4KEQA

Crystal structure of 4-pyridoxolactonase, 5-pyridoxolactone bound
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
270
structure length
270
Chain Sequence
DTKVYLLDGGSLVLDGYHVFWNRGPGGEVRFPVYSILIEHAEGRFLIDTGYDYDHVMKVLPFEKPIQEKHQTIPGALGLLGLEPRDIDVVVNSHFHFDHCGGNKYFPHAKKICHRSEVPQACNPQPFEHLGYSDLSFSAEAAEARGATAQLLEGTTRANSTFEGIDGDVDLARGVKLISTPGHSIGHYSLLVEFPRRKPILFTIDAAYTQKSLETLCQAAFHIDPVAGVNSMRKVKKLAEDHGAELMYSHDMDNFKTYRTGTQFYGHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 4-pyridoxolactonase
publication title Structure of 4-pyridoxolactonase from Mesorhizobium loti
doi rcsb
source organism Mesorhizobium loti
total genus 89
structure length 270
sequence length 270
ec nomenclature ec 3.1.1.27: 4-pyridoxolactonase.
pdb deposition date 2013-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4keqA00
2I7XA 2NXAA 3T3OA 3IEKA 2QDSA 3IELA 3RPCA 1SMLA 2Y87A 3IE0A 5HH4A 3KNRA 4C1EA 5ACWA 5LCFA 5ACQA 1BVTA 4UWRB 3PG4A 4BP0A 2WYLA 1DDKA 5A5ZA 2P4ZA 2FU7A 5HIOA 2ZWRA 5FQBA 1KR3A 5LSCA 4AX0B 2YNTA 5EH9A 5EWAA 2BTNA 4D1UA 2AIOA 2GKLA 5FQCA 4Z5ZA 4GCWA 1QH3A 2YNWA 3I0VA 2BG7A 5ACVA 2BFZA 4NQ5A 5LCAA 4Z6XA 1DD6A 3QH8A 3RKKA 2AZ4A 5LE1A 1KO2A 4EY2A 4TYTA 4CHLA 2YZ3A 5K4KA 3SPUA 4WD6A 3SW3A 5AXRA 3WXCA 3SFPA 2GFKA 1Y44A 2BGAA 2BFKA 2NYPA 5KILA 2Q0IA 3ADRA 4RAWA 3X2ZA 1K07A 4YSKA 4RBSA 2BG2A 2YNUA 3PY6A 4PVOA 3I14A 5DPXA 2FU9A 4P62A 5A0VA 2I7VA 3AF6A 2H6AA 5AYAA 2Y8BA 4ZNBA 2R2DA 4C1FA 3IOGA 3BC2A 3RKJA 2Q9UA 4TZEA 2WYMC 3VPEA 2Y8AA 4XUKA 4KEQA 5ACSA 3JXPA 1XM8A 2OHJA 2ZNBA 2XF4A 1M2XA 4C1DA 2P1EA 5EV8A 4D02A 3PY5A 5K0WA 3IE2A 4FSBA 1ZKPA 2BR6A 4HKYA 3DH8A 3A4YA 4HL1A 2YNVA 1E5DA 1JJEA 3Q6VA 5B3RA 1YCGA 5EV6A 3BV6A 2BC2A 3SBLA 2QDTA 3DHAA 5ACUA 2FU8A 4DILA 3IOFA 4UAMA 2Q42A 3ZQ4A 5LM6A 3LVZA 1VGNA 5IQKA 4J5HA 5EVKA 5A0TA 4XWTA 1X8GA 2QEDA 4FEKA 3ZWFA 3I11A 2VW8A 4LE6A 5ACPA 4BZ3A 1WUOA 2BG6A 2BG8B 4TZFA 2FU6A 2FHXB 4EXSA 2NZEA 2P18A 4NQ2A 5K4MA 2UYXA 1KO3A 4TZBA 2DKFA 5LCHA 2FK6A 4TZ9A 4KEPA 4XWWA 4RM5A 2HB9A 1JT1A 4AX1B 1A8TA 1BMCA 3VQZA 2P97A 5ACXA 4HL2A 4D1VA 3BK2A 1BC2A 4Z7RA 1HLKA 2BIBA 5K4NA 3P2UA 4TYFA 3IE1A 1X8IA 3DHCA 2WHGA 3ESHA 4AWYB 2E7YA 3AJ3A 5HH5A 4NQ6A 3X30A 4EFZA 5ACRA 2QJSA 2M5CA 2ZO4A 3AF5A 4UWPB 3IEMA 1L9YA 2DOOA 4YSBA 5EVDA 5EHTA 4ZEJA 3TP9A 4EXYA 2OHHA 3MD7A 3G1PA 4Z60A 3S0ZA 3FCZA 4UWOB 4PVTA 5AEBA 5AHOA 4F6ZA 4JO0A 1A7TA 1P9EA 5HIQA 4AWZA 5HH6A 4J5FA 5KIKA 3T3NA 2A7MA 1X8HA 5AXOA 2YNTB 4F6HA 4GYUA 3ZR9A 4C1HA 3BK1A 4EYBA 4RL0A 4U4LA 4UWSB 5LLDA 3H3EA 4V0HA 1QH5A 4AD9A 3T9MA 4FR7A 2BFZB 1MQOA 2BFLA 2XR1A 3R2UA 1YCFA 3IDZA 3X2YA 2GCUA 4B87A 4C1CA 4YSLA 4Z67A 2M5DA 2WYMA 4C09A 4NQ4A 1VMEA 1DXKA 2BMIA 3ZNBA 1WW1A 3SD9A 4RL2A 2I7TA 5EVBA 3FAIA 2GMNA 2NZFA 5HIPA 2FM6A 1VJNA 4RAMA 4ZO2A 5AHRA 1XTOA 4UA4A 4C1GA 1WUPA 2OHIA 2BG8A 3SRXA 2FHXA 4Z5YA 1WRAA 1ZTCA 2QINA 2YCBA 3X2XA 2WRSA 4GYQA 4D1TA 2Q0JA 3F9OA 3L6NA 2ZZIA 2GFJA 4ZO3A 3I15A 2CBNA 4EYLA 4O98A 3KL7A 5FQAA 3I13A 4DIKA 4D1WA 5B1UA 1YCHA 3KNSA 5B15A 5LS3A 1ZNBA 5HISA 1JJTA 4UBQA 4H0DA 2YNVB 3DHBA 5A87A 5LMCA 4EYFA 5EW0A 5ACTA
chains in the Genus database with same CATH superfamily
2I7XA 2NXAA 3T3OA 3IEKA 2QDSA 3IELA 3RPCA 1SMLA 2Y87A 3IE0A 5HH4A 3KNRA 4C1EA 5ACWA 5LCFA 5ACQA 1BVTA 4UWRB 3PG4A 4BP0A 2WYLA 1DDKA 5A5ZA 2P4ZA 2FU7A 5HIOA 2ZWRA 5FQBA 1KR3A 5LSCA 4AX0B 2YNTA 5EH9A 5EWAA 2BTNA 4D1UA 2AIOA 2GKLA 5FQCA 4Z5ZA 4GCWA 1QH3A 2YNWA 3I0VA 2BG7A 5ACVA 2BFZA 4NQ5A 5LCAA 4Z6XA 1DD6A 3QH8A 3RKKA 2AZ4A 5LE1A 1KO2A 5A23A 4EY2A 4TYTA 4CHLA 2YZ3A 5K4KA 3SPUA 4WD6A 3SW3A 5AXRA 3WXCA 3SFPA 2GFKA 1Y44A 2BGAA 2BFKA 2NYPA 5KILA 2Q0IA 3ADRA 4RAWA 3X2ZA 1K07A 4YSKA 4RBSA 2BG2A 2YNUA 3PY6A 4NURA 4PVOA 3I14A 5DPXA 2FU9A 4P62A 5A0VA 2I7VA 3AF6A 2H6AA 5AYAA 2Y8BA 4ZNBA 2R2DA 4C1FA 3IOGA 3BC2A 3RKJA 2Q9UA 4TZEA 2WYMC 3VPEA 2Y8AA 4XUKA 4KEQA 5ACSA 3JXPA 1XM8A 2OHJA 2ZNBA 2XF4A 1M2XA 4C1DA 2P1EA 5EV8A 4D02A 3PY5A 5K0WA 3IE2A 4FSBA 4AV7A 1ZKPA 2BR6A 4HKYA 3DH8A 3A4YA 4HL1A 2YNVA 1E5DA 1JJEA 3Q6VA 5B3RA 1YCGA 5EV6A 3BV6A 2BC2A 3SBLA 2QDTA 3DHAA 5ACUA 2FU8A 4DILA 3IOFA 4UAMA 2Q42A 3ZQ4A 2CG2A 5LM6A 3LVZA 1VGNA 5IQKA 4J5HA 5EVKA 5A0TA 4XWTA 1X8GA 2QEDA 4FEKA 3ZWFA 3I11A 2VW8A 4LE6A 5ACPA 4BZ3A 1WUOA 2BG6A 2BG8B 4TZFA 2FU6A 2FHXB 4EXSA 2CFZA 2NZEA 2P18A 4PDXA 4NQ2A 5K4MA 2UYXA 1KO3A 4TZBA 2DKFA 5LCHA 2FK6A 5AJLA 4TZ9A 4KEPA 4XWWA 4RM5A 2HB9A 1JT1A 4AX1B 1A8TA 1BMCA 3VQZA 2P97A 5ACXA 4HL2A 4D1VA 3BK2A 1BC2A 4Z7RA 1HLKA 5AIJA 2BIBA 5K4NA 3P2UA 4TYFA 3IE1A 1X8IA 3DHCA 2WHGA 3ESHA 4AWYB 2E7YA 3AJ3A 5HH5A 4NQ6A 3X30A 4EFZA 2CFUA 5ACRA 2QJSA 2M5CA 2ZO4A 3AF5A 4AXHA 4UWPB 3IEMA 1L9YA 2DOOA 4YSBA 5EVDA 5EHTA 4ZEJA 3TP9A 4EXYA 2OHHA 3MD7A 3G1PA 4Z60A 3S0ZA 3FCZA 4UWOB 4PVTA 5AEBA 5AHOA 4F6ZA 4JO0A 1A7TA 1P9EA 5HIQA 4AWZA 5HH6A 4J5FA 5KIKA 3T3NA 2A7MA 1X8HA 5AXOA 2YNTB 4F6HA 4GYUA 3ZR9A 4C1HA 3BK1A 4EYBA 4RL0A 4U4LA 4UWSB 5LLDA 3H3EA 4V0HA 1QH5A 4AD9A 3T9MA 4FR7A 2BFZB 1MQOA 2YHEA 2BFLA 2XR1A 3R2UA 1YCFA 3IDZA 3X2YA 2GCUA 4B87A 4C1CA 4YSLA 4Z67A 2M5DA 2WYMA 4C09A 4NQ4A 1VMEA 1DXKA 2BMIA 3ZNBA 1WW1A 3SD9A 4RL2A 2I7TA 5EVBA 3FAIA 2GMNA 2NZFA 5HIPA 2FM6A 1VJNA 4RAMA 4ZO2A 5AHRA 1XTOA 4UA4A 4C1GA 1WUPA 2OHIA 2BG8A 3SRXA 2FHXA 4Z5YA 1WRAA 1ZTCA 2QINA 2YCBA 3X2XA 2WRSA 4GYQA 4D1TA 2Q0JA 3F9OA 3L6NA 2ZZIA 2GFJA 4ZO3A 3I15A 2CBNA 4EYLA 4O98A 3KL7A 5FQAA 3I13A 4DIKA 2CG3A 4D1WA 5B1UA 1YCHA 3KNSA 5B15A 5LS3A 1ZNBA 5HISA 1JJTA 4UBQA 4H0DA 2YNVB 3DHBA 5A87A 5LMCA 4EYFA 5EW0A 5ACTA
chains in the Genus database with same CATH topology
2I7XA 2NXAA 3T3OA 3IEKA 2QDSA 3IELA 3RPCA 1SMLA 2Y87A 3IE0A 5HH4A 3KNRA 4C1EA 5ACWA 5LCFA 5ACQA 1BVTA 4UWRB 3PG4A 4BP0A 2WYLA 1DDKA 5A5ZA 2P4ZA 2FU7A 5HIOA 2ZWRA 5FQBA 1KR3A 5LSCA 4AX0B 2YNTA 5EH9A 5EWAA 2BTNA 4D1UA 2AIOA 2GKLA 5FQCA 4Z5ZA 4GCWA 1QH3A 2YNWA 3I0VA 2BG7A 5ACVA 2BFZA 4NQ5A 5LCAA 4Z6XA 1DD6A 3QH8A 3RKKA 2AZ4A 5LE1A 1KO2A 4EY2A 4TYTA 4CHLA 2YZ3A 5K4KA 3SPUA 4WD6A 3SW3A 5AXRA 3WXCA 3SFPA 2GFKA 1Y44A 2BGAA 2BFKA 2NYPA 5KILA 2Q0IA 3ADRA 4RAWA 3X2ZA 1K07A 4YSKA 4RBSA 2BG2A 2YNUA 3PY6A 4PVOA 3I14A 5DPXA 2FU9A 4P62A 5A0VA 2I7VA 3AF6A 2H6AA 5AYAA 2Y8BA 4ZNBA 2R2DA 4C1FA 3IOGA 3BC2A 3RKJA 2Q9UA 4TZEA 2WYMC 3VPEA 2Y8AA 4XUKA 4KEQA 5ACSA 3JXPA 1XM8A 2OHJA 2ZNBA 2XF4A 1M2XA 4C1DA 2P1EA 5EV8A 4D02A 3PY5A 5K0WA 3IE2A 4FSBA 1ZKPA 2BR6A 4HKYA 3DH8A 3A4YA 4HL1A 2YNVA 1E5DA 1JJEA 3Q6VA 5B3RA 1YCGA 5EV6A 3BV6A 2BC2A 3SBLA 2QDTA 3DHAA 5ACUA 2FU8A 4DILA 3IOFA 4UAMA 2Q42A 3ZQ4A 5LM6A 3LVZA 1VGNA 5IQKA 4J5HA 5EVKA 5A0TA 4XWTA 1X8GA 2QEDA 4FEKA 3ZWFA 3I11A 2VW8A 4LE6A 5ACPA 4BZ3A 1WUOA 2BG6A 2BG8B 4TZFA 2FU6A 2FHXB 4EXSA 2NZEA 2P18A 4NQ2A 5K4MA 2UYXA 1KO3A 4TZBA 2DKFA 5LCHA 2FK6A 4TZ9A 4KEPA 4XWWA 4RM5A 2HB9A 1JT1A 4AX1B 1A8TA 1BMCA 3VQZA 2P97A 5ACXA 4HL2A 4D1VA 3BK2A 1BC2A 4Z7RA 1HLKA 2BIBA 5K4NA 3P2UA 4TYFA 3IE1A 1X8IA 3DHCA 2WHGA 3ESHA 4AWYB 2E7YA 3AJ3A 5HH5A 4NQ6A 3X30A 4EFZA 5ACRA 2QJSA 2M5CA 2ZO4A 3AF5A 4UWPB 3IEMA 1L9YA 2DOOA 4YSBA 5EVDA 5EHTA 4ZEJA 3TP9A 4EXYA 2OHHA 3MD7A 3G1PA 4Z60A 3S0ZA 3FCZA 4UWOB 4PVTA 5AEBA 5AHOA 4F6ZA 4JO0A 1A7TA 1P9EA 5HIQA 4AWZA 5HH6A 4J5FA 5KIKA 3T3NA 2A7MA 1X8HA 5AXOA 2YNTB 4F6HA 4GYUA 3ZR9A 4C1HA 3BK1A 4EYBA 4RL0A 4U4LA 4UWSB 5LLDA 3H3EA 4V0HA 1QH5A 4AD9A 3T9MA 4FR7A 2BFZB 1MQOA 2BFLA 2XR1A 3R2UA 1YCFA 3IDZA 3X2YA 2GCUA 4B87A 4C1CA 4YSLA 4Z67A 2M5DA 2WYMA 4C09A 4NQ4A 1VMEA 1DXKA 2BMIA 3ZNBA 1WW1A 3SD9A 4RL2A 2I7TA 5EVBA 3FAIA 2GMNA 2NZFA 5HIPA 2FM6A 1VJNA 4RAMA 4ZO2A 5AHRA 1XTOA 4UA4A 4C1GA 1WUPA 2OHIA 2BG8A 3SRXA 2FHXA 4Z5YA 1WRAA 1ZTCA 2QINA 2YCBA 3X2XA 2WRSA 4GYQA 4D1TA 2Q0JA 3F9OA 3L6NA 2ZZIA 2GFJA 4ZO3A 3I15A 2CBNA 4EYLA 4O98A 3KL7A 5FQAA 3I13A 4DIKA 4D1WA 5B1UA 1YCHA 3KNSA 5B15A 5LS3A 1ZNBA 5HISA 1JJTA 4UBQA 4H0DA 2YNVB 3DHBA 5A87A 5LMCA 4EYFA 5EW0A 5ACTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I7X A;  2NXA A;  3T3O A;  3IEK A;  2QDS A;  3IEL A;  3RPC A;  1SML A;  2Y87 A;  3IE0 A;  5HH4 A;  3KNR A;  4C1E A;  5ACW A;  5LCF A;  5ACQ A;  1BVT A;  4UWR B;  3PG4 A;  4BP0 A;  2WYL A;  1DDK A;  5A5Z A;  2P4Z A;  2FU7 A;  5HIO A;  2ZWR A;  5FQB A;  1KR3 A;  5LSC A;  4AX0 B;  2YNT A;  5EH9 A;  5EWA A;  2BTN A;  4D1U A;  2AIO A;  2GKL A;  5FQC A;  4Z5Z A;  4GCW A;  1QH3 A;  2YNW A;  3I0V A;  2BG7 A;  5ACV A;  2BFZ A;  4NQ5 A;  5LCA A;  4Z6X A;  1DD6 A;  3QH8 A;  3RKK A;  2AZ4 A;  5LE1 A;  1KO2 A;  4EY2 A;  4TYT A;  4CHL A;  2YZ3 A;  5K4K A;  3SPU A;  4WD6 A;  3SW3 A;  5AXR A;  3WXC A;  3SFP A;  2GFK A;  1Y44 A;  2BGA A;  2BFK A;  2NYP A;  5KIL A;  2Q0I A;  3ADR A;  4RAW A;  3X2Z A;  1K07 A;  4YSK A;  4RBS A;  2BG2 A;  2YNU A;  3PY6 A;  4PVO A;  3I14 A;  5DPX A;  2FU9 A;  4P62 A;  5A0V A;  2I7V A;  3AF6 A;  2H6A A;  5AYA A;  2Y8B A;  4ZNB A;  2R2D A;  4C1F A;  3IOG A;  3BC2 A;  3RKJ A;  2Q9U A;  4TZE A;  2WYM C;  3VPE A;  2Y8A A;  4XUK A;  4KEQ A;  5ACS A;  3JXP A;  1XM8 A;  2OHJ A;  2ZNB A;  2XF4 A;  1M2X A;  4C1D A;  2P1E A;  5EV8 A;  4D02 A;  3PY5 A;  5K0W A;  3IE2 A;  4FSB A;  1ZKP A;  2BR6 A;  4HKY A;  3DH8 A;  3A4Y A;  4HL1 A;  2YNV A;  1E5D A;  1JJE A;  3Q6V A;  5B3R A;  1YCG A;  5EV6 A;  3BV6 A;  2BC2 A;  3SBL A;  2QDT A;  3DHA A;  5ACU A;  2FU8 A;  4DIL A;  3IOF A;  4UAM A;  2Q42 A;  3ZQ4 A;  5LM6 A;  3LVZ A;  1VGN A;  5IQK A;  4J5H A;  5EVK A;  5A0T A;  4XWT A;  1X8G A;  2QED A;  4FEK A;  3ZWF A;  3I11 A;  2VW8 A;  4LE6 A;  5ACP A;  4BZ3 A;  1WUO A;  2BG6 A;  2BG8 B;  4TZF A;  2FU6 A;  2FHX B;  4EXS A;  2NZE A;  2P18 A;  4NQ2 A;  5K4M A;  2UYX A;  1KO3 A;  4TZB A;  2DKF A;  5LCH A;  2FK6 A;  4TZ9 A;  4KEP A;  4XWW A;  4RM5 A;  2HB9 A;  1JT1 A;  4AX1 B;  1A8T A;  1BMC A;  3VQZ A;  2P97 A;  5ACX A;  4HL2 A;  4D1V A;  3BK2 A;  1BC2 A;  4Z7R A;  1HLK A;  2BIB A;  5K4N A;  3P2U A;  4TYF A;  3IE1 A;  1X8I A;  3DHC A;  2WHG A;  3ESH A;  4AWY B;  2E7Y A;  3AJ3 A;  5HH5 A;  4NQ6 A;  3X30 A;  4EFZ A;  5ACR A;  2QJS A;  2M5C A;  2ZO4 A;  3AF5 A;  4UWP B;  3IEM A;  1L9Y A;  2DOO A;  4YSB A;  5EVD A;  5EHT A;  4ZEJ A;  3TP9 A;  4EXY A;  2OHH A;  3MD7 A;  3G1P A;  4Z60 A;  3S0Z A;  3FCZ A;  4UWO B;  4PVT A;  5AEB A;  5AHO A;  4F6Z A;  4JO0 A;  1A7T A;  1P9E A;  5HIQ A;  4AWZ A;  5HH6 A;  4J5F A;  5KIK A;  3T3N A;  2A7M A;  1X8H A;  5AXO A;  2YNT B;  4F6H A;  4GYU A;  3ZR9 A;  4C1H A;  3BK1 A;  4EYB A;  4RL0 A;  4U4L A;  4UWS B;  5LLD A;  3H3E A;  4V0H A;  1QH5 A;  4AD9 A;  3T9M A;  4FR7 A;  2BFZ B;  1MQO A;  2BFL A;  2XR1 A;  3R2U A;  1YCF A;  3IDZ A;  3X2Y A;  2GCU A;  4B87 A;  4C1C A;  4YSL A;  4Z67 A;  2M5D A;  2WYM A;  4C09 A;  4NQ4 A;  1VME A;  1DXK A;  2BMI A;  3ZNB A;  1WW1 A;  3SD9 A;  4RL2 A;  2I7T A;  5EVB A;  3FAI A;  2GMN A;  2NZF A;  5HIP A;  2FM6 A;  1VJN A;  4RAM A;  4ZO2 A;  5AHR A;  1XTO A;  4UA4 A;  4C1G A;  1WUP A;  2OHI A;  2BG8 A;  3SRX A;  2FHX A;  4Z5Y A;  1WRA A;  1ZTC A;  2QIN A;  2YCB A;  3X2X A;  2WRS A;  4GYQ A;  4D1T A;  2Q0J A;  3F9O A;  3L6N A;  2ZZI A;  2GFJ A;  4ZO3 A;  3I15 A;  2CBN A;  4EYL A;  4O98 A;  3KL7 A;  5FQA A;  3I13 A;  4DIK A;  4D1W A;  5B1U A;  1YCH A;  3KNS A;  5B15 A;  5LS3 A;  1ZNB A;  5HIS A;  1JJT A;  4UBQ A;  4H0D A;  2YNV B;  3DHB A;  5A87 A;  5LMC A;  4EYF A;  5EW0 A;  5ACT A; 
#chains in the Genus database with same CATH topology
 2I7X A;  2NXA A;  3T3O A;  3IEK A;  2QDS A;  3IEL A;  3RPC A;  1SML A;  2Y87 A;  3IE0 A;  5HH4 A;  3KNR A;  4C1E A;  5ACW A;  5LCF A;  5ACQ A;  1BVT A;  4UWR B;  3PG4 A;  4BP0 A;  2WYL A;  1DDK A;  5A5Z A;  2P4Z A;  2FU7 A;  5HIO A;  2ZWR A;  5FQB A;  1KR3 A;  5LSC A;  4AX0 B;  2YNT A;  5EH9 A;  5EWA A;  2BTN A;  4D1U A;  2AIO A;  2GKL A;  5FQC A;  4Z5Z A;  4GCW A;  1QH3 A;  2YNW A;  3I0V A;  2BG7 A;  5ACV A;  2BFZ A;  4NQ5 A;  5LCA A;  4Z6X A;  1DD6 A;  3QH8 A;  3RKK A;  2AZ4 A;  5LE1 A;  1KO2 A;  5A23 A;  4EY2 A;  4TYT A;  4CHL A;  2YZ3 A;  5K4K A;  3SPU A;  4WD6 A;  3SW3 A;  5AXR A;  3WXC A;  3SFP A;  2GFK A;  1Y44 A;  2BGA A;  2BFK A;  2NYP A;  5KIL A;  2Q0I A;  3ADR A;  4RAW A;  3X2Z A;  1K07 A;  4YSK A;  4RBS A;  2BG2 A;  2YNU A;  3PY6 A;  4NUR A;  4PVO A;  3I14 A;  5DPX A;  2FU9 A;  4P62 A;  5A0V A;  2I7V A;  3AF6 A;  2H6A A;  5AYA A;  2Y8B A;  4ZNB A;  2R2D A;  4C1F A;  3IOG A;  3BC2 A;  3RKJ A;  2Q9U A;  4TZE A;  2WYM C;  3VPE A;  2Y8A A;  4XUK A;  4KEQ A;  5ACS A;  3JXP A;  1XM8 A;  2OHJ A;  2ZNB A;  2XF4 A;  1M2X A;  4C1D A;  2P1E A;  5EV8 A;  4D02 A;  3PY5 A;  5K0W A;  3IE2 A;  4FSB A;  4AV7 A;  1ZKP A;  2BR6 A;  4HKY A;  3DH8 A;  3A4Y A;  4HL1 A;  2YNV A;  1E5D A;  1JJE A;  3Q6V A;  5B3R A;  1YCG A;  5EV6 A;  3BV6 A;  2BC2 A;  3SBL A;  2QDT A;  3DHA A;  5ACU A;  2FU8 A;  4DIL A;  3IOF A;  4UAM A;  2Q42 A;  3ZQ4 A;  2CG2 A;  5LM6 A;  3LVZ A;  1VGN A;  5IQK A;  4J5H A;  5EVK A;  5A0T A;  4XWT A;  1X8G A;  2QED A;  4FEK A;  3ZWF A;  3I11 A;  2VW8 A;  4LE6 A;  5ACP A;  4BZ3 A;  1WUO A;  2BG6 A;  2BG8 B;  4TZF A;  2FU6 A;  2FHX B;  4EXS A;  2CFZ A;  2NZE A;  2P18 A;  4PDX A;  4NQ2 A;  5K4M A;  2UYX A;  1KO3 A;  4TZB A;  2DKF A;  5LCH A;  2FK6 A;  5AJL A;  4TZ9 A;  4KEP A;  4XWW A;  4RM5 A;  2HB9 A;  1JT1 A;  4AX1 B;  1A8T A;  1BMC A;  3VQZ A;  2P97 A;  5ACX A;  4HL2 A;  4D1V A;  3BK2 A;  1BC2 A;  4Z7R A;  1HLK A;  5AIJ A;  2BIB A;  5K4N A;  3P2U A;  4TYF A;  3IE1 A;  1X8I A;  3DHC A;  2WHG A;  3ESH A;  4AWY B;  2E7Y A;  3AJ3 A;  5HH5 A;  4NQ6 A;  3X30 A;  4EFZ A;  2CFU A;  5ACR A;  2QJS A;  2M5C A;  2ZO4 A;  3AF5 A;  4AXH A;  4UWP B;  3IEM A;  1L9Y A;  2DOO A;  4YSB A;  5EVD A;  5EHT A;  4ZEJ A;  3TP9 A;  4EXY A;  2OHH A;  3MD7 A;  3G1P A;  4Z60 A;  3S0Z A;  3FCZ A;  4UWO B;  4PVT A;  5AEB A;  5AHO A;  4F6Z A;  4JO0 A;  1A7T A;  1P9E A;  5HIQ A;  4AWZ A;  5HH6 A;  4J5F A;  5KIK A;  3T3N A;  2A7M A;  1X8H A;  5AXO A;  2YNT B;  4F6H A;  4GYU A;  3ZR9 A;  4C1H A;  3BK1 A;  4EYB A;  4RL0 A;  4U4L A;  4UWS B;  5LLD A;  3H3E A;  4V0H A;  1QH5 A;  4AD9 A;  3T9M A;  4FR7 A;  2BFZ B;  1MQO A;  2YHE A;  2BFL A;  2XR1 A;  3R2U A;  1YCF A;  3IDZ A;  3X2Y A;  2GCU A;  4B87 A;  4C1C A;  4YSL A;  4Z67 A;  2M5D A;  2WYM A;  4C09 A;  4NQ4 A;  1VME A;  1DXK A;  2BMI A;  3ZNB A;  1WW1 A;  3SD9 A;  4RL2 A;  2I7T A;  5EVB A;  3FAI A;  2GMN A;  2NZF A;  5HIP A;  2FM6 A;  1VJN A;  4RAM A;  4ZO2 A;  5AHR A;  1XTO A;  4UA4 A;  4C1G A;  1WUP A;  2OHI A;  2BG8 A;  3SRX A;  2FHX A;  4Z5Y A;  1WRA A;  1ZTC A;  2QIN A;  2YCB A;  3X2X A;  2WRS A;  4GYQ A;  4D1T A;  2Q0J A;  3F9O A;  3L6N A;  2ZZI A;  2GFJ A;  4ZO3 A;  3I15 A;  2CBN A;  4EYL A;  4O98 A;  3KL7 A;  5FQA A;  3I13 A;  4DIK A;  2CG3 A;  4D1W A;  5B1U A;  1YCH A;  3KNS A;  5B15 A;  5LS3 A;  1ZNB A;  5HIS A;  1JJT A;  4UBQ A;  4H0D A;  2YNV B;  3DHB A;  5A87 A;  5LMC A;  4EYF A;  5EW0 A;  5ACT A; 
#chains in the Genus database with same CATH homology
 2I7X A;  2NXA A;  3T3O A;  3IEK A;  2QDS A;  3IEL A;  3RPC A;  1SML A;  2Y87 A;  3IE0 A;  5HH4 A;  3KNR A;  4C1E A;  5ACW A;  5LCF A;  5ACQ A;  1BVT A;  4UWR B;  3PG4 A;  4BP0 A;  2WYL A;  1DDK A;  5A5Z A;  2P4Z A;  2FU7 A;  5HIO A;  2ZWR A;  5FQB A;  1KR3 A;  5LSC A;  4AX0 B;  2YNT A;  5EH9 A;  5EWA A;  2BTN A;  4D1U A;  2AIO A;  2GKL A;  5FQC A;  4Z5Z A;  4GCW A;  1QH3 A;  2YNW A;  3I0V A;  2BG7 A;  5ACV A;  2BFZ A;  4NQ5 A;  5LCA A;  4Z6X A;  1DD6 A;  3QH8 A;  3RKK A;  2AZ4 A;  5LE1 A;  1KO2 A;  4EY2 A;  4TYT A;  4CHL A;  2YZ3 A;  5K4K A;  3SPU A;  4WD6 A;  3SW3 A;  5AXR A;  3WXC A;  3SFP A;  2GFK A;  1Y44 A;  2BGA A;  2BFK A;  2NYP A;  5KIL A;  2Q0I A;  3ADR A;  4RAW A;  3X2Z A;  1K07 A;  4YSK A;  4RBS A;  2BG2 A;  2YNU A;  3PY6 A;  4PVO A;  3I14 A;  5DPX A;  2FU9 A;  4P62 A;  5A0V A;  2I7V A;  3AF6 A;  2H6A A;  5AYA A;  2Y8B A;  4ZNB A;  2R2D A;  4C1F A;  3IOG A;  3BC2 A;  3RKJ A;  2Q9U A;  4TZE A;  2WYM C;  3VPE A;  2Y8A A;  4XUK A;  4KEQ A;  5ACS A;  3JXP A;  1XM8 A;  2OHJ A;  2ZNB A;  2XF4 A;  1M2X A;  4C1D A;  2P1E A;  5EV8 A;  4D02 A;  3PY5 A;  5K0W A;  3IE2 A;  4FSB A;  1ZKP A;  2BR6 A;  4HKY A;  3DH8 A;  3A4Y A;  4HL1 A;  2YNV A;  1E5D A;  1JJE A;  3Q6V A;  5B3R A;  1YCG A;  5EV6 A;  3BV6 A;  2BC2 A;  3SBL A;  2QDT A;  3DHA A;  5ACU A;  2FU8 A;  4DIL A;  3IOF A;  4UAM A;  2Q42 A;  3ZQ4 A;  5LM6 A;  3LVZ A;  1VGN A;  5IQK A;  4J5H A;  5EVK A;  5A0T A;  4XWT A;  1X8G A;  2QED A;  4FEK A;  3ZWF A;  3I11 A;  2VW8 A;  4LE6 A;  5ACP A;  4BZ3 A;  1WUO A;  2BG6 A;  2BG8 B;  4TZF A;  2FU6 A;  2FHX B;  4EXS A;  2NZE A;  2P18 A;  4NQ2 A;  5K4M A;  2UYX A;  1KO3 A;  4TZB A;  2DKF A;  5LCH A;  2FK6 A;  4TZ9 A;  4KEP A;  4XWW A;  4RM5 A;  2HB9 A;  1JT1 A;  4AX1 B;  1A8T A;  1BMC A;  3VQZ A;  2P97 A;  5ACX A;  4HL2 A;  4D1V A;  3BK2 A;  1BC2 A;  4Z7R A;  1HLK A;  2BIB A;  5K4N A;  3P2U A;  4TYF A;  3IE1 A;  1X8I A;  3DHC A;  2WHG A;  3ESH A;  4AWY B;  2E7Y A;  3AJ3 A;  5HH5 A;  4NQ6 A;  3X30 A;  4EFZ A;  5ACR A;  2QJS A;  2M5C A;  2ZO4 A;  3AF5 A;  4UWP B;  3IEM A;  1L9Y A;  2DOO A;  4YSB A;  5EVD A;  5EHT A;  4ZEJ A;  3TP9 A;  4EXY A;  2OHH A;  3MD7 A;  3G1P A;  4Z60 A;  3S0Z A;  3FCZ A;  4UWO B;  4PVT A;  5AEB A;  5AHO A;  4F6Z A;  4JO0 A;  1A7T A;  1P9E A;  5HIQ A;  4AWZ A;  5HH6 A;  4J5F A;  5KIK A;  3T3N A;  2A7M A;  1X8H A;  5AXO A;  2YNT B;  4F6H A;  4GYU A;  3ZR9 A;  4C1H A;  3BK1 A;  4EYB A;  4RL0 A;  4U4L A;  4UWS B;  5LLD A;  3H3E A;  4V0H A;  1QH5 A;  4AD9 A;  3T9M A;  4FR7 A;  2BFZ B;  1MQO A;  2BFL A;  2XR1 A;  3R2U A;  1YCF A;  3IDZ A;  3X2Y A;  2GCU A;  4B87 A;  4C1C A;  4YSL A;  4Z67 A;  2M5D A;  2WYM A;  4C09 A;  4NQ4 A;  1VME A;  1DXK A;  2BMI A;  3ZNB A;  1WW1 A;  3SD9 A;  4RL2 A;  2I7T A;  5EVB A;  3FAI A;  2GMN A;  2NZF A;  5HIP A;  2FM6 A;  1VJN A;  4RAM A;  4ZO2 A;  5AHR A;  1XTO A;  4UA4 A;  4C1G A;  1WUP A;  2OHI A;  2BG8 A;  3SRX A;  2FHX A;  4Z5Y A;  1WRA A;  1ZTC A;  2QIN A;  2YCB A;  3X2X A;  2WRS A;  4GYQ A;  4D1T A;  2Q0J A;  3F9O A;  3L6N A;  2ZZI A;  2GFJ A;  4ZO3 A;  3I15 A;  2CBN A;  4EYL A;  4O98 A;  3KL7 A;  5FQA A;  3I13 A;  4DIK A;  4D1W A;  5B1U A;  1YCH A;  3KNS A;  5B15 A;  5LS3 A;  1ZNB A;  5HIS A;  1JJT A;  4UBQ A;  4H0D A;  2YNV B;  3DHB A;  5A87 A;  5LMC A;  4EYF A;  5EW0 A;  5ACT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...