4KEQA

Crystal structure of 4-pyridoxolactonase, 5-pyridoxolactone bound
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
270
structure length
270
Chain Sequence
DTKVYLLDGGSLVLDGYHVFWNRGPGGEVRFPVYSILIEHAEGRFLIDTGYDYDHVMKVLPFEKPIQEKHQTIPGALGLLGLEPRDIDVVVNSHFHFDHCGGNKYFPHAKKICHRSEVPQACNPQPFEHLGYSDLSFSAEAAEARGATAQLLEGTTRANSTFEGIDGDVDLARGVKLISTPGHSIGHYSLLVEFPRRKPILFTIDAAYTQKSLETLCQAAFHIDPVAGVNSMRKVKKLAEDHGAELMYSHDMDNFKTYRTGTQFYGHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-pyridoxolactonase
publication title Structure of 4-pyridoxolactonase from Mesorhizobium loti
doi rcsb
source organism Mesorhizobium loti
molecule tags Hydrolase
total genus 89
structure length 270
sequence length 270
ec nomenclature ec 3.1.1.27: 4-pyridoxolactonase.
pdb deposition date 2013-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4keqA00
5FQCA 3KNSA 2CBNA 2OHJA 4NQ5A 5ACRA 4UWRB 4PVOA 2P1EA 4D1VA 2DOOA 5EVDA 2OHHA 1L9YA 5EWAA 4WD6A 5B3RA 5A0VA 4H0DA 3RKJA 3IE2A 4KEQA 2FM6A 3AF5A 2P18A 2M5CA 4J5HA 4LE6A 4EXSA 1WUOA 2XF4A 3H3EA 3FAIA 1JT1A 4F6HA 1VJNA 1KO2A 1QH5A 3DHAA 3X2YA 2QDSA 5ACSA 4C1GA 2FK6A 2YNVB 5KILA 2VW8A 5A5ZA 2GMNA 4EY2A 5EV8A 5HIOA 4Z60A 4RBSA 4P62A 4EXYA 3SFPA 4HL1A 4F6ZA 2NZEA 2YZ3A 1YCFA 3T3OA 4D02A 2GKLA 3X30A 3FCZA 4ZO3A 4D1TA 4C1FA 1JJTA 4AD9A 5HIQA 5ACTA 5ACVA 2FU7A 4C1CA 2ZO4A 3VPEA 5ACQA 2YNVA 3BK2A 5K4MA 5HIPA 4TZFA 1P9EA 1X8HA 4CHLA 4XUKA 1SMLA 1KO3A 4BZ3A 4TYFA 4DILA 1K07A 5EHTA 5ACUA 3L6NA 4Z7RA 5AHOA 5DPXA 4D1UA 2BFLA 4RM5A 4RL2A 5K4NA 4TZ9A 2ZWRA 1HLKA 2BG8A 3DHCA 3PY6A 4UBQA 3Q6VA 4AX1B 2YCBA 3IOGA 5HH4A 4EYFA 2WYLA 2Y87A 2P4ZA 2NXAA 4RL0A 5LSCA 2QDTA 4FSBA 1ZKPA 3BC2A 2FU8A 3ZQ4A 4TZBA 3SD9A 2QEDA 3SPUA 4PVTA 3QH8A 5ACPA 1KR3A 4XWTA 4AWZA 2I7TA 5ACWA 4O98A 3IELA 2Y8AA 4HL2A 3AJ3A 3LVZA 1WUPA 4C1HA 3IEMA 2BMIA 1MQOA 5ACXA 1JJEA 3RKKA 5FQAA 3ZWFA 4GCWA 5A87A 2QINA 4JO0A 5K4KA 2A7MA 5EV6A 1BVTA 2Q42A 1QH3A 4DIKA 2FHXB 2QJSA 2P97A 1A7TA 4C1EA 1X8IA 3SBLA 5LCHA 2BG8B 3ZR9A 2YNWA 4EYLA 3DH8A 5B1UA 4EFZA 5LE1A 4ZO2A 4AWYB 1DD6A 3R2UA 3G1PA 3TP9A 4RAMA 2AIOA 5K0WA 4D1WA 5AXOA 4ZEJA 3I11A 4GYUA 2H6AA 1YCGA 3IDZA 2BG6A 5HH6A 5A0TA 1BC2A 2FHXA 2AZ4A 2OHIA 2Y8BA 3IE0A 2NZFA 4Z6XA 2BFZB 3VQZA 3I14A 2WYMC 1X8GA 3P2UA 5LLDA 5AYAA 3S0ZA 3KNRA 3I13A 3SRXA 1BMCA 4KEPA 5B15A 1YCHA 2GFJA 2UYXA 3I0VA 2GFKA 1WW1A 2DKFA 5IQKA 1M2XA 1DXKA 3ADRA 2Q0JA 3PY5A 2FU9A 1ZTCA 5HH5A 3PG4A 4Z5ZA 5FQBA 5EH9A 4XWWA 4UWSB 5LCAA 1ZNBA 2I7VA 5AEBA 2BGAA 2E7YA 2WHGA 3F9OA 4TYTA 3IE1A 2YNTB 3SW3A 4UWOB 4NQ2A 2BFZA 2FU6A 3AF6A 4YSKA 5KIKA 4Z5YA 3WXCA 3IOFA 1A8TA 1VGNA 4NQ4A 4V0HA 3MD7A 2GCUA 2HB9A 2WRSA 1Y44A 5HISA 4UA4A 1XTOA 4U4LA 3X2ZA 1E5DA 3X2XA 3KL7A 5AHRA 4GYQA 4FEKA 5EVKA 4YSLA 1VMEA 1WRAA 2BG2A 3BK1A 4ZNBA 2R2DA 4C09A 5EVBA 2ZNBA 2YNTA 3JXPA 2ZZIA 4AX0B 2BTNA 5LMCA 2Q0IA 2YNUA 4J5FA 5LM6A 1XM8A 3IEKA 3BV6A 3I15A 4BP0A 4TZEA 2BIBA 2NYPA 4EYBA 3ESHA 4RAWA 4FR7A 3T3NA 4HKYA 2WYMA 1DDKA 4NQ6A 5LCFA 3T9MA 4B87A 2BG7A 4UWPB 3ZNBA 2BFKA 2BR6A 5EW0A 3RPCA 4UAMA 4C1DA 5LS3A 3DHBA 2I7XA 2Q9UA 4YSBA 2BC2A 2M5DA 5AXRA 2XR1A 4Z67A 3A4YA
chains in the Genus database with same CATH superfamily
5FQCA 3KNSA 2CBNA 2OHJA 4NQ5A 5ACRA 4UWRB 4PVOA 2P1EA 4D1VA 2DOOA 5EVDA 2OHHA 1L9YA 5EWAA 4WD6A 5B3RA 5A0VA 4H0DA 3RKJA 3IE2A 4KEQA 2FM6A 3AF5A 2P18A 2M5CA 4J5HA 4LE6A 4EXSA 1WUOA 2XF4A 3H3EA 3FAIA 2CG2A 1JT1A 4F6HA 1VJNA 1KO2A 1QH5A 3DHAA 3X2YA 2QDSA 5ACSA 2CG3A 4C1GA 2FK6A 2YNVB 5KILA 2VW8A 5A5ZA 2GMNA 4EY2A 5EV8A 5HIOA 4Z60A 4RBSA 4P62A 5AJLA 4EXYA 3SFPA 4HL1A 4F6ZA 2NZEA 2YZ3A 1YCFA 3T3OA 4D02A 2GKLA 3X30A 3FCZA 4ZO3A 4D1TA 4C1FA 1JJTA 4PDXA 4AD9A 5HIQA 5ACTA 5ACVA 2FU7A 4C1CA 2ZO4A 3VPEA 5ACQA 2YNVA 3BK2A 5K4MA 5HIPA 4TZFA 1P9EA 1X8HA 4CHLA 4XUKA 1SMLA 1KO3A 4BZ3A 4TYFA 4DILA 1K07A 5EHTA 5ACUA 3L6NA 4Z7RA 5AHOA 5DPXA 4D1UA 2BFLA 4RM5A 4RL2A 5K4NA 4TZ9A 2ZWRA 1HLKA 2BG8A 3DHCA 3PY6A 4UBQA 3Q6VA 4AX1B 2YHEA 4AXHA 2YCBA 3IOGA 5HH4A 4EYFA 5A23A 2WYLA 2Y87A 2P4ZA 2NXAA 4RL0A 5LSCA 2QDTA 4FSBA 1ZKPA 3BC2A 2FU8A 3ZQ4A 4TZBA 3SD9A 2QEDA 3SPUA 4PVTA 3QH8A 5ACPA 1KR3A 4XWTA 4AWZA 2I7TA 5ACWA 4O98A 3IELA 2Y8AA 4HL2A 3AJ3A 3LVZA 1WUPA 4C1HA 3IEMA 2BMIA 1MQOA 5ACXA 1JJEA 3RKKA 5FQAA 3ZWFA 4GCWA 5A87A 2QINA 4JO0A 5K4KA 2A7MA 5EV6A 1BVTA 2Q42A 1QH3A 4DIKA 2FHXB 2QJSA 2P97A 1A7TA 4C1EA 1X8IA 3SBLA 5LCHA 2BG8B 3ZR9A 2YNWA 4EYLA 3DH8A 5B1UA 4EFZA 5LE1A 4ZO2A 4AWYB 1DD6A 3R2UA 3G1PA 3TP9A 4RAMA 2AIOA 5K0WA 4D1WA 2CFZA 5AXOA 4ZEJA 3I11A 4GYUA 2H6AA 1YCGA 3IDZA 2BG6A 5HH6A 5A0TA 1BC2A 2FHXA 2AZ4A 2OHIA 2Y8BA 3IE0A 2NZFA 4Z6XA 2BFZB 3VQZA 3I14A 2WYMC 1X8GA 4NURA 3P2UA 5LLDA 5AYAA 3S0ZA 3KNRA 3I13A 3SRXA 1BMCA 4KEPA 5B15A 1YCHA 2GFJA 2UYXA 3I0VA 2GFKA 1WW1A 2DKFA 5IQKA 1M2XA 1DXKA 3ADRA 2Q0JA 3PY5A 2FU9A 1ZTCA 5HH5A 3PG4A 4Z5ZA 5FQBA 5EH9A 4XWWA 4UWSB 5LCAA 1ZNBA 2I7VA 5AEBA 2BGAA 2E7YA 2WHGA 3F9OA 4TYTA 3IE1A 2YNTB 3SW3A 4UWOB 4NQ2A 2BFZA 2FU6A 3AF6A 4YSKA 5KIKA 4Z5YA 3WXCA 3IOFA 1A8TA 1VGNA 4NQ4A 4V0HA 3MD7A 2GCUA 2HB9A 2WRSA 1Y44A 5HISA 4UA4A 1XTOA 4U4LA 3X2ZA 1E5DA 3X2XA 3KL7A 5AHRA 4GYQA 4FEKA 5EVKA 4YSLA 1VMEA 1WRAA 2BG2A 3BK1A 4ZNBA 2R2DA 4C09A 5EVBA 2ZNBA 2YNTA 3JXPA 2ZZIA 4AX0B 2BTNA 5LMCA 2Q0IA 2YNUA 4J5FA 5LM6A 1XM8A 3IEKA 3BV6A 3I15A 4BP0A 4TZEA 2BIBA 2NYPA 4EYBA 3ESHA 4RAWA 4FR7A 3T3NA 4HKYA 2WYMA 5AIJA 1DDKA 4NQ6A 5LCFA 3T9MA 4B87A 2BG7A 4UWPB 3ZNBA 2BFKA 2BR6A 5EW0A 3RPCA 4UAMA 2CFUA 4C1DA 5LS3A 3DHBA 2I7XA 2Q9UA 4YSBA 2BC2A 2M5DA 5AXRA 2XR1A 4Z67A 3A4YA 4AV7A
chains in the Genus database with same CATH topology
5FQCA 3KNSA 2CBNA 2OHJA 4NQ5A 5ACRA 4UWRB 4PVOA 2P1EA 4D1VA 2DOOA 5EVDA 2OHHA 1L9YA 5EWAA 4WD6A 5B3RA 5A0VA 4H0DA 3RKJA 3IE2A 4KEQA 2FM6A 3AF5A 2P18A 2M5CA 4J5HA 4LE6A 4EXSA 1WUOA 2XF4A 3H3EA 3FAIA 1JT1A 4F6HA 1VJNA 1KO2A 1QH5A 3DHAA 3X2YA 2QDSA 5ACSA 4C1GA 2FK6A 2YNVB 5KILA 2VW8A 5A5ZA 2GMNA 4EY2A 5EV8A 5HIOA 4Z60A 4RBSA 4P62A 4EXYA 3SFPA 4HL1A 4F6ZA 2NZEA 2YZ3A 1YCFA 3T3OA 4D02A 2GKLA 3X30A 3FCZA 4ZO3A 4D1TA 4C1FA 1JJTA 4AD9A 5HIQA 5ACTA 5ACVA 2FU7A 4C1CA 2ZO4A 3VPEA 5ACQA 2YNVA 3BK2A 5K4MA 5HIPA 4TZFA 1P9EA 1X8HA 4CHLA 4XUKA 1SMLA 1KO3A 4BZ3A 4TYFA 4DILA 1K07A 5EHTA 5ACUA 3L6NA 4Z7RA 5AHOA 5DPXA 4D1UA 2BFLA 4RM5A 4RL2A 5K4NA 4TZ9A 2ZWRA 1HLKA 2BG8A 3DHCA 3PY6A 4UBQA 3Q6VA 4AX1B 2YCBA 3IOGA 5HH4A 4EYFA 2WYLA 2Y87A 2P4ZA 2NXAA 4RL0A 5LSCA 2QDTA 4FSBA 1ZKPA 3BC2A 2FU8A 3ZQ4A 4TZBA 3SD9A 2QEDA 3SPUA 4PVTA 3QH8A 5ACPA 1KR3A 4XWTA 4AWZA 2I7TA 5ACWA 4O98A 3IELA 2Y8AA 4HL2A 3AJ3A 3LVZA 1WUPA 4C1HA 3IEMA 2BMIA 1MQOA 5ACXA 1JJEA 3RKKA 5FQAA 3ZWFA 4GCWA 5A87A 2QINA 4JO0A 5K4KA 2A7MA 5EV6A 1BVTA 2Q42A 1QH3A 4DIKA 2FHXB 2QJSA 2P97A 1A7TA 4C1EA 1X8IA 3SBLA 5LCHA 2BG8B 3ZR9A 2YNWA 4EYLA 3DH8A 5B1UA 4EFZA 5LE1A 4ZO2A 4AWYB 1DD6A 3R2UA 3G1PA 3TP9A 4RAMA 2AIOA 5K0WA 4D1WA 5AXOA 4ZEJA 3I11A 4GYUA 2H6AA 1YCGA 3IDZA 2BG6A 5HH6A 5A0TA 1BC2A 2FHXA 2AZ4A 2OHIA 2Y8BA 3IE0A 2NZFA 4Z6XA 2BFZB 3VQZA 3I14A 2WYMC 1X8GA 3P2UA 5LLDA 5AYAA 3S0ZA 3KNRA 3I13A 3SRXA 1BMCA 4KEPA 5B15A 1YCHA 2GFJA 2UYXA 3I0VA 2GFKA 1WW1A 2DKFA 5IQKA 1M2XA 1DXKA 3ADRA 2Q0JA 3PY5A 2FU9A 1ZTCA 5HH5A 3PG4A 4Z5ZA 5FQBA 5EH9A 4XWWA 4UWSB 5LCAA 1ZNBA 2I7VA 5AEBA 2BGAA 2E7YA 2WHGA 3F9OA 4TYTA 3IE1A 2YNTB 3SW3A 4UWOB 4NQ2A 2BFZA 2FU6A 3AF6A 4YSKA 5KIKA 4Z5YA 3WXCA 3IOFA 1A8TA 1VGNA 4NQ4A 4V0HA 3MD7A 2GCUA 2HB9A 2WRSA 1Y44A 5HISA 4UA4A 1XTOA 4U4LA 3X2ZA 1E5DA 3X2XA 3KL7A 5AHRA 4GYQA 4FEKA 5EVKA 4YSLA 1VMEA 1WRAA 2BG2A 3BK1A 4ZNBA 2R2DA 4C09A 5EVBA 2ZNBA 2YNTA 3JXPA 2ZZIA 4AX0B 2BTNA 5LMCA 2Q0IA 2YNUA 4J5FA 5LM6A 1XM8A 3IEKA 3BV6A 3I15A 4BP0A 4TZEA 2BIBA 2NYPA 4EYBA 3ESHA 4RAWA 4FR7A 3T3NA 4HKYA 2WYMA 1DDKA 4NQ6A 5LCFA 3T9MA 4B87A 2BG7A 4UWPB 3ZNBA 2BFKA 2BR6A 5EW0A 3RPCA 4UAMA 4C1DA 5LS3A 3DHBA 2I7XA 2Q9UA 4YSBA 2BC2A 2M5DA 5AXRA 2XR1A 4Z67A 3A4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FQC A;  3KNS A;  2CBN A;  2OHJ A;  4NQ5 A;  5ACR A;  4UWR B;  4PVO A;  2P1E A;  4D1V A;  2DOO A;  5EVD A;  2OHH A;  1L9Y A;  5EWA A;  4WD6 A;  5B3R A;  5A0V A;  4H0D A;  3RKJ A;  3IE2 A;  4KEQ A;  2FM6 A;  3AF5 A;  2P18 A;  2M5C A;  4J5H A;  4LE6 A;  4EXS A;  1WUO A;  2XF4 A;  3H3E A;  3FAI A;  1JT1 A;  4F6H A;  1VJN A;  1KO2 A;  1QH5 A;  3DHA A;  3X2Y A;  2QDS A;  5ACS A;  4C1G A;  2FK6 A;  2YNV B;  5KIL A;  2VW8 A;  5A5Z A;  2GMN A;  4EY2 A;  5EV8 A;  5HIO A;  4Z60 A;  4RBS A;  4P62 A;  4EXY A;  3SFP A;  4HL1 A;  4F6Z A;  2NZE A;  2YZ3 A;  1YCF A;  3T3O A;  4D02 A;  2GKL A;  3X30 A;  3FCZ A;  4ZO3 A;  4D1T A;  4C1F A;  1JJT A;  4AD9 A;  5HIQ A;  5ACT A;  5ACV A;  2FU7 A;  4C1C A;  2ZO4 A;  3VPE A;  5ACQ A;  2YNV A;  3BK2 A;  5K4M A;  5HIP A;  4TZF A;  1P9E A;  1X8H A;  4CHL A;  4XUK A;  1SML A;  1KO3 A;  4BZ3 A;  4TYF A;  4DIL A;  1K07 A;  5EHT A;  5ACU A;  3L6N A;  4Z7R A;  5AHO A;  5DPX A;  4D1U A;  2BFL A;  4RM5 A;  4RL2 A;  5K4N A;  4TZ9 A;  2ZWR A;  1HLK A;  2BG8 A;  3DHC A;  3PY6 A;  4UBQ A;  3Q6V A;  4AX1 B;  2YCB A;  3IOG A;  5HH4 A;  4EYF A;  2WYL A;  2Y87 A;  2P4Z A;  2NXA A;  4RL0 A;  5LSC A;  2QDT A;  4FSB A;  1ZKP A;  3BC2 A;  2FU8 A;  3ZQ4 A;  4TZB A;  3SD9 A;  2QED A;  3SPU A;  4PVT A;  3QH8 A;  5ACP A;  1KR3 A;  4XWT A;  4AWZ A;  2I7T A;  5ACW A;  4O98 A;  3IEL A;  2Y8A A;  4HL2 A;  3AJ3 A;  3LVZ A;  1WUP A;  4C1H A;  3IEM A;  2BMI A;  1MQO A;  5ACX A;  1JJE A;  3RKK A;  5FQA A;  3ZWF A;  4GCW A;  5A87 A;  2QIN A;  4JO0 A;  5K4K A;  2A7M A;  5EV6 A;  1BVT A;  2Q42 A;  1QH3 A;  4DIK A;  2FHX B;  2QJS A;  2P97 A;  1A7T A;  4C1E A;  1X8I A;  3SBL A;  5LCH A;  2BG8 B;  3ZR9 A;  2YNW A;  4EYL A;  3DH8 A;  5B1U A;  4EFZ A;  5LE1 A;  4ZO2 A;  4AWY B;  1DD6 A;  3R2U A;  3G1P A;  3TP9 A;  4RAM A;  2AIO A;  5K0W A;  4D1W A;  5AXO A;  4ZEJ A;  3I11 A;  4GYU A;  2H6A A;  1YCG A;  3IDZ A;  2BG6 A;  5HH6 A;  5A0T A;  1BC2 A;  2FHX A;  2AZ4 A;  2OHI A;  2Y8B A;  3IE0 A;  2NZF A;  4Z6X A;  2BFZ B;  3VQZ A;  3I14 A;  2WYM C;  1X8G A;  3P2U A;  5LLD A;  5AYA A;  3S0Z A;  3KNR A;  3I13 A;  3SRX A;  1BMC A;  4KEP A;  5B15 A;  1YCH A;  2GFJ A;  2UYX A;  3I0V A;  2GFK A;  1WW1 A;  2DKF A;  5IQK A;  1M2X A;  1DXK A;  3ADR A;  2Q0J A;  3PY5 A;  2FU9 A;  1ZTC A;  5HH5 A;  3PG4 A;  4Z5Z A;  5FQB A;  5EH9 A;  4XWW A;  4UWS B;  5LCA A;  1ZNB A;  2I7V A;  5AEB A;  2BGA A;  2E7Y A;  2WHG A;  3F9O A;  4TYT A;  3IE1 A;  2YNT B;  3SW3 A;  4UWO B;  4NQ2 A;  2BFZ A;  2FU6 A;  3AF6 A;  4YSK A;  5KIK A;  4Z5Y A;  3WXC A;  3IOF A;  1A8T A;  1VGN A;  4NQ4 A;  4V0H A;  3MD7 A;  2GCU A;  2HB9 A;  2WRS A;  1Y44 A;  5HIS A;  4UA4 A;  1XTO A;  4U4L A;  3X2Z A;  1E5D A;  3X2X A;  3KL7 A;  5AHR A;  4GYQ A;  4FEK A;  5EVK A;  4YSL A;  1VME A;  1WRA A;  2BG2 A;  3BK1 A;  4ZNB A;  2R2D A;  4C09 A;  5EVB A;  2ZNB A;  2YNT A;  3JXP A;  2ZZI A;  4AX0 B;  2BTN A;  5LMC A;  2Q0I A;  2YNU A;  4J5F A;  5LM6 A;  1XM8 A;  3IEK A;  3BV6 A;  3I15 A;  4BP0 A;  4TZE A;  2BIB A;  2NYP A;  4EYB A;  3ESH A;  4RAW A;  4FR7 A;  3T3N A;  4HKY A;  2WYM A;  1DDK A;  4NQ6 A;  5LCF A;  3T9M A;  4B87 A;  2BG7 A;  4UWP B;  3ZNB A;  2BFK A;  2BR6 A;  5EW0 A;  3RPC A;  4UAM A;  4C1D A;  5LS3 A;  3DHB A;  2I7X A;  2Q9U A;  4YSB A;  2BC2 A;  2M5D A;  5AXR A;  2XR1 A;  4Z67 A;  3A4Y A; 
#chains in the Genus database with same CATH topology
 5FQC A;  3KNS A;  2CBN A;  2OHJ A;  4NQ5 A;  5ACR A;  4UWR B;  4PVO A;  2P1E A;  4D1V A;  2DOO A;  5EVD A;  2OHH A;  1L9Y A;  5EWA A;  4WD6 A;  5B3R A;  5A0V A;  4H0D A;  3RKJ A;  3IE2 A;  4KEQ A;  2FM6 A;  3AF5 A;  2P18 A;  2M5C A;  4J5H A;  4LE6 A;  4EXS A;  1WUO A;  2XF4 A;  3H3E A;  3FAI A;  2CG2 A;  1JT1 A;  4F6H A;  1VJN A;  1KO2 A;  1QH5 A;  3DHA A;  3X2Y A;  2QDS A;  5ACS A;  2CG3 A;  4C1G A;  2FK6 A;  2YNV B;  5KIL A;  2VW8 A;  5A5Z A;  2GMN A;  4EY2 A;  5EV8 A;  5HIO A;  4Z60 A;  4RBS A;  4P62 A;  5AJL A;  4EXY A;  3SFP A;  4HL1 A;  4F6Z A;  2NZE A;  2YZ3 A;  1YCF A;  3T3O A;  4D02 A;  2GKL A;  3X30 A;  3FCZ A;  4ZO3 A;  4D1T A;  4C1F A;  1JJT A;  4PDX A;  4AD9 A;  5HIQ A;  5ACT A;  5ACV A;  2FU7 A;  4C1C A;  2ZO4 A;  3VPE A;  5ACQ A;  2YNV A;  3BK2 A;  5K4M A;  5HIP A;  4TZF A;  1P9E A;  1X8H A;  4CHL A;  4XUK A;  1SML A;  1KO3 A;  4BZ3 A;  4TYF A;  4DIL A;  1K07 A;  5EHT A;  5ACU A;  3L6N A;  4Z7R A;  5AHO A;  5DPX A;  4D1U A;  2BFL A;  4RM5 A;  4RL2 A;  5K4N A;  4TZ9 A;  2ZWR A;  1HLK A;  2BG8 A;  3DHC A;  3PY6 A;  4UBQ A;  3Q6V A;  4AX1 B;  2YHE A;  4AXH A;  2YCB A;  3IOG A;  5HH4 A;  4EYF A;  5A23 A;  2WYL A;  2Y87 A;  2P4Z A;  2NXA A;  4RL0 A;  5LSC A;  2QDT A;  4FSB A;  1ZKP A;  3BC2 A;  2FU8 A;  3ZQ4 A;  4TZB A;  3SD9 A;  2QED A;  3SPU A;  4PVT A;  3QH8 A;  5ACP A;  1KR3 A;  4XWT A;  4AWZ A;  2I7T A;  5ACW A;  4O98 A;  3IEL A;  2Y8A A;  4HL2 A;  3AJ3 A;  3LVZ A;  1WUP A;  4C1H A;  3IEM A;  2BMI A;  1MQO A;  5ACX A;  1JJE A;  3RKK A;  5FQA A;  3ZWF A;  4GCW A;  5A87 A;  2QIN A;  4JO0 A;  5K4K A;  2A7M A;  5EV6 A;  1BVT A;  2Q42 A;  1QH3 A;  4DIK A;  2FHX B;  2QJS A;  2P97 A;  1A7T A;  4C1E A;  1X8I A;  3SBL A;  5LCH A;  2BG8 B;  3ZR9 A;  2YNW A;  4EYL A;  3DH8 A;  5B1U A;  4EFZ A;  5LE1 A;  4ZO2 A;  4AWY B;  1DD6 A;  3R2U A;  3G1P A;  3TP9 A;  4RAM A;  2AIO A;  5K0W A;  4D1W A;  2CFZ A;  5AXO A;  4ZEJ A;  3I11 A;  4GYU A;  2H6A A;  1YCG A;  3IDZ A;  2BG6 A;  5HH6 A;  5A0T A;  1BC2 A;  2FHX A;  2AZ4 A;  2OHI A;  2Y8B A;  3IE0 A;  2NZF A;  4Z6X A;  2BFZ B;  3VQZ A;  3I14 A;  2WYM C;  1X8G A;  4NUR A;  3P2U A;  5LLD A;  5AYA A;  3S0Z A;  3KNR A;  3I13 A;  3SRX A;  1BMC A;  4KEP A;  5B15 A;  1YCH A;  2GFJ A;  2UYX A;  3I0V A;  2GFK A;  1WW1 A;  2DKF A;  5IQK A;  1M2X A;  1DXK A;  3ADR A;  2Q0J A;  3PY5 A;  2FU9 A;  1ZTC A;  5HH5 A;  3PG4 A;  4Z5Z A;  5FQB A;  5EH9 A;  4XWW A;  4UWS B;  5LCA A;  1ZNB A;  2I7V A;  5AEB A;  2BGA A;  2E7Y A;  2WHG A;  3F9O A;  4TYT A;  3IE1 A;  2YNT B;  3SW3 A;  4UWO B;  4NQ2 A;  2BFZ A;  2FU6 A;  3AF6 A;  4YSK A;  5KIK A;  4Z5Y A;  3WXC A;  3IOF A;  1A8T A;  1VGN A;  4NQ4 A;  4V0H A;  3MD7 A;  2GCU A;  2HB9 A;  2WRS A;  1Y44 A;  5HIS A;  4UA4 A;  1XTO A;  4U4L A;  3X2Z A;  1E5D A;  3X2X A;  3KL7 A;  5AHR A;  4GYQ A;  4FEK A;  5EVK A;  4YSL A;  1VME A;  1WRA A;  2BG2 A;  3BK1 A;  4ZNB A;  2R2D A;  4C09 A;  5EVB A;  2ZNB A;  2YNT A;  3JXP A;  2ZZI A;  4AX0 B;  2BTN A;  5LMC A;  2Q0I A;  2YNU A;  4J5F A;  5LM6 A;  1XM8 A;  3IEK A;  3BV6 A;  3I15 A;  4BP0 A;  4TZE A;  2BIB A;  2NYP A;  4EYB A;  3ESH A;  4RAW A;  4FR7 A;  3T3N A;  4HKY A;  2WYM A;  5AIJ A;  1DDK A;  4NQ6 A;  5LCF A;  3T9M A;  4B87 A;  2BG7 A;  4UWP B;  3ZNB A;  2BFK A;  2BR6 A;  5EW0 A;  3RPC A;  4UAM A;  2CFU A;  4C1D A;  5LS3 A;  3DHB A;  2I7X A;  2Q9U A;  4YSB A;  2BC2 A;  2M5D A;  5AXR A;  2XR1 A;  4Z67 A;  3A4Y A;  4AV7 A; 
#chains in the Genus database with same CATH homology
 5FQC A;  3KNS A;  2CBN A;  2OHJ A;  4NQ5 A;  5ACR A;  4UWR B;  4PVO A;  2P1E A;  4D1V A;  2DOO A;  5EVD A;  2OHH A;  1L9Y A;  5EWA A;  4WD6 A;  5B3R A;  5A0V A;  4H0D A;  3RKJ A;  3IE2 A;  4KEQ A;  2FM6 A;  3AF5 A;  2P18 A;  2M5C A;  4J5H A;  4LE6 A;  4EXS A;  1WUO A;  2XF4 A;  3H3E A;  3FAI A;  1JT1 A;  4F6H A;  1VJN A;  1KO2 A;  1QH5 A;  3DHA A;  3X2Y A;  2QDS A;  5ACS A;  4C1G A;  2FK6 A;  2YNV B;  5KIL A;  2VW8 A;  5A5Z A;  2GMN A;  4EY2 A;  5EV8 A;  5HIO A;  4Z60 A;  4RBS A;  4P62 A;  4EXY A;  3SFP A;  4HL1 A;  4F6Z A;  2NZE A;  2YZ3 A;  1YCF A;  3T3O A;  4D02 A;  2GKL A;  3X30 A;  3FCZ A;  4ZO3 A;  4D1T A;  4C1F A;  1JJT A;  4AD9 A;  5HIQ A;  5ACT A;  5ACV A;  2FU7 A;  4C1C A;  2ZO4 A;  3VPE A;  5ACQ A;  2YNV A;  3BK2 A;  5K4M A;  5HIP A;  4TZF A;  1P9E A;  1X8H A;  4CHL A;  4XUK A;  1SML A;  1KO3 A;  4BZ3 A;  4TYF A;  4DIL A;  1K07 A;  5EHT A;  5ACU A;  3L6N A;  4Z7R A;  5AHO A;  5DPX A;  4D1U A;  2BFL A;  4RM5 A;  4RL2 A;  5K4N A;  4TZ9 A;  2ZWR A;  1HLK A;  2BG8 A;  3DHC A;  3PY6 A;  4UBQ A;  3Q6V A;  4AX1 B;  2YCB A;  3IOG A;  5HH4 A;  4EYF A;  2WYL A;  2Y87 A;  2P4Z A;  2NXA A;  4RL0 A;  5LSC A;  2QDT A;  4FSB A;  1ZKP A;  3BC2 A;  2FU8 A;  3ZQ4 A;  4TZB A;  3SD9 A;  2QED A;  3SPU A;  4PVT A;  3QH8 A;  5ACP A;  1KR3 A;  4XWT A;  4AWZ A;  2I7T A;  5ACW A;  4O98 A;  3IEL A;  2Y8A A;  4HL2 A;  3AJ3 A;  3LVZ A;  1WUP A;  4C1H A;  3IEM A;  2BMI A;  1MQO A;  5ACX A;  1JJE A;  3RKK A;  5FQA A;  3ZWF A;  4GCW A;  5A87 A;  2QIN A;  4JO0 A;  5K4K A;  2A7M A;  5EV6 A;  1BVT A;  2Q42 A;  1QH3 A;  4DIK A;  2FHX B;  2QJS A;  2P97 A;  1A7T A;  4C1E A;  1X8I A;  3SBL A;  5LCH A;  2BG8 B;  3ZR9 A;  2YNW A;  4EYL A;  3DH8 A;  5B1U A;  4EFZ A;  5LE1 A;  4ZO2 A;  4AWY B;  1DD6 A;  3R2U A;  3G1P A;  3TP9 A;  4RAM A;  2AIO A;  5K0W A;  4D1W A;  5AXO A;  4ZEJ A;  3I11 A;  4GYU A;  2H6A A;  1YCG A;  3IDZ A;  2BG6 A;  5HH6 A;  5A0T A;  1BC2 A;  2FHX A;  2AZ4 A;  2OHI A;  2Y8B A;  3IE0 A;  2NZF A;  4Z6X A;  2BFZ B;  3VQZ A;  3I14 A;  2WYM C;  1X8G A;  3P2U A;  5LLD A;  5AYA A;  3S0Z A;  3KNR A;  3I13 A;  3SRX A;  1BMC A;  4KEP A;  5B15 A;  1YCH A;  2GFJ A;  2UYX A;  3I0V A;  2GFK A;  1WW1 A;  2DKF A;  5IQK A;  1M2X A;  1DXK A;  3ADR A;  2Q0J A;  3PY5 A;  2FU9 A;  1ZTC A;  5HH5 A;  3PG4 A;  4Z5Z A;  5FQB A;  5EH9 A;  4XWW A;  4UWS B;  5LCA A;  1ZNB A;  2I7V A;  5AEB A;  2BGA A;  2E7Y A;  2WHG A;  3F9O A;  4TYT A;  3IE1 A;  2YNT B;  3SW3 A;  4UWO B;  4NQ2 A;  2BFZ A;  2FU6 A;  3AF6 A;  4YSK A;  5KIK A;  4Z5Y A;  3WXC A;  3IOF A;  1A8T A;  1VGN A;  4NQ4 A;  4V0H A;  3MD7 A;  2GCU A;  2HB9 A;  2WRS A;  1Y44 A;  5HIS A;  4UA4 A;  1XTO A;  4U4L A;  3X2Z A;  1E5D A;  3X2X A;  3KL7 A;  5AHR A;  4GYQ A;  4FEK A;  5EVK A;  4YSL A;  1VME A;  1WRA A;  2BG2 A;  3BK1 A;  4ZNB A;  2R2D A;  4C09 A;  5EVB A;  2ZNB A;  2YNT A;  3JXP A;  2ZZI A;  4AX0 B;  2BTN A;  5LMC A;  2Q0I A;  2YNU A;  4J5F A;  5LM6 A;  1XM8 A;  3IEK A;  3BV6 A;  3I15 A;  4BP0 A;  4TZE A;  2BIB A;  2NYP A;  4EYB A;  3ESH A;  4RAW A;  4FR7 A;  3T3N A;  4HKY A;  2WYM A;  1DDK A;  4NQ6 A;  5LCF A;  3T9M A;  4B87 A;  2BG7 A;  4UWP B;  3ZNB A;  2BFK A;  2BR6 A;  5EW0 A;  3RPC A;  4UAM A;  4C1D A;  5LS3 A;  3DHB A;  2I7X A;  2Q9U A;  4YSB A;  2BC2 A;  2M5D A;  5AXR A;  2XR1 A;  4Z67 A;  3A4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...