;  2QIN A;  3S0Z A;  1XM8 A;  5EV8 A;  3SW3 A;  2FK6 A;  2BR6 A;  5ACS A;  4UA4 A;  1X8H A;  3I0V A;  4FSB A;  2P1E A;  5LSC A;  5HH5 A;  4D02 A;  5ACP A;  2AIO A;  5FQA A;  5AXO A;  4ZNB A;  1BVT A;  5LCF A;  3ESH A;  2BFL A;  3X30 A;  2NZE A;  3RPC A;  1SML A;  5A87 A;  3ZNB A;  5B3R A;  5AXR A;  2OHI A;  2DOO A;  1WRA A;  1WUP A;  3PG4 A;  3X2X A;  3SPU A;  4HKY A;  1Y44 A;  5FQB A;  4PVT A;  4GCW A;  4C09 A;  3A4Y A;  3AJ3 A;  1E5D A;  4UAM A;  4DIK A;  5B15 A;  5EVB A;  5K0W A;  4D1U A;  2BTN A;  2YCB A;  4EYB A;  1XTO A;  4Z6X A;  4ZO3 A;  3PY6 A;  2ZO4 A;  3SD9 A;  4NQ6 A;  3L6N A;  4JO0 A;  4NQ4 A;  1DDK A;  4HL2 A;  5EHT A;  3VPE A;  2H6A A;  2GCU A;  1MQO A;  2I7V A;  5AHR A;  4LE6 A;  5ACX A;  3IE1 A;  4Z67 A;  2M5D A;  3MD7 A;  5LLD A;  5ACU A;  5EVD A;  4Z60 A;  4WD6 A;  4C1D A;  5LCH A;  3ADR A;  4AD9 A;  1WUO A;  2GFJ A;  3BK1 A;  4BP0 A;  4ZEJ A;  3I15 A;  2FHX B;  3IE0 A;  2M5C A;  4PVO A;  2NZF A;  2BG6 A;  3P2U A;  4ZO2 A;  3IDZ A;  2BG8 B;  5EV6 A;  1A8T A;  4EYF A;  1A7T A;  2WYL A;  3SFP A;  5HIP A;  2QED A;  3IEK A;  4FR7 A;  3T3O A;  5LMC A;  5AHO A;  2ZWR A;  2FU6 A;  2XF4 A;  1KO2 A;  1JT1 A;  2I7T A;  4YSK A;  3BV6 A;  4O98 A;  1WW1 A;  1JJT A;  4KEP A;  3T3N A;  3I13 A;  3ZWF A;  1ZTC A;  5ACT A;  2YNV A;  4D1T A;  2FM6 A;  4TYT A;  4B87 A;  3JXP A;  2P18 A;  1K07 A;  2QJS A;  2ZNB A;  5ACV A;  5LE1 A;  2FU9 A;  4AX1 B;  5KIL A;  3G1P A;  4NQ2 A;  2E7Y A;  5FQC A;  4RBS A;  5K4N A;  5AYA A;  4RAM A;  2WYM A;  3X2Z A;  2OHH A;  2P4Z A;  5EVK A;  5DPX A;  3BK2 A;  4H0D A;  5AEB A;  3IEL A;  3RKK A;  2BG7 A;  5HIQ A;  2DKF A;  1M2X A;  4DIL A;  1BC2 A;  5ACQ A;  3T9M A;  2NXA A;  2A7M A;  5A0V A;  4GYU A;  4EYL A;  4NQ5 A;  5B1U A;  1YCF A;  5K4M A;  3AF6 A;  1VGN A;  5KIK A;  5IQK A;  2BFZ A;  4J5F A;  1QH3 A;  2Y8A A;  5HH6 A;  4UWS B;  4BZ3 A;  4F6Z A;  5EH9 A;  3VQZ A;  3KNS A;  3X2Y A;  2UYX A;  4F6H A;  4UWR B;  4FEK A;  5K4K A;  3DHC A;  4TZE A;  3LVZ A;  4C1E A;  5LS3 A;  2AZ4 A;  1DXK A;  2ZZI A;  4D1W A;  2Q0J A;  4TZF A;  2BGA A;  2WYM C;  1QH5 A;  4C1H A;  2BFK A;  3RKJ A;  2YNV B;  3IEM A;  5LM6 A;  1BMC A;  5EW0 A;  3I14 A;  3IOG A;  4D1V A;  2Q42 A;  4XUK A;  4Z5Z A;  2BG2 A;  4C1F A;  1HLK A;  2Q9U A;  2YNT A;  2OHJ A;  3TP9 A;  2BMI A;  3ZR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...